Citrus Sinensis ID: 041977

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MQNMAGNTLQLHKRDLGILYVSMDPLIKTCNVERDITVTLTDSGICPDSEVESKIIGARYYPSSEAGNYTTRDIENHGTCTSSTTGGNEVKDVSFFWDWGKVLKEVVFLWQELRYIKSYASAAGVAVMTISIGHAHSLNIRDESIYNDLKFCWQLRFL
ccccccccEEEEEEccccccccccccccccccccccEEEEEcccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccEEHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHccc
cccccccHHHcccccccEEEEEcccccccccccccEEEEEEEcccccccccccEEEEEEEcccccccccccccccccccccccccccccccccEEEcccccHHHHHEEHHHHHHHHHHHHHHcccEEEEEEcccHHHccccccHHHHHHHHHHHHHcc
MQNMAGNTLQLHKRDLGIlyvsmdpliktcnvERDITVtltdsgicpdseveskiigaryypsseagnyttrdienhgtctssttggnevkdvsFFWDWGKVLKEVVFLWQELRYIKSYASAAGVAVMTISIGHahslnirdesiyNDLKFCWQLRFL
MQNMAGNTLQLHKRDLGILYVSMDPLIKTCNVERDITvtltdsgicpdseveskiigaryypSSEAGNYTTRDIENHGtctssttggneVKDVSFFWDWGKVLKEVVFLWQELRYIKSYASAAGVAVMTISIGHAHSLNIRDESIYNDLKFCWQLRFL
MQNMAGNTLQLHKRDLGILYVSMDPLIKTCNVERDITVTLTDSGICPDSEVESKIIGARYYPSSEAGNYTTRDIENHGTCTSSTTGGNEVKDVSFFWDWGKVLKEVVFLWQELRYIKSYASAAGVAVMTISIGHAHSLNIRDESIYNDLKFCWQLRFL
*********QLHKRDLGILYVSMDPLIKTCNVERDITVTLTDSGICPDSEVESKIIGARYYPSSEAGNYTTRDIENHGTCTSSTTGGNEVKDVSFFWDWGKVLKEVVFLWQELRYIKSYASAAGVAVMTISIGHAHSLNIRDESIYNDLKFCWQLRF*
*****GN*LQLHKRDLGILYVSMDPLIKTCNVERDITVTLTDSGICPDSEVESKIIGARYYPSSEAGNYTTRDIENHGTCTSSTTGGNEVKDVSFFWDWGKVLKEVVFLWQELRYIKSYASAAGVAVMTISIGHAHSLNIRDESIYNDLKFCWQLRFL
MQNMAGNTLQLHKRDLGILYVSMDPLIKTCNVERDITVTLTDSGICPDSEVESKIIGARYYPSSEAGNYTTRDIENHGTCTSSTTGGNEVKDVSFFWDWGKVLKEVVFLWQELRYIKSYASAAGVAVMTISIGHAHSLNIRDESIYNDLKFCWQLRFL
*******TLQLHKRDLGILYVSMDPLIKTCNVERDITVTLTDSGICPDSEVESKIIGARYYPSSE*************TCTSSTTGGNEVKDVSFFWDWGKVLKEVVFLWQELRYIKSYASAAGVAVMTISIGHAHSLNIRDESIYNDLKFCWQLRFL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQNMAGNTLQLHKRDLGILYVSMDPLIKTCNVERDITVTLTDSGICPDSEVESKIIGARYYPSSEAGNYTTRDIENHGTCTSSTTGGNEVKDVSFFWDWGKVLKEVVFLWQELRYIKSYASAAGVAVMTISIGHAHSLNIRDESIYNDLKFCWQLRFL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query158
147846613 668 hypothetical protein VITISV_010797 [Viti 0.702 0.166 0.287 4e-06
255558936 2072 peptidase, putative [Ricinus communis] g 0.715 0.054 0.300 1e-05
29028287 764 subtilase [Casuarina glauca] 0.715 0.147 0.3 3e-05
357512713 729 Subtilisin-like serine protease [Medicag 0.417 0.090 0.351 7e-05
357456041 736 Subtilisin-like serine protease [Medicag 0.392 0.084 0.388 8e-05
357498425 732 Subtilisin-like serine protease [Medicag 0.392 0.084 0.344 0.0002
357498403 715 Subtilisin-like serine protease [Medicag 0.392 0.086 0.344 0.0002
359478633 740 PREDICTED: cucumisin [Vitis vinifera] 0.702 0.15 0.266 0.0004
357450189 709 Subtilisin-like serine protease [Medicag 0.664 0.148 0.279 0.0004
297746066 703 unnamed protein product [Vitis vinifera] 0.702 0.157 0.266 0.0005
>gi|147846613|emb|CAN81645.1| hypothetical protein VITISV_010797 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 72/153 (47%), Gaps = 42/153 (27%)

Query: 28  KTCNVERDITVTLTDSGICPDSE-------------VESKIIGARYYPSSEAGNYTTRDI 74
           +  ++E DI + + D+GI P+S+              E KIIGAR Y S  + + T RD 
Sbjct: 66  RVPSIESDIIIGVLDTGIWPESKSFSDEGLGPVPKKXERKIIGARVYNSMISPDNTARDS 125

Query: 75  ENHGTCTSSTTGGNEVKDVSFF----------------------WDWGKVLKEVVFLWQE 112
           E HGT T+ST  G+ VK  SF+                      ++ G  + +V+  + +
Sbjct: 126 EGHGTHTASTAAGSVVKGASFYGVGKGDARGGVPSARIAVYKVCYETGCTVADVMAAFDD 185

Query: 113 LRYIKSYASAAGVAVMTISIGHAHSLNIRDESI 145
                  A + GV ++T+S+G A +L +  +SI
Sbjct: 186 -------AISDGVDIITVSLGAAAALPLDSDSI 211

