Citrus Sinensis ID: 041976


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-
MGLLIRSYQFFSLQLLLLHSLSYAKHCPREQSSALIQFKQLFSFDEDSSFVCQRSYPKMISWKKDTNCCSWDGVTCDMATGNVISLDLSCSWLHGNIPTNTSLFHLLHLQTLNLSHNDFDYSEISSGFSRFRNLTHFSLSDSNINCKIPYEISFLKMSTVVLDSLKNLSSSLTSLSLSDCILQGNFPINIFHLPNPQMIRLSQNPSLAGKFPANNWTSPIEYLDVSETSFSELPDSIGNLKLLGRLMLGYSQFVGPVPASLGNLTQLTLLHLMHNNFSGHIPSSLSNLVQLTYLDLSSNSFFGEIPDIFNLTQVSFFDLSNNQLAGPIPSHGSRLQNLVLIRLNNNSFSGTIPSWLFSLPLLEYVRLSDNQLSGHIDEFPSKSLQNIYLSNNRLQGSIPSSIFELVNLTDLQLDSNNFSGIAEPYMFAKLIKLKYLYLSHNSLSLGNTFKIDSPFPKFSYLSLSACNISAFPRFLRTQDELSYLDLSENKIDGQIPSWISEIGKDSLSYVNLSHNFITKMKQIPWKNLGYLDLRSNLLQGPLPVPPSSLRVLLISNNQFTGEIIHSICDIIALDVLDLSNNRLNGTIPECIGNFSPSLSVLDLRNNRLNGSIPGTFAESNWLRSLNLNNNELGGAIPQSLVNCTKVEVLDIGNIKINDAFPYWLGNLPELQVLVLRSNKFHGSVREFEPKESFPKLRILDLSINNFSGYLPERFLENLNAMRNVSADEGKLRYLGEEYYQDSVVVTLKGTEIEMQKILTVFTTIDFSSNGFDGEISQVIGKLHSLRLLNLSHNHFTGQIPSSLGNLAKLESLDLSSNNVAGKIPKPLTSLTSLSVLNLSHNRLDGPIPHGPQFNTFQEDSYIGNLGLCGFPLTKKCGNDEAPTTFHEEDEEAESSSSWFDW
cccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEccccccEEEEEcccccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEccccccccccEEEcccccccccccccccccccccEEEccccccEEEEccHHccccccccEEEccccEEccccccccccccccccEEEccccccccccHHccccccccEEEcccccccccccHHHHHcccccccEEEccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEcccccccccccHHHHHcccccEEEcccccccccccHHHcccccccEEEccccccEEEccccccccccccccEEEcccccccccccHHHHHcHHHccccccccccccccccccEEEEEEEEEcccHHHHHHcccccEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccccccccccHHccccccccccccccEEEEcccccEEEEEEccccccccccccccHHHccHHHcEEEccccccccccccHHHccccccEEEEcccccccccccHHHHcccccEEEEccccccccccEEEEcccccccccccHHHHccccccEEEccccccccccccHHccccccEEEEccccccccccHHHccccccEEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccccccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccEEEcccccccccccHHHHccccccEEEEccccccccccHHHHHccccccEEEEcccccEccccccccccccHHHEEEccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEEcccccccccccccccccEEEEccccccccccccccccEEEEEEccccccccccHHHccccccEEEEcccccccccccHHHHcccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEcccHHHHccccEEEEcccccccccccHHHHcccccEEEEEEccccccccccccccccccccEEEEEccccccccccHHHHHHHHHHHHHcccccccccccccEEHHHEEEEcccccHHHHHHccEEEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccccccHHHccHHHcccccEEEcccccccccccccccccccccccccccccEEcc
MGLLIRSYQFFSLQLLLLHSLsyakhcpreqsSALIQFKQlfsfdedssfvcqrsypkmiswkkdtnccswdgvtcdmatgnVISLDLScswlhgniptntsLFHLLHLQtlnlshndfdyseissgfsrfrnlthfslsdsninckipyEISFLKMSTVVLDSLKNLSSSLtslslsdcilqgnfpinifhlpnpqmirlsqnpslagkfpannwtspieyldvsetsfselpdsigNLKLLGRLMLGysqfvgpvpaslgnltQLTLLHLMHnnfsghipsslsnlvqltyldlssnsffgeipdifnltqvsffdlsnnqlagpipshgsrLQNLVLIRlnnnsfsgtipswlfslplleyvrlsdnqlsghidefpskslqniylsnnrlqgsipssIFELVNltdlqldsnnfsgiaEPYMFAKLIKLKYLYLSHnslslgntfkidspfpkfsylslsacnisafprflrtqdelsyldlsenkidgqipswISEIGKDSLSYVNLSHNFITKmkqipwknlgyldlrsnllqgplpvppsslRVLLISNNQFTGEIIHSICDIIALdvldlsnnrlngtipecignfspslsvldlrnnrlngsipgtfaesnWLRSLNLnnnelggaipqslvnctkvevldignikindafpywlgnlpeLQVLVLRSnkfhgsvrefepkesfpklrilDLSINNFSGYLPERFLENLNAMRNvsadegklrylgeeyyqdSVVVTLKGTEIEMQKILTVFTtidfssngfdgeISQVIGKLHSLRLlnlshnhftgqipsslgnlaklesldlssnnvagkipkpltsltslsvlnlshnrldgpiphgpqfntfqedsyignlglcgfpltkkcgndeapttfheedeeaesssswfdw
MGLLIRSYQFFSLQLLLLHSLSYAKHCPREQSSALIQFKQLFSFDEDSSFVCQRSYPKMISWKKDTNCCSWDGVTCDMATGNVISLDLSCSWLHGNIPTNTSLFHLLHLQTLNLSHNDFDYSEISSGFSRFRNLTHFSLSDSNINCKIPYEISFLKMSTVVLDSLKNLSSSLTSLSLSDCILQGNFPINIFHLPNPQMIRLSQNPSLAGKFPANNWTSPIEYLDVSETSFSELPDSIGNLKLLGRLMLGYSQFVGPVPASLGNLTQLTLLHLMHNNFSGHIPSSLSNLVQLTYLDLSSNSFFGEIPDIFNLTQVSFFDLSNNQLAGPIPSHGSRLQNLVLIRLNNNSFSGTIPSWLFSLPLLEYVRLSDNQLSGHIDEFPSKSLQNIYLSNNRLQGSIPSSIFELVNLTDLQLDSNNFSGIAEPYMFAKLIKLKYLYLSHNSLSLGNTFKIDSPFPKFSYLSLSACNISAFPRFLRTQDELSYLDLSENKIDGQIPSWISEIGKDSLSYVNLSHNFITKMKQIPWKNLGYLDLRSNLLQGPLPVPPSSLRVLLISNNQFTGEIIHSICDIIALDVLDLSNNRLNGTIPECIGNFSPSLSVLDLRNNRLNGSIPGTFAESNWLRSLNLNNNELGGAIPQSLVNCTKVEVLDIGNIKINDAFPYWLGNLPELQVLVLRSNKFHGSVrefepkesfpklriLDLSINNFSGYLPERFLENLNAMRNVSADEGKLRYLGEEYYQDSVVVTLKGTEIEMQKILTVFTTIDFSSNGFDGEISQVIGKLHSLRLLNLSHNHFTGQIPSSLGNLAKLESLDLSSNNVAGKIPKPLTSLTSLSVLNLSHNRLDGPIPHGPQFNTFQEDSYIGNLGLCGFPLTKKCGNDEAPTTfheedeeaesssswfdw
MGLLIRsyqffslqllllhslsyAKHCPREQSSALIQFKQLFSFDEDSSFVCQRSYPKMISWKKDTNCCSWDGVTCDMATGNVISLDLSCSWLHGNIPTNtslfhllhlqtlnlshnDFDYSEISSGFSRFRNLTHFSLSDSNINCKIPYEISFLKMSTVVldslknlsssltslslsDCILQGNFPINIFHLPNPQMIRLSQNPSLAGKFPANNWTSPIEYLDVSETSFSELPDSIGNLKLLGRLMLGYSQFVGPVPASlgnltqltllhlmhnnFSGHIPSSLSNLVQLTYLDLSSNSFFGEIPDIFNLTQVSFFDLSNNQLAGPIPSHGSRLQNLVLIRLNNNSFSGTIPSWLFSLPLLEYVRLSDNQLSGHIDEFPSKSLQNIYLSNNRLQGSIPSSIFELVNLTDLQLDSNNFSGIAEPYMFAKLIKLKYLYLSHNSLSLGNTFKIDSPFPKFSYLSLSACNISAFPRFLRTQDELSYLDLSENKIDGQIPSWISEIGKDSLSYVNLSHNFITKMKQIPWKNLGYLDLRSNLLQGplpvppsslrvllISNNQFTGEIIHSICDIIALDVLDLSNNRLNGTIPECIGNFSPSLSVLDLRNNRLNGSIPGTFAesnwlrslnlnnnelGGAIPQSLVNCTKVEVLDIGNIKINDAFPYWLGNLPELQVLVLRSNKFHGSVREFEPKESFPKLRILDLSINNFSGYLPERFLENLNAMRNVSADEGKLRYLGEEYYQDSVVVTLKGTEIEMQKILTVFTTIDFSSNGFDGEISQVIGKlhslrllnlshnhFTGQIPSSLGNLAKLESLDLSSNNVAGKIPKPltsltslsvlnlsHNRLDGPIPHGPQFNTFQEDSYIGNLGLCGFPLTKKCGNDEAPTTFHeedeeaessssWFDW
**LLIRSYQFFSLQLLLLHSLSYAKHCPREQSSALIQFKQLFSFDEDSSFVCQRSYPKMISWKKDTNCCSWDGVTCDMATGNVISLDLSCSWLHGNIPTNTSLFHLLHLQTLNLSHNDFDYSEISSGFSRFRNLTHFSLSDSNINCKIPYEISFLKMSTVVLDSLKNLSSSLTSLSLSDCILQGNFPINIFHLPNPQMIRLSQNPSLAGKFPANNWTSPIEYLDVSETSFSELPDSIGNLKLLGRLMLGYSQFVGPVPASLGNLTQLTLLHLMHNNFSGHIPSSLSNLVQLTYLDLSSNSFFGEIPDIFNLTQVSFFDLSNNQLAGPIPSHGSRLQNLVLIRLNNNSFSGTIPSWLFSLPLLEYVRLSDNQLSGHIDEFPSKSLQNIYLSNNRLQGSIPSSIFELVNLTDLQLDSNNFSGIAEPYMFAKLIKLKYLYLSHNSLSLGNTFKIDSPFPKFSYLSLSACNISAFPRFLRTQDELSYLDLSENKIDGQIPSWISEIGKDSLSYVNLSHNFITKMKQIPWKNLGYLDLRSNLLQGPLPVPPSSLRVLLISNNQFTGEIIHSICDIIALDVLDLSNNRLNGTIPECIGNFSPSLSVLDLRNNRLNGSIPGTFAESNWLRSLNLNNNELGGAIPQSLVNCTKVEVLDIGNIKINDAFPYWLGNLPELQVLVLRSNKFHGSVREFEPKESFPKLRILDLSINNFSGYLPERFLENLNAMRNVSADEGKLRYLGEEYYQDSVVVTLKGTEIEMQKILTVFTTIDFSSNGFDGEISQVIGKLHSLRLLNLSHNHFTGQIPSSLGNLAKL******************TSLTSLSVLNLSHNRLDGPIPHGPQFNTFQEDSYIGNLGLCGFPLTKKC*************************
*G*LIRSYQFFSLQLLLLHSLSYAKHCPREQSSALIQFKQLFSFDEDSSFVCQRSYPKMISWKKDTNCCSWDGVTCDMATGNVISLDLSCSWLHGNIPTNTSLFHLLHLQTLNLSHNDFDYSEISSGFSRFRNLTHFSLSDSNINCKIPYEISFLKMSTVVLDSLKNLSSSLTSLSLSDCILQGNFPINIFHLPNPQMIRLSQNPSLAGKFPANNWTSPIEYLDVSETSFSELPDSIGNLKLLGRLMLGYSQFVGPVPASLGNLTQLTLLHLMHNNFSGHIPSSLSNLVQLTYLDLSSNSFFGEIPDIFNLTQVSFFDLSNNQLAGPIPSHGSRLQNLVLIRLNNNSFSGTIPSWLFSLPLLEYVRLSDNQLSGHIDEFPSKSLQNIYLSNNRLQGSIPSSIFELVNLTDLQLDSNNFSGIAEPYMFAKLIKLKYLYLSHNSLSLGNTFKIDSPFPKFSYLSLSACNISAFPRFLRTQDELSYLDLSENKIDGQIPSWISEIGKDSLSYVNLSHNFITKMKQIPWKNLGYLDLRSNLLQGPLPVPPSSLRVLLISNNQFTGEIIHSICDIIALDVLDLSNNRLNGTIPECIGNFSPSLSVLDLRNNRLNGSIPGTFAESNWLRSLNLNNNELGGAIPQSLVNCTKVEVLDIGNIKINDAFPYWLGNLPELQVLVLRSNKFHGSVREFEPKESFPKLRILDLSINNFSGYLPERFLENLNAMRN*******LRYLGEEYYQDSVVVTLKGTEIEMQKILTVFTTIDFSSNGFDGEISQVIGKLHSLRLLNLSHNHFTGQIPSSLGNLAKLESLDLSSNNVAGKIPKPLTSLTSLSVLNLSHNRLDGPIPHGPQFNTFQEDSYIGNLGLCGFP************************SSWFDW
MGLLIRSYQFFSLQLLLLHSLSYAKHCPREQSSALIQFKQLFSFDEDSSFVCQRSYPKMISWKKDTNCCSWDGVTCDMATGNVISLDLSCSWLHGNIPTNTSLFHLLHLQTLNLSHNDFDYSEISSGFSRFRNLTHFSLSDSNINCKIPYEISFLKMSTVVLDSLKNLSSSLTSLSLSDCILQGNFPINIFHLPNPQMIRLSQNPSLAGKFPANNWTSPIEYLDVSETSFSELPDSIGNLKLLGRLMLGYSQFVGPVPASLGNLTQLTLLHLMHNNFSGHIPSSLSNLVQLTYLDLSSNSFFGEIPDIFNLTQVSFFDLSNNQLAGPIPSHGSRLQNLVLIRLNNNSFSGTIPSWLFSLPLLEYVRLSDNQLSGHIDEFPSKSLQNIYLSNNRLQGSIPSSIFELVNLTDLQLDSNNFSGIAEPYMFAKLIKLKYLYLSHNSLSLGNTFKIDSPFPKFSYLSLSACNISAFPRFLRTQDELSYLDLSENKIDGQIPSWISEIGKDSLSYVNLSHNFITKMKQIPWKNLGYLDLRSNLLQGPLPVPPSSLRVLLISNNQFTGEIIHSICDIIALDVLDLSNNRLNGTIPECIGNFSPSLSVLDLRNNRLNGSIPGTFAESNWLRSLNLNNNELGGAIPQSLVNCTKVEVLDIGNIKINDAFPYWLGNLPELQVLVLRSNKFHGSVREFEPKESFPKLRILDLSINNFSGYLPERFLENLNAMRNVSADEGKLRYLGEEYYQDSVVVTLKGTEIEMQKILTVFTTIDFSSNGFDGEISQVIGKLHSLRLLNLSHNHFTGQIPSSLGNLAKLESLDLSSNNVAGKIPKPLTSLTSLSVLNLSHNRLDGPIPHGPQFNTFQEDSYIGNLGLCGFPLTKKCGNDEA********************
*GLLIRSYQFFSLQLLLLHSLSYAKHCPREQSSALIQFKQLFSFDEDSSFVCQRSYPKMISWKKDTNCCSWDGVTCDMATGNVISLDLSCSWLHGNIPTNTSLFHLLHLQTLNLSHNDFDYSEISSGFSRFRNLTHFSLSDSNINCKIPYEISFLKMSTVVLDSLKNLSSSLTSLSLSDCILQGNFPINIFHLPNPQMIRLSQNPSLAGKFPANNWTSPIEYLDVSETSFSELPDSIGNLKLLGRLMLGYSQFVGPVPASLGNLTQLTLLHLMHNNFSGHIPSSLSNLVQLTYLDLSSNSFFGEIPDIFNLTQVSFFDLSNNQLAGPIPSHGSRLQNLVLIRLNNNSFSGTIPSWLFSLPLLEYVRLSDNQLSGHIDEFPSKSLQNIYLSNNRLQGSIPSSIFELVNLTDLQLDSNNFSGIAEPYMFAKLIKLKYLYLSHNSLSLGNTFKIDSPFPKFSYLSLSACNISAFPRFLRTQDELSYLDLSENKIDGQIPSWISEIGKDSLSYVNLSHNFITKMKQIPWKNLGYLDLRSNLLQGPLPVPPSSLRVLLISNNQFTGEIIHSICDIIALDVLDLSNNRLNGTIPECIGNFSPSLSVLDLRNNRLNGSIPGTFAESNWLRSLNLNNNELGGAIPQSLVNCTKVEVLDIGNIKINDAFPYWLGNLPELQVLVLRSNKFHGSVREFEPKESFPKLRILDLSINNFSGYLPERFLENLNAMRNVSADEGKLRYLGEEYYQDSVVVTLKGTEIEMQKILTVFTTIDFSSNGFDGEISQVIGKLHSLRLLNLSHNHFTGQIPSSLGNLAKLESLDLSSNNVAGKIPKPLTSLTSLSVLNLSHNRLDGPIPHGPQFNTFQEDSYIGNLGLCGFPLTKKC*************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLLIRSYQFFSLQLLLLHSLSYAKHCPREQSSALIQFKQLFSFDEDSSFVCQRSYPKMISWKKDTNCCSWDGVTCDMATGNVISLDLSCSWLHGNIPTNTSLFHLLHLQTLNLSHNDFDYSEISSGFSRFRNLTHFSLSDSNINCKIPYEISFLKMSTVVLDSLKNLSSSLTSLSLSDCILQGNFPINIFHLPNPQMIRLSQNPSLAGKFPANNWTSPIEYLDVSETSFSELPDSIGNLKLLGRLMLGYSQFVGPVPASLGNLTQLTLLHLMHNNFSGHIPSSLSNLVQLTYLDLSSNSFFGEIPDIFNLTQVSFFDLSNNQLAGPIPSHGSRLQNLVLIRLNNNSFSGTIPSWLFSLPLLEYVRLSDNQLSGHIDEFPSKSLQNIYLSNNRLQGSIPSSIFELVNLTDLQLDSNNFSGIAEPYMFAKLIKLKYLYLSHNSLSLGNTFKIDSPFPKFSYLSLSACNISAFPRFLRTQDELSYLDLSENKIDGQIPSWISEIGKDSLSYVNLSHNFITKMKQIPWKNLGYLDLRSNLLQGPLPVPPSSLRVLLISNNQFTGEIIHSICDIIALDVLDLSNNRLNGTIPECIGNFSPSLSVLDLRNNRLNGSIPGTFAESNWLRSLNLNNNELGGAIPQSLVNCTKVEVLDIGNIKINDAFPYWLGNLPELQVLVLRSNKFHGSVREFEPKESFPKLRILDLSINNFSGYLPERFLENLNAMRNVSADEGKLRYLGEEYYQDSVVVTLKGTEIEMQKILTVFTTIDFSSNGFDGEISQVIGKLHSLRLLNLSHNHFTGQIPSSLGNLAKLESLDLSSNNVAGKIPKPLTSLTSLSVLNLSHNRLDGPIPHGPQFNTFQEDSYIGNLGLCGFPLTKKCGNDEAPTTFHEEDEEAESSSSWFDW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query901 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 no no 0.861 0.916 0.348 1e-120
C0LGQ5 1249 LRR receptor-like serine/ no no 0.836 0.603 0.332 1e-83
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.830 0.597 0.322 2e-75
Q9FL28 1173 LRR receptor-like serine/ no no 0.780 0.599 0.302 2e-69
Q9LP24 1120 Probable leucine-rich rep no no 0.762 0.613 0.291 2e-61
Q9LYN8 1192 Leucine-rich repeat recep no no 0.634 0.479 0.327 9e-61
C0LGS2 1136 Probable LRR receptor-lik no no 0.596 0.472 0.336 4e-57
Q9FZ59 1088 Leucine-rich repeat recep no no 0.641 0.531 0.328 1e-56
Q9SHI2 1101 Leucine-rich repeat recep no no 0.644 0.527 0.331 2e-56
Q9LVP0 1102 Probable leucine-rich rep no no 0.673 0.550 0.306 3e-56
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  434 bits (1115), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 321/922 (34%), Positives = 478/922 (51%), Gaps = 146/922 (15%)

Query: 3   LLIRSYQ--FFSLQL-----LLLHSL--SYAKHCPREQSSALIQFKQLFSFDEDSSFVCQ 53
           ++IRS++   FS ++     LL+HSL  S    C  +Q  AL++F+  F  +     + Q
Sbjct: 1   MMIRSHRHWVFSSRIIIFLSLLVHSLASSSPHFCRDDQRDALLEFRGEFPINASWHIMNQ 60

Query: 54  RSYPKMISWKKDTNCCSWDGVTCDMATGNVISLDLSCSWLHGNIPTNTSLFHLLHLQTLN 113
              P    W K T+CC W+GVTC+  +G VISLD+  ++L+  + TN+SLF L +L+ L+
Sbjct: 61  WRGP----WNKSTDCCLWNGVTCNDKSGQVISLDIPNTFLNNYLKTNSSLFKLQYLRHLD 116

Query: 114 LSHNDFDYSEISSGFSRFRNLTHFSLSDSNINCKIPYEISFLKMSTVVLDSLKNLSSSLT 173
           L++ +  Y EI S      NL+H +L +          + F K    +  S+ NL+  L 
Sbjct: 117 LTNCNL-YGEIPSSLG---NLSHLTLVN----------LYFNKFVGEIPASIGNLNQ-LR 161

Query: 174 SLSLSDCILQGNFPINIFHLPNPQMIRLSQNPSLAGKFPANNWTSPIEYLDVSETSFSEL 233
            L L++ +L G  P ++ +L     + L  N  L GK                      +
Sbjct: 162 HLILANNVLTGEIPSSLGNLSRLVNLELFSN-RLVGK----------------------I 198

Query: 234 PDSIGNLKLLGRLMLGYSQFVGPVPASLGNLTQLTLLHLMHNNFSGHIPSSLSNLVQLTY 293
           PDSIG+LK L  L L  +  +G +P+SLGNL+ L  L L HN   G +P+S+ NL++L  
Sbjct: 199 PDSIGDLKQLRNLSLASNNLIGEIPSSLGNLSNLVHLVLTHNQLVGEVPASIGNLIELRV 258

Query: 294 LDLSSNSFFGEIPDIF-NLTQVSFFDLSNNQLAGPIPSHGSRLQNLVLIRLNNNSFSGTI 352
           +   +NS  G IP  F NLT++S F LS+N      P   S   NL    ++ NSFSG  
Sbjct: 259 MSFENNSLSGNIPISFANLTKLSIFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNSFSGPF 318