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255558936|ref|XP_002520491.1| peptidase, putative [Ricinus communis] gi|223540333|gb|EEF41904.1| peptidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|29028287|gb|AAO62352.1| subtilase [Casuarina glauca] Back     alignment and taxonomy information
>gi|357512713|ref|XP_003626645.1| Subtilisin-like serine protease [Medicago truncatula] gi|357512761|ref|XP_003626669.1| Subtilisin-like serine protease [Medicago truncatula] gi|355520667|gb|AET01121.1| Subtilisin-like serine protease [Medicago truncatula] gi|355520691|gb|AET01145.1| Subtilisin-like serine protease [Medicago truncatula] Back     alignment and taxonomy information
>gi|357456041|ref|XP_003598301.1| Subtilisin-like serine protease [Medicago truncatula] gi|355487349|gb|AES68552.1| Subtilisin-like serine protease [Medicago truncatula] Back     alignment and taxonomy information
>gi|357498425|ref|XP_003619501.1| Subtilisin-like serine protease [Medicago truncatula] gi|355494516|gb|AES75719.1| Subtilisin-like serine protease [Medicago truncatula] Back     alignment and taxonomy information
>gi|357498403|ref|XP_003619490.1| Subtilisin-like serine protease [Medicago truncatula] gi|355494505|gb|AES75708.1| Subtilisin-like serine protease [Medicago truncatula] Back     alignment and taxonomy information
>gi|359478633|ref|XP_002280951.2| PREDICTED: cucumisin [Vitis vinifera] Back     alignment and taxonomy information
>gi|357450189|ref|XP_003595371.1| Subtilisin-like serine protease [Medicago truncatula] gi|355484419|gb|AES65622.1| Subtilisin-like serine protease [Medicago truncatula] Back     alignment and taxonomy information
>gi|297746066|emb|CBI16122.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query158
TAIR|locus:2198656 769 ATSBT5.2 "AT1G20160" [Arabidop 0.303 0.062 0.46 5.8e-05
TAIR|locus:2102792 738 AT3G46840 "AT3G46840" [Arabido 0.335 0.071 0.438 0.00025
TAIR|locus:2153296 741 AT5G59100 "AT5G59100" [Arabido 0.278 0.059 0.431 0.00026
TAIR|locus:2153291 736 SBT4.12 "AT5G59090" [Arabidops 0.303 0.065 0.482 0.00052
TAIR|locus:2154513 701 AT5G58830 "AT5G58830" [Arabido 0.303 0.068 0.464 0.00068
TAIR|locus:2154503 703 AT5G58820 "AT5G58820" [Arabido 0.303 0.068 0.464 0.00068
TAIR|locus:2154528 713 AT5G58840 "AT5G58840" [Arabido 0.303 0.067 0.464 0.00069
TAIR|locus:2198656 ATSBT5.2 "AT1G20160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 113 (44.8 bits), Expect = 5.8e-05, P = 5.8e-05
 Identities = 23/50 (46%), Positives = 32/50 (64%)

Query:    49 SEVESKIIGARYY--PSSEAGNYTTRDIENHGTCTSSTTGGNEVKDVSFF 96
             S    KIIGARYY  P  ++  YTTRD+  HG+  SST  G+ V++ S++
Sbjct:   180 SNCNRKIIGARYYKNPDDDSEYYTTRDVIGHGSHVSSTIAGSAVENASYY 229
GO:0004252 "serine-type endopeptidase activity" evidence=IEA;IBA
GO:0005576 "extracellular region" evidence=ISM
GO:0005618 "cell wall" evidence=IBA
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0008152 "metabolic process" evidence=IBA
GO:0042802 "identical protein binding" evidence=IEA
GO:0043086 "negative regulation of catalytic activity" evidence=IEA
GO:0048046 "apoplast" evidence=IDA
TAIR|locus:2102792 AT3G46840 "AT3G46840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153296 AT5G59100 "AT5G59100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153291 SBT4.12 "AT5G59090" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154513 AT5G58830 "AT5G58830" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154503 AT5G58820 "AT5G58820" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154528 AT5G58840 "AT5G58840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
cd04852 307 cd04852, Peptidases_S8_3, Peptidase S8 family doma 4e-09
>gnl|CDD|173795 cd04852, Peptidases_S8_3, Peptidase S8 family domain, uncharacterized subfamily 3 Back     alignment and domain information 
 Score = 53.4 bits (129), Expect = 4e-09
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 9/52 (17%)

Query: 54  KIIGARYYPS--------SEAGNY-TTRDIENHGTCTSSTTGGNEVKDVSFF 96
           K+IGARY+          +  G Y + RD + HGT T+ST  GN V + S  
Sbjct: 78  KLIGARYFSDGYDAYGGFNSDGEYRSPRDYDGHGTHTASTAAGNVVVNASVG 129

This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values. Length = 307

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 158
cd04852 307 Peptidases_S8_3 Peptidase S8 family domain, unchar 99.95
PTZ00262 639 subtilisin-like protease; Provisional 99.92
cd07479 255 Peptidases_S8_SKI-1_like Peptidase S8 family domai 99.9
cd07475 346 Peptidases_S8_C5a_Peptidase Peptidase S8 family do 99.89
cd07476 267 Peptidases_S8_thiazoline_oxidase_subtilisin-like_p 99.88
cd07483 291 Peptidases_S8_Subtilisin_Novo-like Peptidase S8 fa 99.88
cd07489 312 Peptidases_S8_5 Peptidase S8 family domain, unchar 99.87
cd07485 273 Peptidases_S8_Fervidolysin_like Peptidase S8 famil 99.87
cd07484 260 Peptidases_S8_Thermitase_like Peptidase S8 family 99.86
cd07487 264 Peptidases_S8_1 Peptidase S8 family domain, unchar 99.86
cd07494 298 Peptidases_S8_10 Peptidase S8 family domain, uncha 99.85
cd07480 297 Peptidases_S8_12 Peptidase S8 family domain, uncha 99.85
cd05562 275 Peptidases_S53_like Peptidase domain in the S53 fa 99.85
cd07491 247 Peptidases_S8_7 Peptidase S8 family domain, unchar 99.84
cd07493 261 Peptidases_S8_9 Peptidase S8 family domain, unchar 99.84
cd07497 311 Peptidases_S8_14 Peptidase S8 family domain, uncha 99.83
cd07474 295 Peptidases_S8_subtilisin_Vpr-like Peptidase S8 fam 99.83
cd07496 285 Peptidases_S8_13 Peptidase S8 family domain, uncha 99.83
cd07498 242 Peptidases_S8_15 Peptidase S8 family domain, uncha 99.83
cd07481 264 Peptidases_S8_BacillopeptidaseF-like Peptidase S8 99.82
cd04059 297 Peptidases_S8_Protein_convertases_Kexins_Furin-lik 99.82
cd04077 255 Peptidases_S8_PCSK9_ProteinaseK_like Peptidase S8 99.82
cd07490 254 Peptidases_S8_6 Peptidase S8 family domain, unchar 99.82
cd05561 239 Peptidases_S8_4 Peptidase S8 family domain, unchar 99.82
cd07478 455 Peptidases_S8_CspA-like Peptidase S8 family domain 99.81
cd04842 293 Peptidases_S8_Kp43_protease Peptidase S8 family do 99.81
cd04843 277 Peptidases_S8_11 Peptidase S8 family domain, uncha 99.8
cd07477 229 Peptidases_S8_Subtilisin_subset Peptidase S8 famil 99.8
cd07473 259 Peptidases_S8_Subtilisin_like Peptidase S8 family 99.79
cd07492222 Peptidases_S8_8 Peptidase S8 family domain, unchar 99.79
cd07482 294 Peptidases_S8_Lantibiotic_specific_protease Peptid 99.78
cd04848 267 Peptidases_S8_Autotransporter_serine_protease_like 99.76
cd04847 291 Peptidases_S8_Subtilisin_like_2 Peptidase S8 famil 99.75
cd04857 412 Peptidases_S8_Tripeptidyl_Aminopeptidase_II Peptid 99.75
PF00082 282 Peptidase_S8: Subtilase family This is family S8 i 99.72
KOG1153 501 consensus Subtilisin-related protease/Vacuolar pro 99.66
cd00306 241 Peptidases_S8_S53 Peptidase domain in the S8 and S 99.56
KOG4266 1033 consensus Subtilisin kexin isozyme-1/site 1 protea 99.55
COG1404 508 AprE Subtilisin-like serine proteases [Posttransla 99.44
KOG1114 1304 consensus Tripeptidyl peptidase II [Posttranslatio 99.31
cd07488 247 Peptidases_S8_2 Peptidase S8 family domain, unchar 99.08
KOG3526 629 consensus Subtilisin-like proprotein convertase [P 98.73
cd04056 361 Peptidases_S53 Peptidase domain in the S53 family. 95.87
KOG3525 431 consensus Subtilisin-like proprotein convertase [P 94.54
>cd04852 Peptidases_S8_3 Peptidase S8 family domain, uncharacterized subfamily 3 Back     alignment and domain information 
Probab=99.95  E-value=3.9e-27  Score=196.55  Aligned_cols=146  Identities=27%  Similarity=0.355  Sum_probs=112.2

Q ss_pred             cccccc----ccccCCCCCcccccccCCCCCcEEEEeccccCCCCcC----------------------------CCcee
Q 041977            9 LQLHKR----DLGILYVSMDPLIKTCNVERDITVTLTDSGICPDSEV----------------------------ESKII   56 (158)
Q Consensus         9 ~~l~tt----~lg~~~~~~~~~W~~~~~G~GV~VaViDTGid~~hp~----------------------------~~~i~   56 (158)
                      |+|||+    |||+.......+|....+|+||+|||||||||++||+                            +.|++
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~gv~VaViDtGid~~hp~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ki~   80 (307)
T cd04852           1 YQLHTTRSPDFLGLPGAWGGSLLGAANAGEGIIIGVLDTGIWPEHPSFADVGGGPYPHTWPGDCVTGEDFNPFSCNNKLI   80 (307)
T ss_pred             CCccccCCHHHcCCCCCCCcccccccCCCCccEEEEEeCCCCCCCcCcccCCCCCCCCCCCCcccCCCCcCccCcCCeEE
Confidence            689999    9999875444467778899999999999999999998                            24677


Q ss_pred             eeEeCCCCC---------CCCCCCCCCCCCCccccccccCCccCC--------CceeeecccCCeeE--EecCc-----h
Q 041977           57 GARYYPSSE---------AGNYTTRDIENHGTCTSSTTGGNEVKD--------VSFFWDWGKVLKEV--VFLWQ-----E  112 (158)
Q Consensus        57 g~~~~~~~~---------~~~~~~~D~~GHGTHvAgiiag~~~~~--------~~~~G~vapg~~a~--kv~~~-----~  112 (158)
                      +.++|.++.         .+...+.|..||||||||||||+...+        ..+.| +||+++..  |+++.     .
T Consensus        81 g~~~~~~~~~~~~~~~~~~~~~~~~d~~gHGT~VAgiiag~~~~~~~~~~~~~~~~~G-vAP~a~l~~~kv~~~~~~~~~  159 (307)
T cd04852          81 GARYFSDGYDAYGGFNSDGEYRSPRDYDGHGTHTASTAAGNVVVNASVGGFAFGTASG-VAPRARIAVYKVCWPDGGCFG  159 (307)
T ss_pred             EEEEcccchhhccCcccccCCCCCccCCCCchhhhhhhcCCCcccccccccccccEEE-ECCCCeEEEEEEecCCCCccH
Confidence            777776531         124566889999999999999987542        23568 99999543  77754     5


Q ss_pred             hHHHHH--HHHHCCCcEEEEccCCCCCCCchHHHHHHHHHHHHHhc
Q 041977          113 LRYIKS--YASAAGVAVMTISIGHAHSLNIRDESIYNDLKFCWQLR  156 (158)
Q Consensus       113 s~iiaa--~Av~~g~dVInmSlG~~~~~~~~~d~i~~~~~~aw~~~  156 (158)
                      ++++++  +|++++++|||||||.... ..+.+.+..++.++.+.+
T Consensus       160 ~~~~~ai~~a~~~g~~Vin~S~G~~~~-~~~~~~~~~~~~~a~~~g  204 (307)
T cd04852         160 SDILAAIDQAIADGVDVISYSIGGGSP-DPYEDPIAIAFLHAVEAG  204 (307)
T ss_pred             HHHHHHHHHHHHcCCCEEEeCCCCCCC-CcccCHHHHHHHHHHhCC
Confidence            678888  9999999999999998732 455677777776665544