Query: 353 PSWLFSLPLLEYVRLSDNQLSGHIDEFPSKS----LQNIYLSNNRLQGSIPSSIFELVNL 408
           P  L  +P LE + L +NQ +G I EF + S    LQ++ L  NRL G IP SI  L+NL
Sbjct: 319 PKSLLLIPSLESIYLQENQFTGPI-EFANTSSSTKLQDLILGRNRLHGPIPESISRLLNL 377

Query: 409 TDLQLDSNNFSGIAEPYMFAKLIKLKYLYLSHNSLSLGNTFKIDSPFPKFSYLSLSACNI 468
            +L +  NNF+G A P   +KL+ L +                                 
Sbjct: 378 EELDISHNNFTG-AIPPTISKLVNLLH--------------------------------- 403

Query: 469 SAFPRFLRTQDELSYLDLSENKIDGQIPSWISEIGKDSLSYVNLSHNFITKMKQIPWKN- 527
                          LDLS+N ++G++P+ +       L+ + LSHN  +  +    +  
Sbjct: 404 ---------------LDLSKNNLEGEVPACLWR-----LNTMVLSHNSFSSFENTSQEEA 443

Query: 528 -LGYLDLRSNLLQGPLPVPPSSLRVLLISNNQFTGEIIHSICDIIALDVLDLSNNRLNGT 586
            +  LDL SN  QGP+P                     + IC + +L  LDLSNN  +G+
Sbjct: 444 LIEELDLNSNSFQGPIP---------------------YMICKLSSLGFLDLSNNLFSGS 482

Query: 587 IPECIGNFSPSLSVLDLRNNRLNGSIPGTFAESNWLRSLNLNNNELGGAIPQSLVNCTKV 646
           IP CI NFS S+  L+L +N  +G++P  F+++  L SL++++N+L G  P+SL+NC  +
Sbjct: 483 IPSCIRNFSGSIKELNLGDNNFSGTLPDIFSKATELVSLDVSHNQLEGKFPKSLINCKAL 542

Query: 647 EVLDIGNIKINDAFPYWLGNLPELQVLVLRSNKFHGSVREFEPKESFPKLRILDLSINNF 706
           E++++ + KI D FP WL +LP L VL LRSNKF+G +        F  LRI+D+S NNF
Sbjct: 543 ELVNVESNKIKDIFPSWLESLPSLHVLNLRSNKFYGPLYHRHASIGFQSLRIIDISHNNF 602

Query: 707 SGYLPERFLENLNAMRNVSADEGKL-----RYLGEEYYQDSVVVTLKGTEIEMQKILTVF 761
           SG LP  +  N   M  ++ +  +      RY  + YY +  +V  KG ++  ++I   F
Sbjct: 603 SGTLPPYYFSNWKDMTTLTEEMDQYMTEFWRY-ADSYYHEMEMVN-KGVDMSFERIRRDF 660

Query: 762 TTIDFSSNGFDGEISQVIGKLHSLRLLNLSHNHFTGQIPSSLGNLAKLESLDLSSNNVAG 821
             IDFS N  +G I + +G L  LR+LNLS N FT  IP  L NL KLE+LD+S N ++G
Sbjct: 661 RAIDFSGNKINGNIPESLGYLKELRVLNLSGNAFTSVIPRFLANLTKLETLDISRNKLSG 720

Query: 822 KIPKPLTSLTSLSVLNLSHNRLDGPIPHGPQFNTFQEDSYIGNLGLCGFPLTKKCGNDEA 881
           +IP+ L +L+ LS +N SHN L GP+P G QF   +  S++ N GL G  L   C +  A
Sbjct: 721 QIPQDLAALSFLSYMNFSHNLLQGPVPRGTQFQRQKCSSFLDNPGLYG--LEDICRDTGA 778

Query: 882 --PTTFHEEDEEAESSSSWFDW 901
             PT+   ED  +E+  + F+W
Sbjct: 779 LNPTSQLPED-LSEAEENMFNW 799




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query901
2254621161001 PREDICTED: receptor-like protein 12-like 0.961 0.865 0.504 0.0
224116970921 predicted protein [Populus trichocarpa] 0.920 0.900 0.503 0.0
225455498980 PREDICTED: receptor-like protein 12-like 0.941 0.865 0.488 0.0
225459979979 PREDICTED: receptor-like protein 12-like 0.940 0.865 0.489 0.0
147793123951 hypothetical protein VITISV_032542 [Viti 0.941 0.891 0.487 0.0
359493546985 PREDICTED: LRR receptor-like serine/thre 0.940 0.859 0.485 0.0
359493544978 PREDICTED: receptor-like protein 12-like 0.938 0.865 0.485 0.0
3594935391001 PREDICTED: receptor-like protein 12-like 0.938 0.845 0.478 0.0
357493403 1015 Receptor-like protein kinase [Medicago t 0.945 0.839 0.439 0.0
357493511 1020 Receptor-like protein kinase [Medicago t 0.946 0.836 0.440 0.0
>gi|225462116|ref|XP_002263233.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  825 bits (2130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/961 (50%), Positives = 614/961 (63%), Gaps = 95/961 (9%)

Query: 10  FFSLQLLLLHSLSYA-KHCPREQSSALIQFKQLFSFD--EDSSFVCQ-RSYPKMISWKKD 65
           F S   ++  SLS + K CP  Q+ AL++ KQLFS D    SS  C   S+ K  +WK+ 
Sbjct: 10  FLSYSPVICFSLSNSTKLCPHHQNVALLRLKQLFSIDVSASSSDDCNLASFAKTDTWKEG 69

Query: 66  TNCCSWDGVTCDMATGNVISLDLSCSWLHGNIPTNTSLFHLLHLQTLNLSHNDFDYSEIS 125
           TNCCSWDGVTC+  TG +I LDLSCS L+G I +N+SLF L HL+ LNL+ NDF+ S IS
Sbjct: 70  TNCCSWDGVTCNRVTGLIIGLDLSCSGLYGTIDSNSSLFLLPHLRRLNLAFNDFNKSSIS 129

Query: 126 SGFSRFRNLTHFSLSDSNINCKIPYEISFLKMSTVVLD------------SLKNLSSSLT 173
           + F +FR +TH +LS S  +  I  EIS L  + V LD            S   L+ +LT
Sbjct: 130 AKFGQFRRMTHLNLSFSGFSGVIAPEISHLS-NLVSLDLSIYSGLGLETSSFIALARNLT 188

Query: 174 SLS---------------------------LSDCILQGNFPINIFHLPNPQMIRLSQNPS 206
            L                            LS C L G FP +   LPN ++++L  N  
Sbjct: 189 KLQKLHLRGINVSSILPISLLNLSSLRSMDLSSCQLYGRFPDDDLQLPNLKVLKLKGNHD 248

Query: 207 LAGKFPANNWTSPIEYLDVSETSFS-ELPDSIGNLKLLGRLMLGYSQFVGPVPASLGNLT 265
           L+G FP  N ++ +  LD+S T+FS ELP SIG LK L  L L  ++F G +P+S+G+L 
Sbjct: 249 LSGNFPKFNESNSMLLLDLSSTNFSGELPSSIGILKSLESLDLSSTKFSGELPSSIGSLK 308

Query: 266 QLTLLHLMHNNFSGHIPSSLSNLVQLTYLDLSSNSFFGEIPDIF---------------- 309
            L  L L H NFSG IPS L NL Q+T+LDLS N F GEI ++F                
Sbjct: 309 SLESLDLSHCNFSGSIPSVLGNLTQITHLDLSRNQFDGEISNVFNKIRKLIVLDLSSNSF 368

Query: 310 ---------NLTQVSFFDLSNNQLAGPIPSHGSRLQNLVLIRLNNNSFSGTIPSWLFSLP 360
                    NLT++SF DLSNN L G IPSH   L +L  I L+NN  +GTIPSWLFSLP
Sbjct: 369 RGQFIASLDNLTELSFLDLSNNNLEGIIPSHVKELSSLSDIHLSNNLLNGTIPSWLFSLP 428

Query: 361 LLEYVRLSDNQLSGHIDEFPSKSLQNIYLSNNRLQGSIPSSIFELVNLTDLQLDSNNFSG 420
            L  + LS N+L+GHIDEF S SL++I LS+N L G +PSSIFELVNLT LQL SNN  G
Sbjct: 429 SLIRLDLSHNKLNGHIDEFQSPSLESIDLSSNELDGPVPSSIFELVNLTYLQLSSNNLGG 488

Query: 421 IAEPYMFAKLIKLKYLYLSHNSLSLGNTFKIDSPFPKFSYLSLSACNISAFPRFLRTQDE 480
           I E  MF  L  L YL LS+N L+L N    +   P    L LS+CNIS FPRFL +Q+ 
Sbjct: 489 IVETDMFMNLENLVYLDLSYNILTLSNYSHSNCALPFLETLLLSSCNISEFPRFLCSQEV 548

Query: 481 LSYLDLSENKIDGQIPSWISEIGKDSLSYVNLSHNFITKMKQIPWKNLGYLDLRSNLLQG 540
           L +LDLS NKI GQ+P W   +G ++LSY NLS N +T+ ++ PWKN+ +LDL SNLLQG
Sbjct: 549 LEFLDLSNNKIYGQLPKWAWNMGTETLSYFNLSQNLLTRFERFPWKNMLFLDLHSNLLQG 608

Query: 541 PLPVPPSSLRVLLISNNQFTGEIIHSICDIIALDVLDLSNNRLNGTIPECIGNFSPSLSV 600
           PLP                       IC++  + VLD SNN L+G IP+C+GNFS SLSV
Sbjct: 609 PLP---------------------SLICEMSYISVLDFSNNNLSGLIPQCLGNFSESLSV 647

Query: 601 LDLRNNRLNGSIPGTFAESNWLRSLNLNNNELGGAIPQSLVNCTKVEVLDIGNIKINDAF 660
           LDLR N+L+G+IP TF++ N++R+L  N N+L G +P+SL+NC +++VLD+GN +IND F
Sbjct: 648 LDLRMNQLHGNIPETFSKGNFIRNLGFNGNQLEGPLPRSLINCRRLQVLDLGNNRINDTF 707

Query: 661 PYWLGNLPELQVLVLRSNKFHGSVREFEPKESFPKLRILDLSINNFSGYLPERFLENLNA 720
           PYWL  LPELQVL+LRSN+FHG +     +  FPKLRI+DLS N+FSG LPE +L+N  A
Sbjct: 708 PYWLETLPELQVLILRSNRFHGHISGSNFQFPFPKLRIMDLSRNDFSGSLPEMYLKNFKA 767

Query: 721 MRNVSADEGKLRYLGEEYYQDSVVVTLKGTEIEMQKILTVFTTIDFSSNGFDGEISQVIG 780
           M NV+ D+ KL+Y+GE YY+DS++ T+KG + E   IL+ FTTID SSN F GEI   IG
Sbjct: 768 MMNVTEDKMKLKYMGEYYYRDSIMGTIKGFDFEFV-ILSTFTTIDLSSNRFQGEILDFIG 826

Query: 781 KLHSLRLLNLSHNHFTGQIPSSLGNLAKLESLDLSSNNVAGKIPKPLTSLTSLSVLNLSH 840
            L SLR LNLSHN+ TG IPSSLGNL  LESLDLSSN ++G+IP+ LTSLT L VLNLS 
Sbjct: 827 SLSSLRELNLSHNNLTGHIPSSLGNLMVLESLDLSSNKLSGRIPRELTSLTFLEVLNLSK 886