This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
>PTZ00262 subtilisin-like protease; Provisional Back     alignment and domain information
>cd07479 Peptidases_S8_SKI-1_like Peptidase S8 family domain in SKI-1-like proteins Back     alignment and domain information
>cd07475 Peptidases_S8_C5a_Peptidase Peptidase S8 family domain in Streptococcal C5a peptidases Back     alignment and domain information
>cd07476 Peptidases_S8_thiazoline_oxidase_subtilisin-like_protease Peptidase S8 family domain in Thiazoline oxidase/subtilisin-like proteases Back     alignment and domain information
>cd07483 Peptidases_S8_Subtilisin_Novo-like Peptidase S8 family domain in Subtilisin_Novo-like proteins Back     alignment and domain information
>cd07489 Peptidases_S8_5 Peptidase S8 family domain, uncharacterized subfamily 5 Back     alignment and domain information
>cd07485 Peptidases_S8_Fervidolysin_like Peptidase S8 family domain in Fervidolysin Back     alignment and domain information
>cd07484 Peptidases_S8_Thermitase_like Peptidase S8 family domain in Thermitase-like proteins Back     alignment and domain information
>cd07487 Peptidases_S8_1 Peptidase S8 family domain, uncharacterized subfamily 1 Back     alignment and domain information
>cd07494 Peptidases_S8_10 Peptidase S8 family domain, uncharacterized subfamily 10 Back     alignment and domain information
>cd07480 Peptidases_S8_12 Peptidase S8 family domain, uncharacterized subfamily 12 Back     alignment and domain information
>cd05562 Peptidases_S53_like Peptidase domain in the S53 family Back     alignment and domain information
>cd07491 Peptidases_S8_7 Peptidase S8 family domain, uncharacterized subfamily 7 Back     alignment and domain information
>cd07493 Peptidases_S8_9 Peptidase S8 family domain, uncharacterized subfamily 9 Back     alignment and domain information
>cd07497 Peptidases_S8_14 Peptidase S8 family domain, uncharacterized subfamily 14 Back     alignment and domain information
>cd07474 Peptidases_S8_subtilisin_Vpr-like Peptidase S8 family domain in Vpr-like proteins Back     alignment and domain information
>cd07496 Peptidases_S8_13 Peptidase S8 family domain, uncharacterized subfamily 13 Back     alignment and domain information
>cd07498 Peptidases_S8_15 Peptidase S8 family domain, uncharacterized subfamily 15 Back     alignment and domain information
>cd07481 Peptidases_S8_BacillopeptidaseF-like Peptidase S8 family domain in BacillopeptidaseF-like proteins Back     alignment and domain information
>cd04059 Peptidases_S8_Protein_convertases_Kexins_Furin-like Peptidase S8 family domain in Protein convertases Back     alignment and domain information
>cd04077 Peptidases_S8_PCSK9_ProteinaseK_like Peptidase S8 family domain in ProteinaseK-like proteins Back     alignment and domain information
>cd07490 Peptidases_S8_6 Peptidase S8 family domain, uncharacterized subfamily 6 Back     alignment and domain information
>cd05561 Peptidases_S8_4 Peptidase S8 family domain, uncharacterized subfamily 4 Back     alignment and domain information
>cd07478 Peptidases_S8_CspA-like Peptidase S8 family domain in CspA-like proteins Back     alignment and domain information
>cd04842 Peptidases_S8_Kp43_protease Peptidase S8 family domain in Kp43 proteases Back     alignment and domain information
>cd04843 Peptidases_S8_11 Peptidase S8 family domain, uncharacterized subfamily 11 Back     alignment and domain information
>cd07477 Peptidases_S8_Subtilisin_subset Peptidase S8 family domain in Subtilisin proteins Back     alignment and domain information
>cd07473 Peptidases_S8_Subtilisin_like Peptidase S8 family domain in Subtilisin-like proteins Back     alignment and domain information
>cd07492 Peptidases_S8_8 Peptidase S8 family domain, uncharacterized subfamily 8 Back     alignment and domain information
>cd07482 Peptidases_S8_Lantibiotic_specific_protease Peptidase S8 family domain in Lantiobiotic (lanthionine-containing antibiotics) specific proteases Back     alignment and domain information
>cd04848 Peptidases_S8_Autotransporter_serine_protease_like Peptidase S8 family domain in Autotransporter serine proteases Back     alignment and domain information
>cd04847 Peptidases_S8_Subtilisin_like_2 Peptidase S8 family domain in Subtilisin-like proteins Back     alignment and domain information
>cd04857 Peptidases_S8_Tripeptidyl_Aminopeptidase_II Peptidase S8 family domain in Tripeptidyl aminopeptidases_II Back     alignment and domain information
>PF00082 Peptidase_S8: Subtilase family This is family S8 in the peptidase classification Back     alignment and domain information
>KOG1153 consensus Subtilisin-related protease/Vacuolar protease B [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00306 Peptidases_S8_S53 Peptidase domain in the S8 and S53 families Back     alignment and domain information
>KOG4266 consensus Subtilisin kexin isozyme-1/site 1 protease, subtilase superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1404 AprE Subtilisin-like serine proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1114 consensus Tripeptidyl peptidase II [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd07488 Peptidases_S8_2 Peptidase S8 family domain, uncharacterized subfamily 2 Back     alignment and domain information
>KOG3526 consensus Subtilisin-like proprotein convertase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04056 Peptidases_S53 Peptidase domain in the S53 family Back     alignment and domain information
>KOG3525 consensus Subtilisin-like proprotein convertase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
3i6s_A 649 Subtilisin-like protease; PA-domain, FN3-domain, h 4e-07
3vta_A 621 Cucumisin; subtilisin-like fold, serine protease, 1e-06
1xf1_A 926 C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {St 9e-04
>3i6s_A Subtilisin-like protease; PA-domain, FN3-domain, hydrolase; HET: NAG FUC; 2.50A {Solanum lycopersicum} PDB: 3i74_A* Length = 649 Back     alignment and structure
 Score = 47.4 bits (112), Expect = 4e-07
 Identities = 27/102 (26%), Positives = 37/102 (36%), Gaps = 36/102 (35%)