Query: 841 NRLDGPIPHGPQFNTFQEDSYIGNLGLCGFPLTKKCGNDEAPTTFHEEDEEAESSSSWFD 900
           N L G IP G QF+TF  +SY GN+GLCG PL+KKC  DEAP    EE+ E+++    FD
Sbjct: 887 NHLTGVIPRGNQFDTFANNSYSGNIGLCGLPLSKKCVVDEAPQPPKEEEVESDTG---FD 943

Query: 901 W 901
           W
Sbjct: 944 W 944




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224116970|ref|XP_002331797.1| predicted protein [Populus trichocarpa] gi|222874493|gb|EEF11624.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225455498|ref|XP_002264793.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225459979|ref|XP_002267546.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147793123|emb|CAN75335.1| hypothetical protein VITISV_032542 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493546|ref|XP_002267585.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493544|ref|XP_002267509.2| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493539|ref|XP_002267388.2| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357493403|ref|XP_003616990.1| Receptor-like protein kinase [Medicago truncatula] gi|355518325|gb|AES99948.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|357493511|ref|XP_003617044.1| Receptor-like protein kinase [Medicago truncatula] gi|355518379|gb|AET00003.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query901
TAIR|locus:2144392957 RLP53 "receptor like protein 5 0.915 0.862 0.343 2.7e-116
TAIR|locus:2085537894 RLP34 "AT3G11010" [Arabidopsis 0.892 0.899 0.345 6.8e-111
TAIR|locus:2825762994 RLP6 "AT1G45616" [Arabidopsis 0.763 0.692 0.381 4.6e-105
TAIR|locus:22050051019 RLP7 "AT1G47890" [Arabidopsis 0.745 0.659 0.376 1.2e-104
TAIR|locus:2046585808 RLP27 "receptor like protein 2 0.658 0.733 0.378 2.9e-99
TAIR|locus:2119430741 RLP47 "receptor like protein 4 0.684 0.832 0.375 4.5e-98
TAIR|locus:2078102875 RLP33 "receptor like protein 3 0.742 0.764 0.362 5.2e-97
TAIR|locus:2046600800 RLP26 "receptor like protein 2 0.653 0.736 0.373 6.9e-96
TAIR|locus:2074633943 RLP35 "AT3G11080" [Arabidopsis 0.821 0.784 0.337 1e-93
TAIR|locus:2087253884 RLP39 "AT3G24900" [Arabidopsis 0.759 0.773 0.350 7e-93
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1146 (408.5 bits), Expect = 2.7e-116, P = 2.7e-116
 Identities = 305/888 (34%), Positives = 451/888 (50%)

Query:    27 CPREQSSALIQFKQLFSFDEDSSFVCQ----RSYPKMISWKKDTNCCSWDGVTCDMATGN 82
             C  EQ  AL+ FK  F   + S   C+     S  K  SW  +++CC+W+GVTC+  +G 
Sbjct:    37 CRPEQRDALLAFKNEFEIGKPSPDHCKIYGIESPRKTDSWGNNSDCCNWEGVTCNAKSGE 96

Query:    83 VISLDLSCSWLHGNIPTNXXXXXXXXXXXXXXXXXDFDYSEISSGFSRFRNLTHFSLSDS 142
             VI LDLSCS LHG   +N                 DF   +I+S      +LT+  LS +
Sbjct:    97 VIELDLSCSSLHGRFHSNSSIRNLHFLTTLDLSFNDFK-GQITSSIENLSHLTYLDLSSN 155

Query:   143 NINCKIPYEISFLKMSTVVXXXXXXXXXXXXXXXXXDCILQGNFPINIFHLPNPQMIRLS 202
             + + +I   I  L   T +                 D    G  P +I +L +   + LS
Sbjct:   156 HFSGQILNSIGNLSRLTYLNLF--------------DNQFSGQAPSSICNLSHLTFLDLS 201

Query:   203 QNPSLAGKFPAN-NWTSPIEYLDVSETSFS-ELPDSIGNLKLLGRLMLGYSQFVGPVPAS 260
              N    G+FP++    S +  L +    FS ++P SIGNL  L  L L  + F G +P+ 
Sbjct:   202 YN-RFFGQFPSSIGGLSHLTTLSLFSNKFSGQIPSSIGNLSNLTTLDLSNNNFSGQIPSF 260

Query:   261 XXXXXXXXXXXXXXXXFSGHIPSSLSNLVQLTYLDLSSNSFFGEIPDIF-NLTQVSFFDL 319
                             F G IPSS  NL QLT L +  N   G  P++  NLT +S   L
Sbjct:   261 IGNLSQLTFLGLFSNNFVGEIPSSFGNLNQLTRLYVDDNKLSGNFPNVLLNLTGLSLLSL 320

Query:   320 SNNQLAGPIPSHGSRLQNLVLIRLNNNSFSGTIPSWLFSLPLLEYVRLSDNQLSGHIDEF 379
             SNN+  G +P + + L NL+    ++N+F+GT PS+LF++P L Y+RL+ NQL G ++  
Sbjct:   321 SNNKFTGTLPPNITSLSNLMDFDASDNAFTGTFPSFLFTIPSLTYIRLNGNQLKGTLEFG 380

Query:   380 PSKSLQNIY---LSNNRLQGSIPSSIFELVNLTDLQLDSNNFSGIAEPYMFAKLIKLKYL 436
                S  N+Y   + NN   G IPSSI +LV L  L +   N  G  +  +F+ L  L  L
Sbjct:   381 NISSPSNLYELDIGNNNFIGPIPSSISKLVKLFRLDISHLNTQGPVDFSIFSHLKSLLDL 440

Query:   437 YLSHNSLSLGNTFKID-----SPFPKFSYLSLSACNISAFPRFLRTQDELSYLDLSENKI 491
              +SH    L  T +ID     S F +   L LS  ++SA  +     D  S L +    +
Sbjct:   441 NISH----LNTTTRIDLNYFLSYFKRLLLLDLSGNHVSATNKS-SVSDPPSQL-IQSLYL 494

Query:   492 DG----QIPSWISEIGKDSLSYVNLSHNFITKMK-QIP---WKN--LGYLDLRSNLLQGX 541
              G    + P ++    +  L ++++S+N   K+K Q+P   W+   L Y++L +N L G 
Sbjct:   495 SGCGITEFPEFVRT--QHELGFLDISNN---KIKGQVPDWLWRLPILYYVNLSNNTLIGF 549

Query:   542 XXXXXXXXXXXXI--SNNQFTGEIIHSICDIIALDVLDLSNNRLNGTIPECIGNFSPSLS 599
                         +  SNN F G+I   IC + +L+ LDLS+N  NG+IP C+G+   +LS
Sbjct:   550 QRPSKPEPSLLYLLGSNNNFIGKIPSFICGLRSLNTLDLSDNNFNGSIPRCMGHLKSTLS 609

Query:   600 VLDLRNNRLNGSIPGTFAXXXXXXXXXXXXXXXGGAIPQSLVNCTKVEVLDIGNIKINDA 659
             VL+LR N L+G +P                    G +P+SL   + +EVL++ + +IND 
Sbjct:   610 VLNLRQNHLSGGLPKQIFEILRSLDVGHNQLV--GKLPRSLSFFSTLEVLNVESNRINDT 667

Query:   660 FPYWLGNLPELQVLVLRSNKFHGSVREFEPKESFPKLRILDLSINNFSGYLPERFLENLN 719
             FP+WL +LP+LQVLVLRSN FHG + E     +FP+LRI+D+S N F+G LP  +    +
Sbjct:   668 FPFWLSSLPKLQVLVLRSNAFHGPIHE----ATFPELRIIDISHNRFNGTLPTEYFVKWS 723

Query:   720 AMRNV--SADEGKLRYLGEE-YYQDSVVVTLKGTEIEMQKILTVFTTIDFSSNGFDGEIS 776
             AM ++  + D+   +Y+G   YYQDS+V+  KG  +E+ +ILT++T +DFS N F+GEI 
Sbjct:   724 AMSSLGKNEDQSNEKYMGSGLYYQDSMVLMNKGVAMELVRILTIYTAVDFSGNRFEGEIP 783

Query:   777 QVIGKXXXXXXXXXXXXXFTGQIPSSLGNLAKLESLDLSSNNVAGKIPKPXXXXXXXXXX 836
             + IG              F+G +PSS+GNL  LESLD+S N + G+IP+           
Sbjct:   784 KSIGLLKELLVLSLSNNAFSGHMPSSMGNLTALESLDVSKNKLTGEIPQELGDLSFLAYM 843

Query:   837 XXXHNRLDGPIPHGPQFNTFQEDSYIGNLGLCGFPLTKKCGNDEAPTT 884
                HN+L G +P G QF T    ++  NLGL G  L + C +   P +
Sbjct:   844 NFSHNQLAGLVPGGQQFLTQNCSAFEDNLGLFGSSLEEVCRDIHTPAS 891




GO:0005576 "extracellular region" evidence=ISM
GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825762 RLP6 "AT1G45616" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046585 RLP27 "receptor like protein 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119430 RLP47 "receptor like protein 47" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046600 RLP26 "receptor like protein 26" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087253 RLP39 "AT3G24900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query901
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-64
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-56
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-19
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 7e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-05
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 5e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
COG5238388 COG5238, RNA1, Ran GTPase-activating protein (RanG 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  233 bits (597), Expect = 2e-64
 Identities = 194/596 (32%), Positives = 285/596 (47%), Gaps = 64/596 (10%)

Query: 286 SNLVQLTYLDLSSNSFFGEI-PDIFNLTQVSFFDLSNNQLAGPIPSHGSRL-QNLVLIRL 343
           +N  ++  +DLS  +  G+I   IF L  +   +LSNNQL+GPIP        +L  + L
Sbjct: 66  NNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNL 125

Query: 344 NNNSFSGTIPSWLFSLPLLEYVRLSDNQLSGHI--DEFPSKSLQNIYLSNNRLQGSIPSS 401
           +NN+F+G+IP    S+P LE + LS+N LSG I  D     SL+ + L  N L G IP+S
Sbjct: 126 SNNNFTGSIPRG--SIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNS 183

Query: 402 IFELVNLTDLQLDSNNFSGIAEPYMFAKLIKLKYLYLSHNSLSLGNTFKIDSPFPKFSYL 461
           +  L +L  L L SN   G   P    ++  LK++YL +N+LS    ++I       ++L
Sbjct: 184 LTNLTSLEFLTLASNQLVG-QIPRELGQMKSLKWIYLGYNNLSGEIPYEIGG-LTSLNHL 241

Query: 462 SLSACNISA-FPRFLRTQDELSYLDLSENKIDGQIPSWISEIGKDSLSYVNLSHNFITKM 520
            L   N++   P  L     L YL L +NK+ G IP  I  +                  
Sbjct: 242 DLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSL------------------ 283

Query: 521 KQIPWKNLGYLDLRSNLLQGPLP---VPPSSLRVLLISNNQFTGEIIHSICDIIALDVLD 577
                + L  LDL  N L G +P   +   +L +L + +N FTG+I  ++  +  L VL 
Sbjct: 284 -----QKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQ 338

Query: 578 LSNNRLNGTIPECIGNFSPSLSVLDLRNNRLNGSIPGTFAESNWLRSLNLNNNELGGAIP 637
           L +N+ +G IP+ +G  + +L+VLDL  N L G IP     S  L  L L +N L G IP
Sbjct: 339 LWSNKFSGEIPKNLGKHN-NLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIP 397

Query: 638 QSLVNCTKVEVLDIGNIKINDAFPYWLGNLPELQVLVLRSNKFHGSVREFEPKESFPKLR 697
           +SL  C  +  + + +   +   P     LP +  L + +N   G +     K   P L+
Sbjct: 398 KSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINS--RKWDMPSLQ 455

Query: 698 ILDLSINNFSGYLPERF----LENLNAMRNVSADEGKLRYLGEEYYQDSVVVTLKGTEIE 753
           +L L+ N F G LP+ F    LENL+  RN               +  +V   L      
Sbjct: 456 MLSLARNKFFGGLPDSFGSKRLENLDLSRN--------------QFSGAVPRKLGSLSEL 501

Query: 754 MQKILTVFTTIDFSSNGFDGEISQVIGKLHSLRLLNLSHNHFTGQIPSSLGNLAKLESLD 813
           MQ        +  S N   GEI   +     L  L+LSHN  +GQIP+S   +  L  LD
Sbjct: 502 MQ--------LKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLD 553

Query: 814 LSSNNVAGKIPKPLTSLTSLSVLNLSHNRLDGPIPHGPQFNTFQEDSYIGNLGLCG 869
           LS N ++G+IPK L ++ SL  +N+SHN L G +P    F      +  GN+ LCG
Sbjct: 554 LSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCG 609


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 901
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
PLN032101153 Resistant to P. syringae 6; Provisional 99.89
PLN032101153 Resistant to P. syringae 6; Provisional 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
KOG4237498 consensus Extracellular matrix protein slit, conta 99.84
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.68
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.66
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
PLN03150623 hypothetical protein; Provisional 99.54
PLN03150623 hypothetical protein; Provisional 99.33
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.06
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.06
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.05
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.04
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.03
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.01
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.99
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.97
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.93
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.93
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.9
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.89
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.87
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.82
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.79
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.78
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.76
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.74
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.72
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.35
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.34
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.33
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.32
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.05
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.05
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.02
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.02
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.99
KOG4341483 consensus F-box protein containing LRR [General fu 97.97
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.95
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.72
PRK15386426 type III secretion protein GogB; Provisional 97.7
PRK15386426 type III secretion protein GogB; Provisional 97.69
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.56
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.52
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.47
KOG4341483 consensus F-box protein containing LRR [General fu 97.31
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.29
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.17
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.0
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.57
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.55
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.28
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.01
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.99
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.01
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.95
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.5
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.31
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.23
KOG4308478 consensus LRR-containing protein [Function unknown 90.1
smart0037026 LRR Leucine-rich repeats, outliers. 89.48
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.48
smart0037026 LRR Leucine-rich repeats, outliers. 88.4
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.4
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 88.3
KOG4308478 consensus LRR-containing protein [Function unknown 87.36
KOG0473 326 consensus Leucine-rich repeat protein [Function un 86.6
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.53
KOG0473326 consensus Leucine-rich repeat protein [Function un 83.04
KOG3864221 consensus Uncharacterized conserved protein [Funct 82.0
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.3e-69  Score=674.68  Aligned_cols=583  Identities=35%  Similarity=0.565  Sum_probs=393.4

Q ss_pred             CHHHHHHHHHhhhcCcCCCCCccccccCCCcCCCCCCCCCCcCccceeecCCCCeEEEEEcCCCCCCCCCCCCcccccCc
Q 041976           28 PREQSSALIQFKQLFSFDEDSSFVCQRSYPKMISWKKDTNCCSWDGVTCDMATGNVISLDLSCSWLHGNIPTNTSLFHLL  107 (901)
Q Consensus        28 ~~~~~~~ll~~k~~~~~~~~~~~~~~~~~~~l~~w~~~~~~c~w~gv~c~~~~~~v~~l~L~~~~~~g~~~~~~~l~~l~  107 (901)
                      .++|++||++||+++.++.+          .+.+|..+++||.|.||+|+. .++|++|+|+++.+.|.+++  .+..++
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~----------~~~~w~~~~~~c~w~gv~c~~-~~~v~~L~L~~~~i~~~~~~--~~~~l~   93 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLK----------YLSNWNSSADVCLWQGITCNN-SSRVVSIDLSGKNISGKISS--AIFRLP   93 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcc----------cCCCCCCCCCCCcCcceecCC-CCcEEEEEecCCCccccCCh--HHhCCC
Confidence            56899999999999965433          678998888999999999985 57999999999999998877  788899


Q ss_pred             cCceEeCCCCCCCCCcCCcccc-CCCCCceeeCCCCcCCCCCCcccccccccccchhhcccCCCCccEEEcCCCcCCCCC
Q 041976          108 HLQTLNLSHNDFDYSEISSGFS-RFRNLTHFSLSDSNINCKIPYEISFLKMSTVVLDSLKNLSSSLTSLSLSDCILQGNF  186 (901)
Q Consensus       108 ~L~~L~Ls~n~~~~~~~~~~l~-~l~~L~~L~Ls~~~~~~~~p~~l~~l~~~~~~~~~~~~l~~~L~~L~Ls~~~~~~~~  186 (901)
                      +|++|+|++|.+.+. +|..+. ++++|++|+|++|++++.+|.  +.+              ++|++|++++|.+.+.+
T Consensus        94 ~L~~L~Ls~n~~~~~-ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l--------------~~L~~L~Ls~n~~~~~~  156 (968)
T PLN00113         94 YIQTINLSNNQLSGP-IPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSI--------------PNLETLDLSNNMLSGEI  156 (968)
T ss_pred             CCCEEECCCCccCCc-CChHHhccCCCCCEEECcCCccccccCc--ccc--------------CCCCEEECcCCcccccC
Confidence            999999999998876 776654 888999999998888887775  345              77888888888777777


Q ss_pred             ccccCCCCCCCEEeCCCCCCCCccCCCCCCCCCcceeecCCCCCccCCccccCCCCcCEEECCCCCCccCCCccccCCCC
Q 041976          187 PINIFHLPNPQMIRLSQNPSLAGKFPANNWTSPIEYLDVSETSFSELPDSIGNLKLLGRLMLGYSQFVGPVPASLGNLTQ  266 (901)
Q Consensus       187 p~~l~~l~~L~~L~L~~n~~l~~~~~~~~~~~~L~~L~Ls~~~l~~lp~~l~~l~~L~~L~L~~n~~~~~~p~~l~~l~~  266 (901)
                      |..++.+++|++|++++| .+.+.+|                      ..++++++|++|++++|.+.+.+|..++++++
T Consensus       157 p~~~~~l~~L~~L~L~~n-~l~~~~p----------------------~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~  213 (968)
T PLN00113        157 PNDIGSFSSLKVLDLGGN-VLVGKIP----------------------NSLTNLTSLEFLTLASNQLVGQIPRELGQMKS  213 (968)
T ss_pred             ChHHhcCCCCCEEECccC-cccccCC----------------------hhhhhCcCCCeeeccCCCCcCcCChHHcCcCC
Confidence            777777777777777777 5555555                      56666666666666666666666666666666


Q ss_pred             CCEEECCCCcCCCCCCccccCCCCCCEEEccCCcCcccCCC-CCCCCCCCEEECCCCCCCCCCCccccCCcCCcEEECcC
Q 041976          267 LTLLHLMHNNFSGHIPSSLSNLVQLTYLDLSSNSFFGEIPD-IFNLTQVSFFDLSNNQLAGPIPSHGSRLQNLVLIRLNN  345 (901)
Q Consensus       267 L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~~~-~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~  345 (901)
                      |++|++++|.+++.+|..++++++|++|++++|.+.+.+|. +.++++|++|++++|.+.+.+|..+..+++|++|++++
T Consensus       214 L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~  293 (968)
T PLN00113        214 LKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSD  293 (968)
T ss_pred             ccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcC
Confidence            66666666666666666666666666666666655544443 44444455555544444444444444444444444444


Q ss_pred             CcCcccCChhhcCCCCCcEEEccCCccccccCCCCCCCCCEEEccCccCCCCCchhhhcccccCceecccCcCCCccchh
Q 041976          346 NSFSGTIPSWLFSLPLLEYVRLSDNQLSGHIDEFPSKSLQNIYLSNNRLQGSIPSSIFELVNLTDLQLDSNNFSGIAEPY  425 (901)
Q Consensus       346 n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~  425 (901)
                      |.+.+.+|.                                              .+.++++|+.|++++|.+.+..+ .
T Consensus       294 n~l~~~~p~----------------------------------------------~~~~l~~L~~L~l~~n~~~~~~~-~  326 (968)
T PLN00113        294 NSLSGEIPE----------------------------------------------LVIQLQNLEILHLFSNNFTGKIP-V  326 (968)
T ss_pred             CeeccCCCh----------------------------------------------hHcCCCCCcEEECCCCccCCcCC-h
Confidence            444433333                                              34444444444444444443322 1


Q ss_pred             hhhhcCCCcEEEccCCccccccccccCCCCCCccEEecCCcCCCCCChhhccCCCCCEEeCCCCcccccCChhhhhcCCC
Q 041976          426 MFAKLIKLKYLYLSHNSLSLGNTFKIDSPFPKFSYLSLSACNISAFPRFLRTQDELSYLDLSENKIDGQIPSWISEIGKD  505 (901)
Q Consensus       426 ~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~L~~L~l~~~~l~~lp~~l~~~~~L~~L~ls~n~l~~~~p~~~~~~~~~  505 (901)
                      .+..+                                                ++|+.|++++|.+.+.+|..+  ... 
T Consensus       327 ~~~~l------------------------------------------------~~L~~L~L~~n~l~~~~p~~l--~~~-  355 (968)
T PLN00113        327 ALTSL------------------------------------------------PRLQVLQLWSNKFSGEIPKNL--GKH-  355 (968)
T ss_pred             hHhcC------------------------------------------------CCCCEEECcCCCCcCcCChHH--hCC-
Confidence            22222                                                223333333333322222222  000 


Q ss_pred             CccEEEcCCCccCCcccCCCCCCceeeccCccccCCCCCCCCCCcEEEccCCccccccccccccCCCCCEEECCCCcCcc
Q 041976          506 SLSYVNLSHNFITKMKQIPWKNLGYLDLRSNLLQGPLPVPPSSLRVLLISNNQFTGEIIHSICDIIALDVLDLSNNRLNG  585 (901)
Q Consensus       506 ~L~~L~ls~n~l~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~  585 (901)
                                                               ++|+.|++++|++++.+|..++.+++|+.|++++|.+.+
T Consensus       356 -----------------------------------------~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~  394 (968)
T PLN00113        356 -----------------------------------------NNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEG  394 (968)
T ss_pred             -----------------------------------------CCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecc
Confidence                                                     112222222222222333333344455555555555555


Q ss_pred             cCCcchhcCCCCccEEECCCCcccccCCcCccCCCccCEEEccCCcccccCCccccCCCcccEEeCCCCcCccCcccccc
Q 041976          586 TIPECIGNFSPSLSVLDLRNNRLNGSIPGTFAESNWLRSLNLNNNELGGAIPQSLVNCTKVEVLDIGNIKINDAFPYWLG  665 (901)
Q Consensus       586 ~~p~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~  665 (901)
                      .+|..+..+. +|+.|++++|++++..|                        ..|..+++|+.|++++|++.+.+|..+.
T Consensus       395 ~~p~~~~~~~-~L~~L~L~~n~l~~~~p------------------------~~~~~l~~L~~L~Ls~N~l~~~~~~~~~  449 (968)
T PLN00113        395 EIPKSLGACR-SLRRVRLQDNSFSGELP------------------------SEFTKLPLVYFLDISNNNLQGRINSRKW  449 (968)
T ss_pred             cCCHHHhCCC-CCCEEECcCCEeeeECC------------------------hhHhcCCCCCEEECcCCcccCccChhhc
Confidence            5555444443 55555555555544444                        4444455555555555555555555555