Query: 31  NVERDITVTLTDSGICPDSE----------------------------VESKIIGARYYP 62
            + +D+ V + DSGI P+S                                K+IGA Y+ 
Sbjct: 21  GLGQDVIVAVLDSGIWPESASFQDDGMPEIPKRWKGICKPGTQFNASMCNRKLIGANYFN 80

Query: 63  SSEAGNY--------TTRDIENHGTCTSSTTGGNEVKDVSFF 96
                N         + RD + HGT  +S T GN  K VS F
Sbjct: 81  KGILANDPTVNITMNSARDTDGHGTHCASITAGNFAKGVSHF 122
>3vta_A Cucumisin; subtilisin-like fold, serine protease, hydrolase; HET: DFP NAG FUC BMA MAN; 2.75A {Cucumis melo} Length = 621 Back     alignment and structure
>1xf1_A C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A* Length = 926 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query158
3vta_A 621 Cucumisin; subtilisin-like fold, serine protease, 99.96
3i6s_A 649 Subtilisin-like protease; PA-domain, FN3-domain, h 99.95
3afg_A 539 Subtilisin-like serine protease; propeptide, therm 99.93
1dbi_A 280 AK.1 serine protease; hydrolase; 1.80A {Bacillus S 99.93
1thm_A 279 Thermitase; hydrolase(serine protease); 1.37A {The 99.92
1xf1_A 926 C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {St 99.92
2x8j_A 327 Intracellular subtilisin protease; hydrolase, seri 99.92
2z2z_A 395 TK-subtilisin precursor; thermococcus kodakaraensi 99.91
1r0r_E 274 Subtilisin carlsberg; high resolution, serine prot 99.91
1to2_E 281 Subtilisin BPN'; serine protease, hydrolase; HET: 99.91
3t41_A 471 Epidermin leader peptide processing serine protea; 99.91
4h6w_A 306 N-terminal cyanobactin protease; hydrolase; 2.45A 99.9
1gci_A 269 Subtilisin; hydrolase, serine protease; 0.78A {Bac 99.9
2ixt_A 310 36KDA protease; serine protease, sphericase, subti 99.9
2z30_A 320 TK-subtilisin; thermococcus kodakaraensis, hydrola 99.9
3zxy_A 282 Subtilisin-like protein; hydrolase; 1.58A {Prochlo 99.9
3lpc_A 340 APRB2; protease, subtilase, virulence factor, hydr 99.89
1p8j_A 471 Furin precursor; prohormone convertase, SPC1, PACE 99.89
1y9z_A 441 Alkaline serine protease; subtilisin-like alpha/be 99.89
4h6x_A 357 Thiazoline oxidase/subtilisin-like protease; hydro 99.89
2iy9_A 347 SUBA; toxin, shiga, plasmid; 1.8A {Escherichia col 99.89
2b6n_A 278 Proteinase K; S binding, substrate specificity, pr 99.89
3hjr_A 600 Extracellular serine protease; kexin, hydrolase; 1 99.88
1sh7_A 284 Extracellular subtilisin-like serine proteinase; c 99.88
1r6v_A 671 Subtilisin-like serine protease; sandwich domain, 99.87
4dzt_A 276 Aqualysin-1, aqualysin-I; serine protease, calcium 99.87
2id4_A 503 Kexin; KEX2, kexin, furin, proprotein, prohormone, 99.87
2oxa_A 600 Extracellular serine protease; kexin, hydrolase; 1 99.85
3f7m_A 279 Alkaline serine protease VER112; verticillium psal 99.85
2pwa_A 279 Proteinase K; structure, alanine boronic acid, hyd 99.85
2p4e_P 692 Proprotein convertase subtilisin/kexin type 9; pro 99.85
1wmd_A 434 Protease; alpha-beta hydrolase fold, jelly-roll be 99.83
2qtw_B 546 Proprotein convertase subtilisin/kexin type 9; cor 99.83
3lxu_X 1354 Tripeptidyl-peptidase 2; spindle complex, aminopep 99.64
1t1e_A 552 Kumamolisin; proenzyme, prosubtilase, activation m 97.95
3lxu_X 1354 Tripeptidyl-peptidase 2; spindle complex, aminopep 94.88
1ga6_A 372 Serine-carboxyl proteinase; serine-carboxyl protei 94.12
>3vta_A Cucumisin; subtilisin-like fold, serine protease, hydrolase; HET: DFP NAG FUC BMA MAN; 2.75A {Cucumis melo} Back     alignment and structure
Probab=99.96  E-value=4.7e-31  Score=238.01  Aligned_cols=138  Identities=27%  Similarity=0.333  Sum_probs=116.4

Q ss_pred             ccccCCCCCcccccccCCCCCcEEEEeccccCCCCcC-------------------------CCceeeeEeCCCCC----
Q 041977           15 DLGILYVSMDPLIKTCNVERDITVTLTDSGICPDSEV-------------------------ESKIIGARYYPSSE----   65 (158)
Q Consensus        15 ~lg~~~~~~~~~W~~~~~G~GV~VaViDTGid~~hp~-------------------------~~~i~g~~~~~~~~----   65 (158)
                      ||||+.    .+|+++.+|+||+|||||||||++||+                         ++|++|.++|..+.    
T Consensus         7 flGl~~----~~~~~~~~G~gViVgViDTGId~~Hp~f~d~g~~~~~~~w~g~~~~~~~~~~n~k~ig~~~~~~~~~~~~   82 (621)
T 3vta_A            7 FLGFPL----TVPRRSQVESNIVVGVLDTGIWPESPSFDDEGFSPPPPKWKGTCETSNNFRCNRKIIGARSYHIGRPISP   82 (621)
T ss_dssp             HTTCCT----TCCCCHHHHTTCEEEEEESCBCTTSGGGCCTTCCCCCTTCCCCBCCSSSCCCCSSEEEEEECCCSSSCCT
T ss_pred             HcCCCc----cccccCCCCCCCEEEEEecCCCCCChhhcCCCCCCcccccccccccCCCcccCcceeeeeecccCCccCC
Confidence            999985    689998899999999999999999997                         35789999887542    


Q ss_pred             CCCCCCCCCCCCCccccccccCCccCCCc--------eeeecccCCee--EEecCc----hhHHHHH--HHHHCCCcEEE
Q 041977           66 AGNYTTRDIENHGTCTSSTTGGNEVKDVS--------FFWDWGKVLKE--VVFLWQ----ELRYIKS--YASAAGVAVMT  129 (158)
Q Consensus        66 ~~~~~~~D~~GHGTHvAgiiag~~~~~~~--------~~G~vapg~~a--~kv~~~----~s~iiaa--~Av~~g~dVIn  129 (158)
                      .+..+++|++||||||||||||+..++.+        +.| +||+++.  .|+|+.    .+++++|  +|+++|+||||
T Consensus        83 ~~~~~p~D~~GHGTHvAgi~AG~~~~~~~~~g~~~g~~~G-vAP~A~l~~~kv~~~~g~~~~di~~a~~~a~~~g~dVin  161 (621)
T 3vta_A           83 GDVNGPRDTNGHGTHTASTAAGGLVSQANLYGLGLGTARG-GVPLARIAAYKVCWNDGCSDTDILAAYDDAIADGVDIIS  161 (621)
T ss_dssp             TCCSSSBCSSSHHHHHHHHHHCCCEEEEEETTEEEEEECC-SCTTSEEEEEECEETTEECHHHHHHHHHHHHHHTCSEEE
T ss_pred             CCCCCCCCCCcCHHHHHHHHhCcCCCCccccccccccEEE-ECCCCEEEEEEeecCCCCCHHHHHHHHHHHHHhCCCEEE
Confidence            23467889999999999999998765433        358 9998843  399876    7889999  99999999999


Q ss_pred             EccCCCCCCCchHHHHHHHHHHHHHhcc
Q 041977          130 ISIGHAHSLNIRDESIYNDLKFCWQLRF  157 (158)
Q Consensus       130 mSlG~~~~~~~~~d~i~~~~~~aw~~~~  157 (158)
                      ||||+..+..++.++++.++..+.+.+.
T Consensus       162 ~SlG~~~~~~~~~~~~~~~~~~a~~~Gi  189 (621)
T 3vta_A          162 LSVGGANPRHYFVDAIAIGSFHAVERGI  189 (621)
T ss_dssp             ECCCCCCGGGGGGCTHHHHHHHHHTTTC
T ss_pred             ecCCCCCCCCcCCcHHHHHHHHHHHCCC
Confidence            9999986677888999999999887664
>3i6s_A Subtilisin-like protease; PA-domain, FN3-domain, hydrolase; HET: NAG FUC; 2.50A {Solanum lycopersicum} PDB: 3i74_A* Back     alignment and structure
>3afg_A Subtilisin-like serine protease; propeptide, thermococcus kodakaraensis, hydrolas protease; 2.00A {Thermococcus kodakarensis} Back     alignment and structure
>1dbi_A AK.1 serine protease; hydrolase; 1.80A {Bacillus SP} SCOP: c.41.1.1 Back     alignment and structure
>1thm_A Thermitase; hydrolase(serine protease); 1.37A {Thermoactinomyces vulgaris} SCOP: c.41.1.1 PDB: 2tec_E 1tec_E 3tec_E Back     alignment and structure
>1xf1_A C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A* Back     alignment and structure
>2x8j_A Intracellular subtilisin protease; hydrolase, serine protease, intracellular proteinase regulat; HET: CSX 1PE; 1.56A {Bacillus clausii} PDB: 2wv7_A 2wwt_A 2xrm_A* Back     alignment and structure
>2z2z_A TK-subtilisin precursor; thermococcus kodakaraensis, hydrolase; 1.87A {Thermococcus kodakarensis} PDB: 2e1p_A 2zwp_A 2zwo_A Back     alignment and structure
>1r0r_E Subtilisin carlsberg; high resolution, serine protease, protein inhibitor, hydrolase; 1.10A {Bacillus licheniformis} SCOP: c.41.1.1 PDB: 1af4_A* 1be8_A* 1bfk_A 1bfu_A 1be6_A 1oyv_A 1cse_E 1sbc_A 1sca_A 1scb_A 1scd_A 2sec_E 2wuv_A 2wuw_E 1yu6_A 1scn_E* 1c3l_A 1avt_A* 1av7_A* 1sel_A ... Back     alignment and structure
>1to2_E Subtilisin BPN'; serine protease, hydrolase; HET: CIT 15P; 1.30A {Bacillus amyloliquefaciens} SCOP: c.41.1.1 PDB: 1tm1_E* 1tm3_E* 1tm4_E* 1lw6_E* 1tm7_E* 1tmg_E* 1to1_E* 1tm5_E* 1y1k_E* 1y33_E* 1y34_E* 1y3b_E* 1y3c_E* 1y3d_E* 1y3f_E* 1y48_E* 1y4a_E* 1y4d_E 1sup_A* 1sib_E ... Back     alignment and structure
>3t41_A Epidermin leader peptide processing serine protea; structural genomics, center for structural genomics of infec diseases, csgid; 1.95A {Staphylococcus aureus} PDB: 3qfh_A Back     alignment and structure
>4h6w_A N-terminal cyanobactin protease; hydrolase; 2.45A {Planktothrix agardhii nies-596} Back     alignment and structure
>1gci_A Subtilisin; hydrolase, serine protease; 0.78A {Bacillus lentus} SCOP: c.41.1.1 PDB: 1jea_A 1ndq_A 1svn_A 1tk2_A* 3bx1_A 1ah2_A 1iav_A* 1c9m_A* 1wsd_A 1mpt_A 1ndu_A 1c9j_A 1q5p_A* 1st3_A 1c9n_A* Back     alignment and structure
>2ixt_A 36KDA protease; serine protease, sphericase, subtilisin like protease, hydrolase; 0.8A {Bacillus sphaericus} SCOP: c.41.1.1 PDB: 3d43_A 1ea7_A* 2gko_A* Back     alignment and structure
>2z30_A TK-subtilisin; thermococcus kodakaraensis, hydrolase; 1.65A {Thermococcus kodakarensis} PDB: 3a3o_A 3a3n_A 2zrq_A 2z57_A 2z56_A 2z58_A 3a3p_A 2z2x_A* 2z2y_A Back     alignment and structure
>3zxy_A Subtilisin-like protein; hydrolase; 1.58A {Prochloron didemni} PDB: 3zxx_A Back     alignment and structure
>3lpc_A APRB2; protease, subtilase, virulence factor, hydrolase; 1.70A {Dichelobacter nodosus} PDB: 3lpa_A 3lpd_A 3ti9_A 3ti7_A Back     alignment and structure
>1p8j_A Furin precursor; prohormone convertase, SPC1, PACE, P-domain; HET: DKA AR7 NAG FUL BMA MAN GAL FUC; 2.60A {Mus musculus} SCOP: b.18.1.20 c.41.1.1 Back     alignment and structure
>1y9z_A Alkaline serine protease; subtilisin-like alpha/beta domain, insert beta barrel domain hydrolase; HET: PMS; 1.40A {Pseudoalteromonas SP} PDB: 1v6c_A* 1wvm_A* Back     alignment and structure
>4h6x_A Thiazoline oxidase/subtilisin-like protease; hydrolase; 2.00A {Prochloron didemni} PDB: 4aks_A 4akt_A Back     alignment and structure
>2iy9_A SUBA; toxin, shiga, plasmid; 1.8A {Escherichia coli} Back     alignment and structure
>2b6n_A Proteinase K; S binding, substrate specificity, proteinase K, subtilase, psychrotrophic, psychrophilic, hydrolase; 1.80A {Serratia SP} Back     alignment and structure
>3hjr_A Extracellular serine protease; kexin, hydrolase; 1.65A {Aeromonas sobria} Back     alignment and structure
>1sh7_A Extracellular subtilisin-like serine proteinase; cold adaptation, psychrotrophic, subtilisin-like proteinase, depentent, hydrolase; HET: PMS; 1.84A {Vibrio SP} PDB: 1s2n_A* Back     alignment and structure
>1r6v_A Subtilisin-like serine protease; sandwich domain, propeptide, hydrolase; 1.70A {Fervidobacterium pennivorans} SCOP: c.41.1.1 Back     alignment and structure
>4dzt_A Aqualysin-1, aqualysin-I; serine protease, calcium binding, inhibitor, hydrolase-hydro inhibitor complex; HET: PMS; 1.95A {Thermus aquaticus} Back     alignment and structure
>2id4_A Kexin; KEX2, kexin, furin, proprotein, prohormone, convertase, SUBT like protease, serine protease; HET: NDG; 1.90A {Saccharomyces cerevisiae} SCOP: b.18.1.20 c.41.1.1 PDB: 1r64_A* 1ot5_A* Back     alignment and structure
>3f7m_A Alkaline serine protease VER112; verticillium psalliotae, cuticle- degrading protease, nematodes, hydrolase, secreted, zymogen; 1.60A {Lecanicillium psalliotae} SCOP: c.41.1.1 PDB: 3f7o_A Back     alignment and structure
>2pwa_A Proteinase K; structure, alanine boronic acid, hydrolase; 0.83A {Engyodontium album} SCOP: c.41.1.1 PDB: 1p7v_A 1p7w_A 2dqk_A 2duj_A 2g4v_A 2hd4_A 2hpz_A 2id8_A 2pq2_A 1ic6_A 2pwb_A* 2pyz_A* 2v8b_A 3aj8_A 3aj9_A 3dyb_A* 3gt3_A* 3gt4_A* 3l1k_A 3osz_A ... Back     alignment and structure
>2p4e_P Proprotein convertase subtilisin/kexin type 9; protease, LDL receptor, LDL, endocytosis, hydrol; 1.98A {Homo sapiens} Back     alignment and structure
>1wmd_A Protease; alpha-beta hydrolase fold, jelly-roll beta-barrel, hydrolase; 1.30A {Bacillus SP} SCOP: b.18.1.20 c.41.1.1 PDB: 1wme_A 1wmf_A Back     alignment and structure
>2qtw_B Proprotein convertase subtilisin/kexin type 9; coronary heart disease, hypercholest low density lipoprotein receptor, autocatalytic cleavage; HET: NAG; 1.90A {Homo sapiens} PDB: 3m0c_B 3bps_A 3gcw_A 3gcx_A 3p5b_A 3p5c_A 2pmw_B 3h42_B 2w2n_A 2w2m_A 2w2p_A 2w2q_A 2xtj_A 2w2o_A Back     alignment and structure
>3lxu_X Tripeptidyl-peptidase 2; spindle complex, aminopeptidase, hydrolase, phosphoprotein, protease; 3.14A {Drosophila melanogaster} Back     alignment and structure
>1t1e_A Kumamolisin; proenzyme, prosubtilase, activation mechanism, sedolisin, serine-carboxyl proteinase, hydrolase; 1.18A {Bacillus SP} SCOP: c.41.1.2 d.58.3.2 PDB: 1t1g_A 1t1i_A 1gt9_1 1gtg_1 1gtj_1* 1gtl_1* 1sio_A* 1sn7_A 1zvj_A 1siu_A 1zvk_A Back     alignment and structure
>3lxu_X Tripeptidyl-peptidase 2; spindle complex, aminopeptidase, hydrolase, phosphoprotein, protease; 3.14A {Drosophila melanogaster} Back     alignment and structure
>1ga6_A Serine-carboxyl proteinase; serine-carboxyl proteinase, hydrolase-hydrolase inhibitor CO; 1.00A {Pseudomonas SP} SCOP: c.41.1.2 PDB: 1ga4_A* 1ga1_A 1kdv_A* 1kdy_A* 1kdz_A* 1ke1_A* 1ke2_A* 1nlu_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query158
d1dbia_ 280 Thermostable serine protease {Bacillus sp., AK.1 [ 99.91
d1v6ca_ 435 Alkaline serine protease Apa1 {Pseudoalteromonas s 99.9
d1thma_ 279 Thermitase {Thermoactinomyces vulgaris [TaxId: 202 99.9
d1r6va_ 671 Fervidolysin {Fervidobacterium pennivorans [TaxId: 99.88
d1r0re_ 274 Subtilisin {Bacillus subtilis, carlsberg [TaxId: 1 99.87
d1to2e_ 281 Subtilisin {Bacillus amyloliquefaciens, Novo/BPN' 99.86
d1gcia_ 269 Subtilisin {Bacillus lentus [TaxId: 1467]} 99.83
d2ixta1 309 Sphericase {Bacillus sphaericus [TaxId: 1421]} 99.83
d1wmda2 318 Alkaline serine protease kp-43, N-terminal domain 99.77
d1p8ja2 334 Furin, N-terminal domain {Mouse (Mus musculus) [Ta 99.76
d2pwaa1 279 Proteinase K {Fungus (Tritirachium album), strain 99.75
d2id4a2 339 Kexin, N-terminal domain {Baker's yeast (Saccharom 99.74
d1t1ga_ 357 Serine-carboxyl proteinase, SCP {Bacillus novosp. 99.47
d1ga6a_ 369 Serine-carboxyl proteinase, SCP {Pseudomonas sp., 98.91
>d1dbia_ c.41.1.1 (A:) Thermostable serine protease {Bacillus sp., AK.1 [TaxId: 1409]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Subtilisin-like
superfamily: Subtilisin-like
family: Subtilases
domain: Thermostable serine protease
species: Bacillus sp., AK.1 [TaxId: 1409]

Probab=99.91  E-value=3.3e-25  Score=179.27  Aligned_cols=134  Identities=16%  Similarity=0.226  Sum_probs=105.1

Q ss_pred             ccccCCCCCcccccccCCCCCcEEEEeccccCCCCcC-CCceeeeEeCCCCCCCCCCCCCCCCCCccccccccCCccCCC
Q 041977           15 DLGILYVSMDPLIKTCNVERDITVTLTDSGICPDSEV-ESKIIGARYYPSSEAGNYTTRDIENHGTCTSSTTGGNEVKDV   93 (158)
Q Consensus        15 ~lg~~~~~~~~~W~~~~~G~GV~VaViDTGid~~hp~-~~~i~g~~~~~~~~~~~~~~~D~~GHGTHvAgiiag~~~~~~   93 (158)
                      ..+|+....+.+|+.+.+|+||+|+||||||+++||+ ..+++..++|...   ...+.|.+||||||||+|++...++.
T Consensus        12 qw~l~~i~~~~aw~~~~~G~gv~VaviDsGi~~~h~~l~~~~~~~~~~~~~---~~~~~d~~~HGT~vag~i~~~~~~~~   88 (280)
T d1dbia_          12 QYGPQNTYTDYAWDVTKGSSGQEIAVIDTGVDYTHPDLDGKVIKGYDFVDN---DYDPMDLNNHGTHVAGIAAAETNNAT   88 (280)
T ss_dssp             CCTTGGGTHHHHTTTCCCCTTCEEEEEESCCCTTSTTTTTTEEEEEETTTT---BSCCCCSSSHHHHHHHHHHCCCSSSS
T ss_pred             ccChhhCCHHHHHhccCCCCCeEEEEEccCcCCCChhhcCCeeecccccCC---CCccccccccccceeEeeeccccCCC
Confidence            3466666678899999999999999999999999998 5567666677644   24567899999999999999877666


Q ss_pred             ceeeecccCCeeE--EecCc-----hhHHHHH--HHHHCCCcEEEEccCCCCCCCchHHHHHHHHHHHHHhc
Q 041977           94 SFFWDWGKVLKEV--VFLWQ-----ELRYIKS--YASAAGVAVMTISIGHAHSLNIRDESIYNDLKFCWQLR  156 (158)
Q Consensus        94 ~~~G~vapg~~a~--kv~~~-----~s~iiaa--~Av~~g~dVInmSlG~~~~~~~~~d~i~~~~~~aw~~~  156 (158)
                      .+.| +||+++..  |+++.     .++++++  +|+++|++|||||||.....+.+    ..+++.+++.+
T Consensus        89 ~~~G-vAp~a~l~~~~v~~~~~~~~~~~~~~ai~~a~~~g~~iin~S~g~~~~~~~~----~~a~~~a~~~g  155 (280)
T d1dbia_          89 GIAG-MAPNTRILAVRALDRNGSGTLSDIADAIIYAADSGAEVINLSLGCDCHTTTL----ENAVNYAWNKG  155 (280)
T ss_dssp             SCCC-SSSSCEEEEEECCCTTSCCCHHHHHHHHHHHHHTTCSEEEECCSSCCCCHHH----HHHHHHHHHTT
T ss_pred             ceeE-EeccCEEEEEEEeCCCCCcCHHHHHHHHHHHHHcCCcEeeccccccccchhH----HHHHHHHHHCC
Confidence            6789 99999543  78754     5677877  89999999999999987443333    44555666554
>d1v6ca_ c.41.1.1 (A:) Alkaline serine protease Apa1 {Pseudoalteromonas sp. AS-11 [TaxId: 247492]} Back     information, alignment and structure
>d1thma_ c.41.1.1 (A:) Thermitase {Thermoactinomyces vulgaris [TaxId: 2026]} Back     information, alignment and structure
>d1r6va_ c.41.1.1 (A:) Fervidolysin {Fervidobacterium pennivorans [TaxId: 93466]} Back     information, alignment and structure
>d1r0re_ c.41.1.1 (E:) Subtilisin {Bacillus subtilis, carlsberg [TaxId: 1423]} Back     information, alignment and structure
>d1to2e_ c.41.1.1 (E:) Subtilisin {Bacillus amyloliquefaciens, Novo/BPN' [TaxId: 1390]} Back     information, alignment and structure
>d1gcia_ c.41.1.1 (A:) Subtilisin {Bacillus lentus [TaxId: 1467]} Back     information, alignment and structure
>d2ixta1 c.41.1.1 (A:1-309) Sphericase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1wmda2 c.41.1.1 (A:1-318) Alkaline serine protease kp-43, N-terminal domain {Bacillus sp. KSM-KP43 [TaxId: 109322]} Back     information, alignment and structure
>d1p8ja2 c.41.1.1 (A:109-442) Furin, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pwaa1 c.41.1.1 (A:1-279) Proteinase K {Fungus (Tritirachium album), strain limber [TaxId: 37998]} Back     information, alignment and structure
>d2id4a2 c.41.1.1 (A:122-460) Kexin, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t1ga_ c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Bacillus novosp. MN-32, kumamolisin [TaxId: 198803]} Back     information, alignment and structure
>d1ga6a_ c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Pseudomonas sp., sedolisin [TaxId: 306]} Back     information, alignment and structure