Q ss_pred             CCCCCcEEEccCCcCcccCCCCCCCCCCCCCcEEEcCCCccccCCcHHHHHhhHhhhcccccCCcccccCccceeceeEE
Q 041976          666 NLPELQVLVLRSNKFHGSVREFEPKESFPKLRILDLSINNFSGYLPERFLENLNAMRNVSADEGKLRYLGEEYYQDSVVV  745 (901)
Q Consensus       666 ~l~~L~~L~L~~n~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~~~~~~l~~L~~l~l~~~~~~~l~~~~~~~~~~~  745 (901)
                      .+++|++|++++|++.+.++...   ..++|+.|++++|++++.+|..+ .+                            
T Consensus       450 ~l~~L~~L~L~~n~~~~~~p~~~---~~~~L~~L~ls~n~l~~~~~~~~-~~----------------------------  497 (968)
T PLN00113        450 DMPSLQMLSLARNKFFGGLPDSF---GSKRLENLDLSRNQFSGAVPRKL-GS----------------------------  497 (968)
T ss_pred             cCCCCcEEECcCceeeeecCccc---ccccceEEECcCCccCCccChhh-hh----------------------------
Confidence            55555566666665555544432   34678888888888888777543 11                            


Q ss_pred             eecchhHHHhhhccceeEEEccccccccccchhhhccCCCCeEeCCCCcCCCCCCccccCCCCCCEEeCCCCccCCCCCc
Q 041976          746 TLKGTEIEMQKILTVFTTIDFSSNGFDGEISQVIGKLHSLRLLNLSHNHFTGQIPSSLGNLAKLESLDLSSNNVAGKIPK  825 (901)
Q Consensus       746 ~~~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~L~~L~~L~Ls~N~l~~~~p~  825 (901)
                                  ++.|++|+|++|++++.+|..++++++|++|+|++|.+++.+|..|+.+++|+.|||++|++++.+|.
T Consensus       498 ------------l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~  565 (968)
T PLN00113        498 ------------LSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPK  565 (968)
T ss_pred             ------------hhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCCh
Confidence                        46778999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcCCCCCCeeeCCCCcCccCCCCCCCCCCcccccccCCcCCCCCC
Q 041976          826 PLTSLTSLSVLNLSHNRLDGPIPHGPQFNTFQEDSYIGNLGLCGFP  871 (901)
Q Consensus       826 ~l~~l~~L~~L~Ls~N~l~g~iP~~~~~~~~~~~~~~~n~~lcg~~  871 (901)
                      .+..+++|+.|++++|++.|.+|..+++.++...++.||+++||.+
T Consensus       566 ~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        566 NLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             hHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            9999999999999999999999999999999999999999999865



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query901
3rgx_A768 Structural Insight Into Brassinosteroid Perception 5e-38
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-38
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 6e-13
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-06
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 4e-06
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 7e-05
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 1e-04
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 2e-04
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 2e-04
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 4e-04
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 7e-04
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 8e-04
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 8e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 156 bits (395), Expect = 5e-38, Method: Compositional matrix adjust. Identities = 178/629 (28%), Positives = 252/629 (40%), Gaps = 116/629 (18%) Query: 285 LSNLVQLTYLDLSSNSFFGEIPDIFNLTQVSFFDLSNNQLAGPIPSHGSRLQNLVLIRLN 344 +S V L +LD+SSN+F IP + + + + D+S N+L+G S L L+ ++ Sbjct: 196 VSRCVNLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNIS 255 Query: 345 NNSFSGTIPSWLFSLPL--LEYVRLSDNQLSGHIDEFPS---KSLQNIYLSNNRLQGSIP 399 +N F G IP LPL L+Y+ L++N+ +G I +F S +L + LS N G++P Sbjct: 256 SNQFVGPIPP----LPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVP 311 Query: 400 SSIFELVNLTDLQLDSNNFSGIAEPYMFAKLIKLKYLYLSHNSLSLGNTFKIDSPFPKFS 459 L L L SNNFSG K+ LK L LS N S Sbjct: 312 PFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFS--------------G 357 Query: 460 YLSLSACNISAFPRFLRTQDELSYLDLSENKIDGQIPSWISEIGKDSLSYVNLSHNFITK 519 L S N+SA L LDLS N G I + Sbjct: 358 ELPESLTNLSA---------SLLTLDLSSNNFSGPI---------------------LPN 387 Query: 520 MKQIPWKNLGYLDLRSNLLQGXXXXXXXXXXXXXISNNQFTGEIIHSICDIIALDVLDLS 579 + Q P L L L+ NN FTG+I ++ + L L LS Sbjct: 388 LCQNPKNTLQELYLQ---------------------NNGFTGKIPPTLSNCSELVSLHLS 426 Query: 580 NNRLNGTIPECIGNFSPSLSVLDLRNNRLNGSIPGTFAXXXXXXXXXXXXXXXGGAIPQS 639 N L+GTIP +G+ S L L L N L G IP G IP Sbjct: 427 FNYLSGTIPSSLGSLS-KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSG 485 Query: 640 LVNCTKVEVLDIGNIKINDAFPYWLGNLPELQVLVLRSNKFHGSVREFEPKE--SFPKLR 697 L NCT + + + N ++ P W+G L L +L L +N F G++ P E L Sbjct: 486 LSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNI----PAELGDCRSLI 541 Query: 698 ILDLSINNFSGYLPER-FLENLNAMRNVSADEGKLRY-------LGEEYYQDSVVVTLKG 749 LDL+ N F+G +P F ++ N A + RY + +E + ++ +G Sbjct: 542 WLDLNTNLFNGTIPAAMFKQSGKIAANFIAGK---RYVYIKNDGMKKECHGAGNLLEFQG 598 Query: 750 TEIEMQKILTV------------------------FTTIDFSSNGFDGEISQVIGKXXXX 785 E L+ +D S N G I + IG Sbjct: 599 IRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYL 658 Query: 786 XXXXXXXXXFTGQIPSSLGNLAKLESLDLSSNNVAGKIPKPXXXXXXXXXXXXXHNRLDG 845 +G IP +G+L L LDLSSN + G+IP+ +N L G Sbjct: 659 FILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSG 718 Query: 846 PIPHGPQFNTFQEDSYIGNLGLCGFPLTK 874 PIP QF TF ++ N GLCG+PL + Sbjct: 719 PIPEMGQFETFPPAKFLNNPGLCGYPLPR 747
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query901
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 0.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-108
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-58
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-22
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-77
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-72
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-62
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-52
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-20
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-76
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-70
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-67
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-66
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-54
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-49
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-42
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-28
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-28
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-67
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-63
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-61
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-56
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-53
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-52
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-34
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-32
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-18
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-66
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-61
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-57
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-44
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-36
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-26
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-65
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-61
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-58
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-43
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-33
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-21
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-62
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-54
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-54
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-43
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-40
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-31
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-15
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-52
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-44
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-41
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-33
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-46
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-46
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-45
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-40
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-45
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-41
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-38
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-37
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-42
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-40
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-38
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-35
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-42
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-39
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-37
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-41
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-20
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-32
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-32
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-31
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-31
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-31
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-31
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-28
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-22
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-30
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-27
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-22
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-17
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-16
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-30
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-29
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-30
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-30
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-24
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-24
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-16
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-11
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-29
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-28
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-18
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-28
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-28
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-17
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-27
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-24
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-24
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-23
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-19
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-26
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-24
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-21
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-25
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-24
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-23
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-22
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-22
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-18
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-17
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-15
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-22
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-21
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-19
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-05
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-08
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-15
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-13
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-13
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 6e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 5e-08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 9e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 7e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 6e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 7e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 8e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  556 bits (1436), Expect = 0.0
 Identities = 232/879 (26%), Positives = 345/879 (39%), Gaps = 141/879 (16%)

Query: 26  HCPREQSSALIQFKQLFSFDEDSSFVCQRSYPKMISWKKDTNCCSWDGVTCDMATGNVIS 85
                +   LI FK +                    W  + N C++DGVTC      V S
Sbjct: 8   QSLYREIHQLISFKDVLPDKNLLP-----------DWSSNKNPCTFDGVTCR--DDKVTS 54

Query: 86  LDLSCSWLHGNIPT-NTSLFHLLHLQTLNLSHNDFDYSEISSGFSRFRNLTHFSLSDSNI 144
           +DLS   L+      ++SL  L  L++L LS++  + S   SGF    +LT   LS +++
Sbjct: 55  IDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGS--VSGFKCSASLTSLDLSRNSL 112

Query: 145 NCKIPYEISFLKMSTVVLDSLKNLSSSLTSLSLSDCILQGNFPINIFHLPNPQMIRLSQN 204
           +  +             L SL + S  L  L++S   L     ++               
Sbjct: 113 SGPVT-----------TLTSLGSCSG-LKFLNVSSNTLDFPGKVSGG------------- 147

Query: 205 PSLAGKFPANNWTSPIEYLDVSETSFSELPDSIGNLKLLGRLMLGYSQFVGPVPASL--- 261
                                              L  L  L L  +   G         
Sbjct: 148 ---------------------------------LKLNSLEVLDLSANSISGANVVGWVLS 174

Query: 262 GNLTQLTLLHLMHNNFSGHIPSSLSNLVQLTYLDLSSNSFFGEIPDIFNLTQVSFFDLSN 321
               +L  L +  N  SG +   +S  V L +LD+SSN+F   IP + + + +   D+S 
Sbjct: 175 DGCGELKHLAISGNKISGDVD--VSRCVNLEFLDVSSNNFSTGIPFLGDCSALQHLDISG 232

Query: 322 NQLAGPIPSHGSRLQNLVLIRLNNNSFSGTIPSWLFSLPLLEYVRLSDNQLSGHIDEFPS 381
           N+L+G      S    L L+ +++N F G IP     L  L+Y+ L++N+ +G I +F S
Sbjct: 233 NKLSGDFSRAISTCTELKLLNISSNQFVGPIPP--LPLKSLQYLSLAENKFTGEIPDFLS 290

Query: 382 ---KSLQNIYLSNNRLQGSIPSSIFELVNLTDLQLDSNNFSGIAEPYMFAKLIKLKYLYL 438
               +L  + LS N   G++P        L  L L SNNFSG        K+  LK L L
Sbjct: 291 GACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDL 350

Query: 439 SHNSLSLGNTFKIDSPFPK-FSYLSLSACNISAFPRFLRTQDELSYLDLSENKIDGQIPS 497
           S N  S           P+  + LS S                L  LDLS N   G I  
Sbjct: 351 SFNEFS--------GELPESLTNLSAS----------------LLTLDLSSNNFSGPILP 386

Query: 498 WISEIGKDSLSYVNLSHNFITKMKQIP-----WKNLGYLDLRSNLLQGPLPVPP---SSL 549
            + +  K++L  + L +N  T   +IP        L  L L  N L G +P      S L
Sbjct: 387 NLCQNPKNTLQELYLQNNGFTG--KIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKL 444

Query: 550 RVLLISNNQFTGEIIHSICDIIALDVLDLSNNRLNGTIPECIGNFSPSLSVLDLRNNRLN 609
           R L +  N   GEI   +  +  L+ L L  N L G IP  + N + +L+ + L NNRL 
Sbjct: 445 RDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCT-NLNWISLSNNRLT 503

Query: 610 GSIPGTFAESNWLRSLNLNNNELGGAIPQSLVNCTKVEVLDIGNIKINDAFPYWLGNLPE 669
           G IP        L  L L+NN   G IP  L +C  +  LD+     N   P  +     
Sbjct: 504 GEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSG 563

Query: 670 LQVLVLRSNKFHGSVREFEPKESFPKLRILDLSINNFSGYLPERFLENLNAMRNVSADEG 729
                + +N   G    +   +   K      ++  F G   E+                
Sbjct: 564 K----IAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQL--------------N 605

Query: 730 KLRYLGEEYYQDSVVVTLKGTEIEMQKILTVFTTIDFSSNGFDGEISQVIGKLHSLRLLN 789
           +L         +       G              +D S N   G I + IG +  L +LN
Sbjct: 606 RLSTR---NPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILN 662

Query: 790 LSHNHFTGQIPSSLGNLAKLESLDLSSNNVAGKIPKPLTSLTSLSVLNLSHNRLDGPIPH 849
           L HN  +G IP  +G+L  L  LDLSSN + G+IP+ +++LT L+ ++LS+N L GPIP 
Sbjct: 663 LGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPE 722

Query: 850 GPQFNTFQEDSYIGNLGLCGFPLTKKCGNDEAPTTFHEE 888
             QF TF    ++ N GLCG+PL +   ++      H+ 
Sbjct: 723 MGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQR 761


>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query901
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.93
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.9
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.84
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.82
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.81
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.77
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.77
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.77
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.72
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.72
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.72
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.72
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.71
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.71
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.69
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.69
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.69
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.67
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.66
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.65
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.64
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.63
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.6
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.58
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.57
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.52
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.52
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.51
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.51
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.49
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.48
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.48
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.47
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.44
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.41
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.39
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.37
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.37
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.36
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.34
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.34
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.33
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.32
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.3
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.25
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.13
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.07
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.06
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.02
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.72
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.68
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.58
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.51
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.26
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.26
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.24
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.1
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.87
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.78
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.74
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.47
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.35
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=4.9e-91  Score=843.86  Aligned_cols=739  Identities=30%  Similarity=0.434  Sum_probs=553.4

Q ss_pred             cCCCCCCHHHHHHHHHhhhcCcCCCCCccccccCCCcCCCCCCCCCCcCccceeecCCCCeEEEEEcCCCCCCCC---CC
Q 041976           22 SYAKHCPREQSSALIQFKQLFSFDEDSSFVCQRSYPKMISWKKDTNCCSWDGVTCDMATGNVISLDLSCSWLHGN---IP   98 (901)
Q Consensus        22 ~~~~~~~~~~~~~ll~~k~~~~~~~~~~~~~~~~~~~l~~w~~~~~~c~w~gv~c~~~~~~v~~l~L~~~~~~g~---~~   98 (901)
                      .++..+.++||+|||+||+++.++.           .+++|..+++||.|+||+|+  +|+|++|+|++..+.|.   ++
T Consensus         4 ~~~~~~~~~~~~all~~k~~~~~~~-----------~l~~W~~~~~~C~w~gv~C~--~~~v~~L~L~~~~l~g~~~~l~   70 (768)
T 3rgz_A            4 ASPSQSLYREIHQLISFKDVLPDKN-----------LLPDWSSNKNPCTFDGVTCR--DDKVTSIDLSSKPLNVGFSAVS   70 (768)
T ss_dssp             ----CCHHHHHHHHHHHHTTCSCTT-----------SSTTCCTTSCGGGSTTEEEE--TTEEEEEECTTSCCCEEHHHHH
T ss_pred             CccccCCHHHHHHHHHHHhhCCCcc-----------cccCCCCCCCCcCCcceEEC--CCcEEEEECCCCCcCCccCccC
Confidence            3445567899999999999997432           58999988899999999998  69999999999999998   87


Q ss_pred             CCcccccCccCceEeCCCCCCCCCcCCccccCCCCCceeeCCCCcCCCCCCc--ccccccccccchhhcccCCCCccEEE
Q 041976           99 TNTSLFHLLHLQTLNLSHNDFDYSEISSGFSRFRNLTHFSLSDSNINCKIPY--EISFLKMSTVVLDSLKNLSSSLTSLS  176 (901)
Q Consensus        99 ~~~~l~~l~~L~~L~Ls~n~~~~~~~~~~l~~l~~L~~L~Ls~~~~~~~~p~--~l~~l~~~~~~~~~~~~l~~~L~~L~  176 (901)
                      +  ++.++++|+.++++.+.+..  +|+.++++++|++|+|++|.+.|.+|.  .++++              ++|++|+
T Consensus        71 ~--~l~~L~~L~~l~~~~~~~~~--l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l--------------~~L~~L~  132 (768)
T 3rgz_A           71 S--SLLSLTGLESLFLSNSHING--SVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSC--------------SGLKFLN  132 (768)
T ss_dssp             H--HTTTCTTCCEEECTTSCEEE--CCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGC--------------TTCCEEE
T ss_pred             h--hHhccCcccccCCcCCCcCC--CchhhccCCCCCEEECCCCcCCCcCCChHHHhCC--------------CCCCEEE
Confidence            7  89999999999999998744  678899999999999999999999998  89999              9999999


Q ss_pred             cCCCcCCCCCcccc-CCCCCCCEEeCCCCCCCCccCCC----CCCCCCcceeecCCCCCccCCccccCCCCcCEEECCCC
Q 041976          177 LSDCILQGNFPINI-FHLPNPQMIRLSQNPSLAGKFPA----NNWTSPIEYLDVSETSFSELPDSIGNLKLLGRLMLGYS  251 (901)
Q Consensus       177 Ls~~~~~~~~p~~l-~~l~~L~~L~L~~n~~l~~~~~~----~~~~~~L~~L~Ls~~~l~~lp~~l~~l~~L~~L~L~~n  251 (901)
                      +++|.+.+..|..+ .++++|++|++++| .+++..|.    +..+++|++|++++|.+..... +..+++|++|++++|
T Consensus       133 Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n-~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~-~~~l~~L~~L~Ls~n  210 (768)
T 3rgz_A          133 VSSNTLDFPGKVSGGLKLNSLEVLDLSAN-SISGANVVGWVLSDGCGELKHLAISGNKISGDVD-VSRCVNLEFLDVSSN  210 (768)
T ss_dssp             CCSSEEECCSSCCSCCCCTTCSEEECCSS-CCEEETHHHHHHTTCCTTCCEEECCSSEEESCCB-CTTCTTCCEEECCSS
T ss_pred             CcCCccCCcCCHHHhccCCCCCEEECCCC-ccCCcCChhhhhhccCCCCCEEECCCCcccccCC-cccCCcCCEEECcCC
Confidence            99999999888876 89999999999999 88887764    5778899999999998886533 378889999999999


Q ss_pred             CCccCCCccccCCCCCCEEECCCCcCCCCCCccccCCCCCCEEEccCCcCcccCCCCCCCCCCCEEECCCCCCCCCCCcc
Q 041976          252 QFVGPVPASLGNLTQLTLLHLMHNNFSGHIPSSLSNLVQLTYLDLSSNSFFGEIPDIFNLTQVSFFDLSNNQLAGPIPSH  331 (901)
Q Consensus       252 ~~~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~  331 (901)
                      .+.+.+|. ++++++|++|++++|.+++.+|..++.+++|++|++++|.+.+.+|.. .+++|++|++++|.+++.+|..
T Consensus       211 ~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~-~l~~L~~L~L~~n~l~~~ip~~  288 (768)
T 3rgz_A          211 NFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL-PLKSLQYLSLAENKFTGEIPDF  288 (768)
T ss_dssp             CCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC-CCTTCCEEECCSSEEEESCCCC
T ss_pred             cCCCCCcc-cccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc-ccCCCCEEECcCCccCCccCHH
Confidence            99887776 888999999999999998888888999999999999999888877766 7888999999999888888888


Q ss_pred             ccCC-cCCcEEECcCCcCcccCChhhcCCCCCcEEEccCCccccccCCC---CCCCCCEEEccCccCCCCCchhhhccc-
Q 041976          332 GSRL-QNLVLIRLNNNSFSGTIPSWLFSLPLLEYVRLSDNQLSGHIDEF---PSKSLQNIYLSNNRLQGSIPSSIFELV-  406 (901)
Q Consensus       332 ~~~l-~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~---~~~~L~~L~L~~n~l~~~~~~~~~~l~-  406 (901)
                      +... ++|++|++++|.+++.+|..++.+++|++|++++|.+.+.++..   .+++|++|++++|.+++.+|..+..++ 
T Consensus       289 ~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~  368 (768)
T 3rgz_A          289 LSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA  368 (768)
T ss_dssp             SCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTT
T ss_pred             HHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhc
Confidence            8765 88999999999888888888888888888888888777555431   445555555555555555555555554 


Q ss_pred             ccCceecccCcCCCccchhhhhhcCCCcEEEccCCccccccccccCCCCCCccEEecCCcCCC-CCChhhccCCCCCEEe
Q 041976          407 NLTDLQLDSNNFSGIAEPYMFAKLIKLKYLYLSHNSLSLGNTFKIDSPFPKFSYLSLSACNIS-AFPRFLRTQDELSYLD  485 (901)
Q Consensus       407 ~L~~L~L~~n~l~~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~L~~L~l~~~~l~-~lp~~l~~~~~L~~L~  485 (901)
                      +|++|++++|.+++..++ .+..                       ..+++|++|++++|+++ .+|..+..+++|++|+
T Consensus       369 ~L~~L~Ls~N~l~~~~~~-~~~~-----------------------~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~  424 (768)
T 3rgz_A          369 SLLTLDLSSNNFSGPILP-NLCQ-----------------------NPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH  424 (768)
T ss_dssp             TCSEEECCSSEEEEECCT-TTTC-----------------------STTCCCCEEECCSSEEEEECCGGGGGCTTCCEEE
T ss_pred             CCcEEEccCCCcCCCcCh-hhhh-----------------------cccCCccEEECCCCccccccCHHHhcCCCCCEEE
Confidence            555555555555443331 1111                       11344455555555444 4566677777777777


Q ss_pred             CCCCcccccCChhhhhcCCCCccEEEcCCCccCCcccCCCCCCceeeccCccccCCCCCCCCCCcEEEccCCcccccccc
Q 041976          486 LSENKIDGQIPSWISEIGKDSLSYVNLSHNFITKMKQIPWKNLGYLDLRSNLLQGPLPVPPSSLRVLLISNNQFTGEIIH  565 (901)
Q Consensus       486 ls~n~l~~~~p~~~~~~~~~~L~~L~ls~n~l~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~L~~L~l~~n~l~~~~~~  565 (901)
                      +++|++.+.+|..+  ..+                                          ++|++|++++|.+++.+|.
T Consensus       425 Ls~N~l~~~~p~~l--~~l------------------------------------------~~L~~L~L~~n~l~~~~p~  460 (768)
T 3rgz_A          425 LSFNYLSGTIPSSL--GSL------------------------------------------SKLRDLKLWLNMLEGEIPQ  460 (768)
T ss_dssp             CCSSEEESCCCGGG--GGC------------------------------------------TTCCEEECCSSCCCSCCCG
T ss_pred             CcCCcccCcccHHH--hcC------------------------------------------CCCCEEECCCCcccCcCCH
Confidence            77777777777665  222                                          3455555566666666777


Q ss_pred             ccccCCCCCEEECCCCcCcccCCcchhcCCCCccEEECCCCcccccCCcCccCCCccCEEEccCCcccccCCccccCCCc
Q 041976          566 SICDIIALDVLDLSNNRLNGTIPECIGNFSPSLSVLDLRNNRLNGSIPGTFAESNWLRSLNLNNNELGGAIPQSLVNCTK  645 (901)
Q Consensus       566 ~~~~l~~L~~L~Ls~n~l~~~~p~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~l~~l~~  645 (901)
                      .+..+++|++|++++|.+++.+|..+..+. +|++|++++|++++.+|..|+.+++|++|++++|++++.+|..+..+++
T Consensus       461 ~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~-~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~  539 (768)
T 3rgz_A          461 ELMYVKTLETLILDFNDLTGEIPSGLSNCT-NLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRS  539 (768)
T ss_dssp             GGGGCTTCCEEECCSSCCCSCCCGGGGGCT-TCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTT
T ss_pred             HHcCCCCceEEEecCCcccCcCCHHHhcCC-CCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCC
Confidence            777777777777777777777777777765 7777777777777777777777777777777777777777777777777


Q ss_pred             ccEEeCCCCcCccCccccccCCCCCcEEEccCCcCcccCCCCCCCCCCCCCcEEEcCCCccccCCcHHHHHhhHhhhccc
Q 041976          646 VEVLDIGNIKINDAFPYWLGNLPELQVLVLRSNKFHGSVREFEPKESFPKLRILDLSINNFSGYLPERFLENLNAMRNVS  725 (901)
Q Consensus       646 L~~L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~~~~~~l~~L~~l~  725 (901)
                      |++|++++|++++.+|.++.....+..+.+..+.-...+.... ...........+   .+.+..+.. +..+..+..++
T Consensus       540 L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~---~~~~~~~~~-~~~l~~~~~~~  614 (768)
T 3rgz_A          540 LIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDG-MKKECHGAGNLL---EFQGIRSEQ-LNRLSTRNPCN  614 (768)
T ss_dssp             CCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCS-CCTTCCSSEEEE---ECTTCCGGG-GGGGGGTCCSC
T ss_pred             CCEEECCCCccCCcCChHHhcccchhhhhcccccccccccccc-cccccccccccc---ccccccchh-hhccccccccc
Confidence            7777777777777777777666555444333211000000000 000000000000   122333322 12233333333


Q ss_pred             ccCCcccccCccceeceeEEeecchhHHHhhhccceeEEEccccccccccchhhhccCCCCeEeCCCCcCCCCCCccccC
Q 041976          726 ADEGKLRYLGEEYYQDSVVVTLKGTEIEMQKILTVFTTIDFSSNGFDGEISQVIGKLHSLRLLNLSHNHFTGQIPSSLGN  805 (901)
Q Consensus       726 l~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~  805 (901)
                      +..+.+.....                .....++.|+.|||++|+++|.+|..++++++|++|+|++|+++|.+|..|++
T Consensus       615 l~~~~~~g~~~----------------~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~  678 (768)
T 3rgz_A          615 ITSRVYGGHTS----------------PTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGD  678 (768)
T ss_dssp             TTSCEEEEECC----------------CSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGG
T ss_pred             cccceecccCc----------------hhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhC
Confidence            33322211100                01122678999999999999999999999999999999999999999999999


Q ss_pred             CCCCCEEeCCCCccCCCCCcCCcCCCCCCeeeCCCCcCccCCCCCCCCCCcccccccCCcCCCCCCCCCCCCCCCCCCCC
Q 041976          806 LAKLESLDLSSNNVAGKIPKPLTSLTSLSVLNLSHNRLDGPIPHGPQFNTFQEDSYIGNLGLCGFPLTKKCGNDEAPTTF  885 (901)
Q Consensus       806 L~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~iP~~~~~~~~~~~~~~~n~~lcg~~l~~~c~~~~~~~~~  885 (901)
                      +++|++|||++|+++|.+|+.+..+++|++|||++|+++|.||.++||.+|...+|.||+++||.|+. .|.... +.+|
T Consensus       679 L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~~-~~~~  756 (768)
T 3rgz_A          679 LRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RCDPSN-ADGY  756 (768)
T ss_dssp             CTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC-CCCSCC-----
T ss_pred             CCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc-CCCCCc-cCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999986 886544 4667


Q ss_pred             CC
Q 041976          886 HE  887 (901)
Q Consensus       886 ~~  887 (901)
                      +.
T Consensus       757 ~~  758 (768)
T 3rgz_A          757 AH  758 (768)
T ss_dssp             --
T ss_pred             CC
Confidence            63



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 901
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-27
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-09
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-07
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-10
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-11
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-04
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-04
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-07
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-07
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 2e-06
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 5e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.001
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.003
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.004
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.002
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score =  110 bits (276), Expect = 3e-27
 Identities = 70/320 (21%), Positives = 119/320 (37%), Gaps = 27/320 (8%)

Query: 27  CPREQSSALIQFKQLFSFDEDSSFVCQRSYPKMISWKKDTNCC--SWDGVTCDMATG--N 82
           C  +   AL+Q K+       ++           SW   T+CC  +W GV CD  T    
Sbjct: 3   CNPQDKQALLQIKK--DLGNPTTLS---------SWLPTTDCCNRTWLGVLCDTDTQTYR 51

Query: 83  VISLDLSCSWLHGNIPTNTSLFHLLHLQTLNLSHNDFDYSEISSGFSRFRNLTHFSLSDS 142
           V +LDLS   L    P  +SL +L +L  L +   +     I    ++   L +  ++ +
Sbjct: 52  VNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHT 111

Query: 143 NINCKIPYEISFLKMSTVVLDSLKNLS----------SSLTSLSLSDCILQGNFPINIFH 192
           N++  IP  +S +K    +  S   LS           +L  ++     + G  P +   
Sbjct: 112 NVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGS 171

Query: 193 LPNPQMIRLSQNPSLAGKFPANNWTSPIEYLDVSETSFSELPDSIGNLKLLGRLMLGYSQ 252
                         L GK P       + ++D+S          +       + +     
Sbjct: 172 FSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKN 231

Query: 253 FVGPVPASLGNLTQLTLLHLMHNNFSGHIPSSLSNLVQLTYLDLSSNSFFGEIPDIFNLT 312
            +      +G    L  L L +N   G +P  L+ L  L  L++S N+  GEIP   NL 
Sbjct: 232 SLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQ 291

Query: 313 QVSFFDLSNNQL--AGPIPS 330
           +      +NN+     P+P+
Sbjct: 292 RFDVSAYANNKCLCGSPLPA 311


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query901
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.84
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.7
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.69
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.68
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.65
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.62
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.49
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.47
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.36
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.36
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.36
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.34
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.34
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.33
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.14
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.1
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.09
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.07
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.06
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.92
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.49
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.15
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.61
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.97
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=3.8e-40  Score=352.53  Aligned_cols=293  Identities=27%  Similarity=0.423  Sum_probs=240.6

Q ss_pred             CCCHHHHHHHHHhhhcCcCCCCCccccccCCCcCCCCCCCCCCc--CccceeecCCC--CeEEEEEcCCCCCCCC--CCC
Q 041976           26 HCPREQSSALIQFKQLFSFDEDSSFVCQRSYPKMISWKKDTNCC--SWDGVTCDMAT--GNVISLDLSCSWLHGN--IPT   99 (901)
Q Consensus        26 ~~~~~~~~~ll~~k~~~~~~~~~~~~~~~~~~~l~~w~~~~~~c--~w~gv~c~~~~--~~v~~l~L~~~~~~g~--~~~   99 (901)
                      -|.++||+||++||+++.++.           .+++|..++|||  .|.||+|+..+  +||++|+|+++.+.|.  +|+
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~-----------~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~   70 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT-----------TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPS   70 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-----------GGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCG
T ss_pred             CCCHHHHHHHHHHHHHCCCCC-----------cCCCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCCh
Confidence            599999999999999998653           689999889999  49999998643  4899999999999884  566


Q ss_pred             CcccccCccCceEeCCC-CCCCCCcCCccccCCCCCceeeCCCCcCCCCCCcccccccccccchhhcccCCCCccEEEcC
Q 041976          100 NTSLFHLLHLQTLNLSH-NDFDYSEISSGFSRFRNLTHFSLSDSNINCKIPYEISFLKMSTVVLDSLKNLSSSLTSLSLS  178 (901)
Q Consensus       100 ~~~l~~l~~L~~L~Ls~-n~~~~~~~~~~l~~l~~L~~L~Ls~~~~~~~~p~~l~~l~~~~~~~~~~~~l~~~L~~L~Ls  178 (901)
                        .++++++|++|+|++ |++.+. +|+.|+++++|++|+|++|++.+..|..+..+              ..|++++++
T Consensus        71 --~l~~L~~L~~L~Ls~~N~l~g~-iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~--------------~~L~~l~l~  133 (313)
T d1ogqa_          71 --SLANLPYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQI--------------KTLVTLDFS  133 (313)
T ss_dssp             --GGGGCTTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGC--------------TTCCEEECC
T ss_pred             --HHhcCccccccccccccccccc-cccccccccccchhhhccccccccccccccch--------------hhhcccccc
Confidence              888888888888886 778776 88888888888888888888887777777777              888888888


Q ss_pred             CCcCCCCCccccCCCCCCCEEeCCCCCCCCccCCCCCCCCCcceeecCCCCCccCCccccCCCCc-CEEECCCCCCccCC
Q 041976          179 DCILQGNFPINIFHLPNPQMIRLSQNPSLAGKFPANNWTSPIEYLDVSETSFSELPDSIGNLKLL-GRLMLGYSQFVGPV  257 (901)
Q Consensus       179 ~~~~~~~~p~~l~~l~~L~~L~L~~n~~l~~~~~~~~~~~~L~~L~Ls~~~l~~lp~~l~~l~~L-~~L~L~~n~~~~~~  257 (901)
                      +|.+.+.+|..++++++|+++++++| .+.+.+|                      +.+..+..+ +.+++++|++++..
T Consensus       134 ~N~~~~~~p~~l~~l~~L~~l~l~~n-~l~~~ip----------------------~~~~~l~~l~~~l~~~~n~l~~~~  190 (313)
T d1ogqa_         134 YNALSGTLPPSISSLPNLVGITFDGN-RISGAIP----------------------DSYGSFSKLFTSMTISRNRLTGKI  190 (313)
T ss_dssp             SSEEESCCCGGGGGCTTCCEEECCSS-CCEEECC----------------------GGGGCCCTTCCEEECCSSEEEEEC
T ss_pred             cccccccCchhhccCcccceeecccc-ccccccc----------------------cccccccccccccccccccccccc
Confidence            88888888888888888888888888 7777766                      666666665 77888888888877


Q ss_pred             CccccCCCCCCEEECCCCcCCCCCCccccCCCCCCEEEccCCcCcccCCCCCCCCCCCEEECCCCCCCCCCCccccCCcC
Q 041976          258 PASLGNLTQLTLLHLMHNNFSGHIPSSLSNLVQLTYLDLSSNSFFGEIPDIFNLTQVSFFDLSNNQLAGPIPSHGSRLQN  337 (901)
Q Consensus       258 p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~  337 (901)
                      |..+..+..+ .+++..+...+.+|..+..+++++.+++++|.+.+.++.+..+++|+.|++++|+++|.+|.+++++++
T Consensus       191 ~~~~~~l~~~-~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~  269 (313)
T d1ogqa_         191 PPTFANLNLA-FVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKF  269 (313)
T ss_dssp             CGGGGGCCCS-EEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGGGCCCCTTCCEEECCSSCCEECCCGGGGGCTT
T ss_pred             cccccccccc-ccccccccccccccccccccccccccccccccccccccccccccccccccCccCeecccCChHHhCCCC
Confidence            7777766544 688888888888888888888888888888888877777777888888888888888888888888888


Q ss_pred             CcEEECcCCcCcccCChhhcCCCCCcEEEccCCc
Q 041976          338 LVLIRLNNNSFSGTIPSWLFSLPLLEYVRLSDNQ  371 (901)
Q Consensus       338 L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~  371 (901)
                      |++|+|++|+++|.+|+ ++++++|+.+++++|+
T Consensus       270 L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         270 LHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNK  302 (313)
T ss_dssp             CCEEECCSSEEEEECCC-STTGGGSCGGGTCSSS
T ss_pred             CCEEECcCCcccccCCC-cccCCCCCHHHhCCCc
Confidence            88888888888877774 5677777777777775



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure