Citrus Sinensis ID: 042025

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840----
MEQKGGESWKELVRKMLPPGAPLPEEMSELDYSIAMEYKGPPVSHDVPRVEPLDVNSRAIPTAEPLSESQRSVANVGAPVIEPIPLPVSRIADGVTDSPTQSPRLSASSESVVSVLQNPDFSSASPSASPGSIQNRPSNPPKPVNEGRRVPVVTFNTVDSTVDRSERKEVDVETPTYPKYVGVSKEKKRRKSRVCYRCGKGKWETKESCLVCDAKYCSNCVLRAMGSMPEGRNAVLSRLLSPLEVKQIMKAEKECSANQLRPEQLIVNGFPLKPEEMAELLGCPLPPRKLKPGKYWYDKESGLWGKEGEKPDRIISSNLNFSGKLSPDASNGNTQVFINGREITKLERRVLKLANVQCPRDTHFWVYDDGRYEEEGQNNIRGNIWEKATTRFVCSLLSLPVLHGQPQGHRDEASNYTTVPNYLEQKKVQKLLLLGLQGAGTSTIFKQAKFLYGNKFTAEELQDIKLMIQSNMYRYLSILLDGRERFEEEATARMNAQGSHDQISEAGGEADPSETTQCIYSINPRLKHFSDWLLDIIATGDLDAFFPAATREYAPLVDEVWKDPAIQETYKRKDELHFLPDVAEYFLSRAVEVSSNEYEPSDRDILYAEGVTQGNGLAFIEFSLDDRSPMSETYTDNLEVQPQPLTKYQLIRVNAKGMNEGCKWVEMFEDVRVVVFCVALSDYDQMWICPESSGSGTLLQNKMIQSKELFEMMIRHPCFKDTPFVLILNKYDLFEEKVNRVHLSTCEWFNDFSPVRTHHNNQSLAHQAYYYVAMKFKDLYASLTGRKLFVWQARARDRVTVDEAFKYIREVLKWDDEKEDNYYGGAEDSFYSTDMSSSPFVRQE
ccccccccHHHHHHHHcccccccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccEEEccccccccccEEEEcccccccHHHHHHccccccHHHHHHHHHccHHHHHHHHHHHHccccccccccEEEEccccccHHHHHHHHccccccccccccccccccccccccccccccccEEcccccccccccccccccccEEEEccccccHHHHHHHHHHcccccccccEEEEccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccHHHHHHHHEEEEEccccccccccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccccHHHHHccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHcccHHHHHHHHHHcccccccccHHHHHccccccccccccccccccEEcccccccccEEEEEEEEcccccccccccccccccccccccEEEEEEcccccccccccccccccccEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHcccccccccEEEEEccHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccEEEEEEEccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccc
ccccccccHHHHHHHHcccccccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccEccccccccccEEEEccccccccEEEEEEEccHHcHHHHHHHcccccccHHHHHHHHccHHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHcccccccccccccEEEEccccccccccccccEEEcccccccccccccccccccEEEEcccHHHHHHHHHHHHHccccccccEEEEEccccccHcccccccccccccHHHHHHHHHccccccccHHHHHHcHHHHHHccHcHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccccccEEEEccHHHHHHHHHHHHHHHcccHHHHcccccHHHHHHHHHHHccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccHHHEEEEEEcccccEEEEEEEEccccccccccccccccccccccEEEEEEEEcccccccHHHHHHccccccEEEEEEEHHHHHEEEEccccccccccHHEHHHHHHHHHHHHHccHHHcccEEEEEEEcHHHHHHHcccccHHHccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHcccEccccccccccccccccccccc
MEQKGGESWKELVRKmlppgaplpeemsELDYSIAMeykgppvshdvprvepldvnsraiptaeplsesqrsvanvgapviepiplpvsriadgvtdsptqsprlsasseSVVSVlqnpdfssaspsaspgsiqnrpsnppkpvnegrrvpvvtfntvdstvdrserkevdvetptypkyvgvskekkrrksrvcyrcgkgkwetkesclvcdakycsNCVLramgsmpegRNAVLSRLLSPLEVKQIMKAEKEcsanqlrpeqlivngfplkpEEMAEllgcplpprklkpgkywydkesglwgkegekpdriissnlnfsgklspdasngntqvfiNGREITKLERRVLKLAnvqcprdthfwvyddgryeeegqnnirgniWEKATTRFVCSLlslpvlhgqpqghrdeasnyttvpnyLEQKKVQKLLLLGLQGAGTSTIFKQAKflygnkftaeELQDIKLMIQSNMYRYLSILLDGRERFEEEATARMNAqgshdqiseaggeadpsettqciysinprlkhfSDWLLDIIAtgdldaffpaatreyaplvdevwkdpaiqetykrkdelhflpDVAEYFLSRAVevssneyepsdrdilyaegvtqgngLAFIEfslddrspmsetytdnlevqpqpltkyQLIRVNAKgmnegckwVEMFEDVRVVVFCVAlsdydqmwicpessgsgtllqNKMIQSKELFEMMirhpcfkdtpfvlILNKYDLFEEKVNRVHLSTcewfndfspvrthhnnqslaHQAYYYVAMKFKDLYASLTGRKLFVWQARARDRVTVDEAFKYIREVLKwddekednyyggaedsfystdmssspfvrqe
meqkggeswKELVRKMLPPGAPLPEEMSELDYSIAMEYKGPPVSHDVPRVEPLDVNSRAIPtaeplsesqrsVANVGAPVIEPIPLPVSRIADGVTDSPTQSPRLSASSESVVSVLQNPDFSSAspsaspgsiqnrpsnppkpvnegrrvpvvtfntvdstvdrserkevdvetptypkyvgvskekkrrksrvcyrcgkgkwetkesclvcDAKYCSNCVLRAMGSMPEGRNAVLSRLLSPLEVKQIMKAEKecsanqlrpeQLIVNGFPLKPEEMAELLGCPLPPRKLKPGKYWYDKESGlwgkegekpDRIISSNLNFsgklspdasngntqvFINGREITKLERRVLKlanvqcprdthfwvYDDGRYEEEGQNNIRGNIWEKATTRFVCSLLSLPVLHGQPQGHRDEASNYTTVPNYLEQKKVQKLLLLGLQGAGTSTIFKQAKFLYGNKFTAEELQDIKLMIQSNMYRYLSILLDGRERFEEEATARMNAQGSHDQISEAGGEADPSETTQCIYSINPRLKHFSDWLLDIIATGDLDAFFPAATREYAPLVDEVWKDPAIQETYKRKDELHFLPDVAEYFLSRAVEVSSNEYEPSDRDILYAEGVTQGNGLAFIEFSLDDRSPMSETytdnlevqpqplTKYQLIRVNAKGMNEGCKWVEMFEDVRVVVFCVALSDYDQMWICPessgsgtllQNKMIQSKELFEMMIRHPCFKDTPFVLILNKYDLFEEKVNRVHLSTCEWFNDFSPVRTHHNNQSLAHQAYYYVAMKFKDLYASLTGRKLFVWqarardrvtvdEAFKYIRevlkwddekednyyggaedsfystdmssspfvrqe
MEQKGGESWKELVRKMLPPGAPLPEEMSELDYSIAMEYKGPPVSHDVPRVEPLDVNSRAIPTAEPLSESQRSVANVGAPVIEPIPLPVSRIADGVTDSPTQSPRLsassesvvsvLQNPDFssaspsaspgsIQNRPSNPPKPVNEGRRVPVVTFNTVDSTVDRSERKEVDVETPTYPKYVGVskekkrrksrVCYRCGKGKWETKESCLVCDAKYCSNCVLRAMGSMPEGRNAVLSRLLSPLEVKQIMKAEKECSANQLRPEQLIVNGFPLKPEEMAELLGCPLPPRKLKPGKYWYDKESGLWGKEGEKPDRIISSNLNFSGKLSPDASNGNTQVFINGREITKLERRVLKLANVQCPRDTHFWVYDDGRYEEEGQNNIRGNIWEKATTRFVCSLLSLPVLHGQPQGHRDEASNYTTVPNYleqkkvqkllllglqgagTSTIFKQAKFLYGNKFTAEELQDIKLMIQSNMYRYLSILLDGRERFEEEATARMNAQGSHDQISEAGGEADPSETTQCIYSINPRLKHFSDWLLDIIATGDLDAFFPAATREYAPLVDEVWKDPAIQETYKRKDELHFLPDVAEYFLSRAVEVSSNEYEPSDRDILYAEGVTQGNGLAFIEFSLDDRSPMSETYTDNLEVQPQPLTKYQLIRVNAKGMNEGCKWVEMFEDVRVVVFCVALSDYDQMWICPESSGSGTLLQNKMIQSKELFEMMIRHPCFKDTPFVLILNKYDLFEEKVNRVHLSTCEWFNDFSPVRTHHNNQSLAHQAYYYVAMKFKDLYASLTGRKLFVWQARARDRVTVDEAFKYIREVLKWDDEKEDNYYGGAEDSFYSTDMSSSPFVRQE
********************************************************************************************************************************************************VTF************************YV**********SRVCYRCGKGKWETKESCLVCDAKYCSNCVLRAMGSMPEGRNAVLSRLLSPLEVKQI**************EQLIVNGFPLKPEEMAELLGCPLPPRKLKPGKYWYDKESGLWG****************************TQVFINGREITKLERRVLKLANVQCPRDTHFWVYDDGRYEEEGQNNIRGNIWEKATTRFVCSLLSLPVLHGQ*********NYTTVPNYLEQKKVQKLLLLGLQGAGTSTIFKQAKFLYGNKFTAEELQDIKLMIQSNMYRYLSILLDG**********************************QCIYSINPRLKHFSDWLLDIIATGDLDAFFPAATREYAPLVDEVWKDPAIQETYKRKDELHFLPDVAEYFLSRAVEVSSNEY**SDRDILYAEGVTQGNGLAFIEFSLD************LEVQPQPLTKYQLIRVNAKGMNEGCKWVEMFEDVRVVVFCVALSDYDQMWICPESSGSGTLLQNKMIQSKELFEMMIRHPCFKDTPFVLILNKYDLFEEKVNRVHLSTCEWFNDFSPVRTHHNNQSLAHQAYYYVAMKFKDLYASLTGRKLFVWQARARDRVTVDEAFKYIREVLKWDDEKEDNYYG********************
************VRKMLPPGAPLPEEMSELDYSIAMEYKGPPVSHDVPRVEPLDVNSRAIP**********************I*****************************************************************************************************************CGKGKWETKESCLVCDAKYCSNCVLRAMGSMPEGRNAVLSRLLSPLEVKQIMKAEKECSANQLRPEQLIVNGFPLKPEEMAELLGCPLPPRKLKPGKYWYDKESGLWGKEGEKPDRIISSNLNFSGKLSPDASNGNTQVFINGREITKLERRVLKLANVQCPRDTHFWVYDDGRY*************EKATTRFVC*******************************KKVQKLLLLGLQGAGTSTIFKQAKFLYGNKFTAEELQDIKLMIQSNMYRYLSILLDGRERFEEEATARMNAQGSHDQ**********SETTQCIYSINPRLKHFSDWLLDIIATGDLDAFFPAATREYAPLVDEVWKDPAIQETYKRKDELHFLPDVAEYFLSRAVEVSSNEYEPSDRDILYAEGVTQGNGLAFIEFSLDDRSPMSETYTDNLEVQPQPLTKYQLIRVNAKGMNEGCKWVEMFEDVRVVVFCVALSDYDQMWICPESSGSGTLLQNKMIQSKELFEMMIRHPCFKDTPFVLILNKYDLFEEKVNRVHLSTCEWFNDFSPVRTHHNNQSLAHQAYYYVAMKFKDLYASLTGRKLFVWQARARDRVTVDEAFKYIREVLKWDDEKEDNYYGGAEDS***************
********WKELVRKMLPPGAPLPEEMSELDYSIAMEYKGPPVSHDVPRVEPLDVNSRAIPTA*********VANVGAPVIEPIPLPVSRIADG*******************SVLQNP************************VNEGRRVPVVTFNTVDSTVDRSERKEVDVETPTYPKYV*************CYRCGKGKWETKESCLVCDAKYCSNCVLRAMGSMPEGRNAVLSRLLSPLEVKQIMKAEKECSANQLRPEQLIVNGFPLKPEEMAELLGCPLPPRKLKPGKYWYDKESGLWGKEGEKPDRIISSNLNFSGKLSPDASNGNTQVFINGREITKLERRVLKLANVQCPRDTHFWVYDDGRYEEEGQNNIRGNIWEKATTRFVCSLLSLPVLHGQPQGHRDEASNYTTVPNYLEQKKVQKLLLLGLQGAGTSTIFKQAKFLYGNKFTAEELQDIKLMIQSNMYRYLSILLDGRERFEEEAT***********************TTQCIYSINPRLKHFSDWLLDIIATGDLDAFFPAATREYAPLVDEVWKDPAIQETYKRKDELHFLPDVAEYFLSRAVE********SDRDILYAEGVTQGNGLAFIEFSLDDRSPMSETYTDNLEVQPQPLTKYQLIRVNAKGMNEGCKWVEMFEDVRVVVFCVALSDYDQMWICPESSGSGTLLQNKMIQSKELFEMMIRHPCFKDTPFVLILNKYDLFEEKVNRVHLSTCEWFNDFSPVRTHHNNQSLAHQAYYYVAMKFKDLYASLTGRKLFVWQARARDRVTVDEAFKYIREVLKWDDEKEDNYYGGAEDSFYS************
********WKELVRKMLPPGAPLPEEMSELDYSIAMEYKGPPVSHDVPRVEPLDVNSRAIPTAEPLS*******NVGA****************************************************************************************************************KSRVCYRCGKGKWETKESCLVCDAKYCSNCVLRAMGSMPEGRNAVLSRLLSPLEVKQIMKAEKECSANQLRPEQLIVNGFPLKPEEMAELLGCPLPPRKLKPGKYWYDKESGLWGKEGEKPDRIISSNLNFSGKLSPDASNGNTQVFINGREITKLERRVLKLANVQCPRDTHFWVYDDGRYEEEGQNNIRGNIWEKATTRFVCSLLSLPVLHGQPQGHRDEASNYTTVPNYLEQKKVQKLLLLGLQGAGTSTIFKQAKFLYGNKFTAEELQDIKLMIQSNMYRYLSILLDGRERFEEEATARMNAQGSHDQISEAGGEADPSETTQCIYSINPRLKHFSDWLLDIIATGDLDAFFPAATREYAPLVDEVWKDPAIQETYKRKDELHFLPDVAEYFLSRAVEVSSNEYEPSDRDILYAEGVTQGNGLAFIEFSLDDRSPMSETYTDNLEVQPQPLTKYQLIRVNAKGMNEGCKWVEMFEDVRVVVFCVALSDYDQMWICPESSGSGTLLQNKMIQSKELFEMMIRHPCFKDTPFVLILNKYDLFEEKVNRVHLSTCEWFNDFSPVRTHHNNQSLAHQAYYYVAMKFKDLYASLTGRKLFVWQARARDRVTVDEAFKYIREVLKWDDEKEDNYYGGAED****************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQKGGESWKELVRKMLPPGAPLPEEMSELDYSIAMEYKGPPVSHDVPRVEPLDVNSRAIPTAEPLSESQRSVANVGAPVIEPIPLPVSRIADGVTDSPTQSPRLSASSESVVSVLQNPDFSSASPSASPGSIQNRPSNPPKPVNEGRRVPVVTFNTVDSTVDRSERKEVDVETPTYPKYVGVSKEKKRRKSRVCYRCGKGKWETKESCLVCDAKYCSNCVLRAMGSMPEGRNAVLSRLLSPLEVKQIMKAEKECSANQLRPEQLIVNGFPLKPEEMAELLGCPLPPRKLKPGKYWYDKESGLWGKEGEKPDRIISSNLNFSGKLSPDASNGNTQVFINGREITKLERRVLKLANVQCPRDTHFWVYDDGRYEEEGQNNIRGNIWEKATTRFVCSLLSLPVLHGQPQGHRDEASNYTTVPNYLEQKKVQKLLLLGLQGAGTSTIFKQAKFLYGNKFTAEELQDIKLMIQSNMYRYLSILLDGRERFEEEATARMNAQGSHDQISEAGGEADPSETTQCIYSINPRLKHFSDWLLDIIATGDLDAFFPAATREYAPLVDEVWKDPAIQETYKRKDELHFLPDVAEYFLSRAVEVSSNEYEPSDRDILYAEGVTQGNGLAFIEFSLDDRSPMSETYTDNLEVQPQPLTKYQLIRVNAKGMNEGCKWVEMFEDVRVVVFCVALSDYDQMWICPESSGSGTLLQNKMIQSKELFEMMIRHPCFKDTPFVLILNKYDLFEEKVNRVHLSTCEWFNDFSPVRTHHNNQSLAHQAYYYVAMKFKDLYASLTGRKLFVWQARARDRVTVDEAFKYIREVLKWDDEKEDNYYGGAEDSFYSTDMSSSPFVRQE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query844 2.2.26 [Sep-21-2011]
P93163385 Guanine nucleotide-bindin no no 0.402 0.883 0.357 8e-54
P49082384 Guanine nucleotide-bindin N/A no 0.395 0.869 0.350 5e-51
O04278384 Guanine nucleotide-bindin N/A no 0.395 0.869 0.345 1e-49
P93564384 Guanine nucleotide-bindin N/A no 0.417 0.916 0.340 1e-49
Q40224384 Guanine nucleotide-bindin N/A no 0.395 0.869 0.342 2e-49
Q0DJ33380 Guanine nucleotide-bindin no no 0.395 0.878 0.345 2e-49
A2Y3B5380 Guanine nucleotide-bindin N/A no 0.395 0.878 0.345 2e-49
P26981384 Guanine nucleotide-bindin N/A no 0.395 0.869 0.350 2e-49
O04279384 Guanine nucleotide-bindin N/A no 0.395 0.869 0.332 4e-49
P49084385 Guanine nucleotide-bindin no no 0.395 0.867 0.354 5e-49
>sp|P93163|GPA2_SOYBN Guanine nucleotide-binding protein alpha-2 subunit OS=Glycine max GN=GPA2 PE=2 SV=1 Back     alignment and function desciption
 Score =  212 bits (540), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 143/400 (35%), Positives = 212/400 (53%), Gaps = 60/400 (15%)

Query: 419 VPNYLEQKKVQKLLLLGLQGAGTSTIFKQAKFLYGNKFTAEELQDIKLMIQSNMYRYLSI 478
           V N   +K +QKLLLLG   +G STIFKQ K L+   F   EL+    +I +N+Y+ + +
Sbjct: 31  VRNERAEKHIQKLLLLGAGESGKSTIFKQIKLLFQTGFDEAELKSYLPVIHANVYQTIKL 90

Query: 479 LLDGRERFEEEATARMNAQGSHDQISEAGGEADPSETTQCIYSINPRLKHFSDWLLDIIA 538
           L DG + F                   A  + D S+     Y I+   K   + LL+I  
Sbjct: 91  LHDGSKEF-------------------AQNDVDSSK-----YVISNENKEIGEKLLEI-- 124

Query: 539 TGDLDAFFPAATREYAPLVDEVWKDPAIQETYKRKDELHFLPDVAEYFLSRAVEVSSNEY 598
            G LD  +P  ++E A  ++ +WKDPAIQETY R  EL  +PD  +YF+     +S   Y
Sbjct: 125 GGRLD--YPYLSKELAQEIENLWKDPAIQETYARGSELQ-IPDCTDYFMENLQRLSDANY 181

Query: 599 EPSDRDILYAEGVTQGNGLAFIEFSLDDRSPMSETYTDNLEVQPQPLTKYQLIRVNAKGM 658
            P+  D+LYA   T   G+  I+FS     P+ E    + EV       Y+L  V  +  
Sbjct: 182 VPTKEDVLYARVRT--TGVVEIQFS-----PVGENKKSD-EV-------YRLFDVGGQ-R 225

Query: 659 NEGCKWVEMFEDVRVVVFCVALSDYDQMWICPESSGSGTLLQNKMIQSKELFEMMIRHPC 718
           NE  KW+ +FE V  V+FC A+S+YDQ     E+       +N+M+++KELFE +++ PC
Sbjct: 226 NERRKWIHLFEGVSAVIFCAAISEYDQTLFEDEN-------RNRMMETKELFEWILKQPC 278

Query: 719 FKDTPFVLILNKYDLFEEKVNRVHLSTCEWFNDFSPVRTHHNNQSLAHQAYYYVAMKFKD 778
           F+ T F+L LNK+D+FE+K+ +V L+ CEWF D+ PV T    Q + H AY +V  KF++
Sbjct: 279 FEKTSFMLFLNKFDIFEKKILKVPLNVCEWFKDYQPVST--GKQEIEH-AYEFVKKKFEE 335

Query: 779 LYASLTG-----RKLFVWQARARDRVTVDEAFKYIREVLK 813
            Y   T      R   +++  A D+  V + FK + E L+
Sbjct: 336 SYFQSTAPDRVDRVFKIYRTTALDQKVVKKTFKLVDETLR 375
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
Glycine max (taxid: 3847)
>sp|P49082|GPA1_LOTJA Guanine nucleotide-binding protein alpha-1 subunit OS=Lotus japonicus GN=GPA1 PE=2 SV=1 Back     alignment and function description
>sp|O04278|GPA1_PEA Guanine nucleotide-binding protein alpha-1 subunit OS=Pisum sativum GN=GPA1 PE=2 SV=1 Back     alignment and function description
>sp|P93564|GPA1_SOLTU Guanine nucleotide-binding protein alpha-1 subunit OS=Solanum tuberosum GN=GPA1 PE=2 SV=1 Back     alignment and function description
>sp|Q40224|GPA1_LUPLU Guanine nucleotide-binding protein alpha-1 subunit OS=Lupinus luteus GN=GPA1 PE=2 SV=1 Back     alignment and function description
>sp|Q0DJ33|GPA1_ORYSJ Guanine nucleotide-binding protein alpha-1 subunit OS=Oryza sativa subsp. japonica GN=GPA1 PE=1 SV=2 Back     alignment and function description
>sp|A2Y3B5|GPA1_ORYSI Guanine nucleotide-binding protein alpha-1 subunit OS=Oryza sativa subsp. indica GN=GPA1 PE=2 SV=2 Back     alignment and function description
>sp|P26981|GPA1_SOLLC Guanine nucleotide-binding protein alpha-1 subunit OS=Solanum lycopersicum GN=GPA1 PE=2 SV=1 Back     alignment and function description
>sp|O04279|GPA2_PEA Guanine nucleotide-binding protein alpha-2 subunit OS=Pisum sativum GN=GPA2 PE=2 SV=1 Back     alignment and function description
>sp|P49084|GPA1_SOYBN Guanine nucleotide-binding protein alpha-1 subunit OS=Glycine max GN=GPA1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query844
255555919 1203 GTP-binding protein alpha subunit, gna, 0.990 0.694 0.844 0.0
224138260853 predicted protein [Populus trichocarpa] 0.984 0.974 0.830 0.0
356496050860 PREDICTED: uncharacterized protein LOC10 0.994 0.975 0.8 0.0
356531467861 PREDICTED: uncharacterized protein LOC10 0.995 0.975 0.795 0.0
359474450863 PREDICTED: uncharacterized protein LOC10 0.988 0.966 0.817 0.0
449456739867 PREDICTED: uncharacterized protein LOC10 0.979 0.953 0.805 0.0
449509504869 PREDICTED: uncharacterized LOC101207353 0.979 0.951 0.804 0.0
357484831839 Guanine nucleotide-binding protein alpha 0.966 0.972 0.752 0.0
297742015735 unnamed protein product [Vitis vinifera] 0.761 0.874 0.847 0.0
15222516848 extra-large GTP-binding protein 3 [Arabi 0.957 0.952 0.687 0.0
>gi|255555919|ref|XP_002518995.1| GTP-binding protein alpha subunit, gna, putative [Ricinus communis] gi|223541982|gb|EEF43528.1| GTP-binding protein alpha subunit, gna, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1460 bits (3780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 734/869 (84%), Positives = 786/869 (90%), Gaps = 33/869 (3%)

Query: 1   MEQKGGESWKELVRKMLPPGAPLPEEMSELDYSIAMEYKGPPVSHDVPRVEPLDVNSRAI 60
           MEQ+ GESW+EL++KMLP GA LPE+ S+LDYSIA+EY+GPPV + VP+VEPLDV+S+AI
Sbjct: 1   MEQREGESWRELMKKMLPAGASLPEDDSKLDYSIAIEYEGPPVPYKVPKVEPLDVSSQAI 60

Query: 61  PTAEPLSESQRSVANVGAPVIEPIPLPVSRIADGVTDSPTQSPRLSASSESVVSVLQNPD 120
           PTAEPLSESQRS  N+  PVIEPIPLPVS IA GVT+SPTQSPRLSASSESVVSVLQNPD
Sbjct: 61  PTAEPLSESQRSATNLATPVIEPIPLPVSCIA-GVTNSPTQSPRLSASSESVVSVLQNPD 119

Query: 121 FSSASPSASPGSIQNRPSNPPKPV---NEGRRVPVVTFNTVDSTVDRSERKEVDVETPTY 177
           FSSAS  ASPGS+ + PSN  +     NE RRVPVVTFNTVD    RSERK+VDVE P Y
Sbjct: 120 FSSAS--ASPGSV-HIPSNDNQSKLAGNEVRRVPVVTFNTVD----RSERKDVDVEKPFY 172

Query: 178 PKYVGVSKEKKRRKSRVCYRCGKGKWETKESCLVCDAKYCSNCVLRAMGSMPEGRNAV-- 235
           P+YVGVSK KK++KSRVCYRC KGKWETKESCLVCDAKYCSNCVLRAMGSMPEGR  V  
Sbjct: 173 PEYVGVSKGKKKQKSRVCYRCRKGKWETKESCLVCDAKYCSNCVLRAMGSMPEGRKCVTC 232

Query: 236 -------------------LSRLLSPLEVKQIMKAEKECSANQLRPEQLIVNGFPLKPEE 276
                              LSRLLSPLEVKQIMKAEKECSANQLRPEQLIVNGFPLKPEE
Sbjct: 233 IGQAIDESKRSKLGKHSRVLSRLLSPLEVKQIMKAEKECSANQLRPEQLIVNGFPLKPEE 292

Query: 277 MAELLGCPLPPRKLKPGKYWYDKESGLWGKEGEKPDRIISSNLNFSGKLSPDASNGNTQV 336
           MAELLGCPLPPRKLKPG+YWYDKESGLWGKEGEKPDR+ISSNLNF+G+LSPDASNG+T+V
Sbjct: 293 MAELLGCPLPPRKLKPGRYWYDKESGLWGKEGEKPDRVISSNLNFTGRLSPDASNGSTEV 352

Query: 337 FINGREITKLERRVLKLANVQCPRDTHFWVYDDGRYEEEGQNNIRGNIWEKATTRFVCSL 396
           +INGREITKLE RVLKLANVQCPRDTHFWVYDDGRYEEEGQNNIRGNIWEKA+TRFVC+L
Sbjct: 353 YINGREITKLELRVLKLANVQCPRDTHFWVYDDGRYEEEGQNNIRGNIWEKASTRFVCAL 412

Query: 397 LSLPVLHGQPQGHRDEASNYTTVPNYLEQKKVQKLLLLGLQGAGTSTIFKQAKFLYGNKF 456
            SLPV HGQP G RDEASNYTTVPNYLEQKKV KLLLLGLQG+GTSTIFKQAKF+YGNKF
Sbjct: 413 FSLPVPHGQPHGQRDEASNYTTVPNYLEQKKVHKLLLLGLQGSGTSTIFKQAKFMYGNKF 472

Query: 457 TAEELQDIKLMIQSNMYRYLSILLDGRERFEEEATARMNAQGSHDQISEAGGEADPSETT 516
           TAEELQDIKLMIQSNMYRYLSILLDGRERFEEEA +R     + D+ S +GGE D  ET 
Sbjct: 473 TAEELQDIKLMIQSNMYRYLSILLDGRERFEEEAISRKKELDTDDRSSLSGGELDSGETN 532

Query: 517 QCIYSINPRLKHFSDWLLDIIATGDLDAFFPAATREYAPLVDEVWKDPAIQETYKRKDEL 576
           QCIYSINPRLKHFSDWLLDIIATGDLDAFFPAATREYAPLV+EVWKDPAIQETY+RKDEL
Sbjct: 533 QCIYSINPRLKHFSDWLLDIIATGDLDAFFPAATREYAPLVEEVWKDPAIQETYRRKDEL 592

Query: 577 HFLPDVAEYFLSRAVEVSSNEYEPSDRDILYAEGVTQGNGLAFIEFSLDDRSPMSETYTD 636
           HFLPDVAEYFLSRAVEVSSNEYEPS+RDILYAEGVTQGNGLAFIEFSLDDRSPMSETYTD
Sbjct: 593 HFLPDVAEYFLSRAVEVSSNEYEPSERDILYAEGVTQGNGLAFIEFSLDDRSPMSETYTD 652

Query: 637 NLEVQPQPLTKYQLIRVNAKGMNEGCKWVEMFEDVRVVVFCVALSDYDQMWICPESSGSG 696
           NLE QP PLTKYQLIRVNAKGMNEGCKWVEMFEDVRVVVFCVALSDYDQMW+ PE++GSG
Sbjct: 653 NLEAQPPPLTKYQLIRVNAKGMNEGCKWVEMFEDVRVVVFCVALSDYDQMWLAPETNGSG 712

Query: 697 TLLQNKMIQSKELFEMMIRHPCFKDTPFVLILNKYDLFEEKVNRVHLSTCEWFNDFSPVR 756
           +LLQNK++QSKELFE MIRHPCFK+TPFVL+LNKYDLFEEKVNRV LS CEWFNDFSP+R
Sbjct: 713 SLLQNKIMQSKELFETMIRHPCFKNTPFVLVLNKYDLFEEKVNRVQLSACEWFNDFSPLR 772

Query: 757 THHNNQSLAHQAYYYVAMKFKDLYASLTGRKLFVWQARARDRVTVDEAFKYIREVLKWDD 816
            HHN+Q+LAHQAYYYVAMKFKDLYASLTGRKLFVWQARARDRVT+DEAFKYIREVLKWD+
Sbjct: 773 PHHNSQTLAHQAYYYVAMKFKDLYASLTGRKLFVWQARARDRVTIDEAFKYIREVLKWDE 832

Query: 817 EKEDNYY-GGAEDSFYSTDMSSSPFVRQE 844
           EKEDNYY GGAEDSFYSTDMSSSPFVR E
Sbjct: 833 EKEDNYYGGGAEDSFYSTDMSSSPFVRAE 861

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224138260|ref|XP_002326558.1| predicted protein [Populus trichocarpa] gi|222833880|gb|EEE72357.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356496050|ref|XP_003516883.1| PREDICTED: uncharacterized protein LOC100794534 [Glycine max] Back     alignment and taxonomy information
>gi|356531467|ref|XP_003534299.1| PREDICTED: uncharacterized protein LOC100803926 [Glycine max] Back     alignment and taxonomy information
>gi|359474450|ref|XP_003631470.1| PREDICTED: uncharacterized protein LOC100248864 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449456739|ref|XP_004146106.1| PREDICTED: uncharacterized protein LOC101207353 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449509504|ref|XP_004163607.1| PREDICTED: uncharacterized LOC101207353 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357484831|ref|XP_003612703.1| Guanine nucleotide-binding protein alpha-2 subunit [Medicago truncatula] gi|355514038|gb|AES95661.1| Guanine nucleotide-binding protein alpha-2 subunit [Medicago truncatula] Back     alignment and taxonomy information
>gi|297742015|emb|CBI33802.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|15222516|ref|NP_174475.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] gi|30692624|ref|NP_849737.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] gi|334182982|ref|NP_001185125.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] gi|12321289|gb|AAG50710.1|AC079041_3 G-protein, putative [Arabidopsis thaliana] gi|12321467|gb|AAG50792.1|AC074309_9 G-protein alpha subunit, putative [Arabidopsis thaliana] gi|110738987|dbj|BAF01414.1| hypothetical protein [Arabidopsis thaliana] gi|222423921|dbj|BAH19924.1| AT1G31930 [Arabidopsis thaliana] gi|222424740|dbj|BAH20323.1| AT1G31930 [Arabidopsis thaliana] gi|251737921|gb|ACT10805.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] gi|332193296|gb|AEE31417.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] gi|332193297|gb|AEE31418.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] gi|332193298|gb|AEE31419.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query844
TAIR|locus:2034446848 XLG3 "AT1G31930" [Arabidopsis 0.745 0.741 0.739 4.5e-286
UNIPROTKB|Q9LI02867 P0029D06.12 "cDNA clone:J02303 0.759 0.739 0.678 6.7e-239
TAIR|locus:2046738888 XLG1 "AT2G23460" [Arabidopsis 0.723 0.688 0.502 1.8e-181
UNIPROTKB|Q0IM71686 Os12g0593000 "Os12g0593000 pro 0.700 0.861 0.469 3.9e-153
UNIPROTKB|Q0IZ94440 Os10g0117800 "Os10g0117800 pro 0.513 0.984 0.568 4.4e-132
TAIR|locus:2116204861 XLG2 "AT4G34390" [Arabidopsis 0.393 0.385 0.417 2.8e-84
TAIR|locus:2005529383 GP ALPHA 1 "AT2G26300" [Arabid 0.183 0.404 0.385 5e-39
UNIPROTKB|Q0DJ33380 GPA1 "Guanine nucleotide-bindi 0.183 0.407 0.385 7.6e-33
UNIPROTKB|P0C7Q4354 GNAT3 "Guanine nucleotide-bind 0.171 0.409 0.310 4.6e-21
UNIPROTKB|E2R3I0355 GNAT3 "Uncharacterized protein 0.172 0.411 0.298 6.4e-21
TAIR|locus:2034446 XLG3 "AT1G31930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2504 (886.5 bits), Expect = 4.5e-286, Sum P(2) = 4.5e-286
 Identities = 474/641 (73%), Positives = 544/641 (84%)

Query:   213 DAKYCSNCVLRAMGSMPE---GRNA-VLSRLLSPLEVKQIMKAEKECSANQLRPEQLIVN 268
             + + C +C+ +A+        G+++ VLSRLLSPLEVKQIMKAEKEC+ANQLRPEQLIVN
Sbjct:   211 EGRKCVSCIGQAIDESKRSKLGKHSRVLSRLLSPLEVKQIMKAEKECTANQLRPEQLIVN 270

Query:   269 GFPLKPEEMAELLGCPLPPRKLKPGKYWYDKESGLWGKEGEKPDRIISSNLNFSGKLSPD 328
             G+PLKPEEMA+LL C LPP+KLKPG+YWYDKESGLWGKEGEKPDR+ISSNLNF+GKLSPD
Sbjct:   271 GYPLKPEEMADLLNCLLPPQKLKPGRYWYDKESGLWGKEGEKPDRVISSNLNFTGKLSPD 330

Query:   329 ASNGNTQVFINGREITKLERRVLKLANVQCPRDTHFWVYDDGRYEEEGQNNIRGNIWEKA 388
             ASNGNT+V+INGREITKLE R+LKLANVQCPRDTHFWVYDDGRYEEEGQNNIRGNIWEKA
Sbjct:   331 ASNGNTEVYINGREITKLELRILKLANVQCPRDTHFWVYDDGRYEEEGQNNIRGNIWEKA 390

Query:   389 TTRFVCSLLSLPVLHGQPQGHRDEASNYTTVPNYXXXXXXXXXXXXXXXXXXTSTIFKQA 448
             +TRF+C+L SLPV  GQP+G    +SNY TVPNY                  TSTIFKQA
Sbjct:   391 STRFMCALFSLPVPQGQPRGTVQPSSNYATVPNYIEHKKIQKLLLLGIEGSGTSTIFKQA 450

Query:   449 KFLYGNKFTAEELQDIKLMIQSNMYRYLSILLDGRERFEEEATARMNAQGSHDQISEAGG 508
             KFLYGNKF+ EELQDIKLM+QSNMYRYLSILLDGRERFEEEA +  + +G +    ++GG
Sbjct:   451 KFLYGNKFSVEELQDIKLMVQSNMYRYLSILLDGRERFEEEALS--HTRGLNAVEGDSGG 508

Query:   509 EADPSE----TTQCIYSINPRLKHFSDWLLDIIATGDLDAFFPAATREYAPLVDEVWKDP 564
             E    E    T Q +Y++NPRLKHFSDWLLDIIATGDLDAFFPAATREYAPLV+EVWKDP
Sbjct:   509 EEANDEGTVTTPQSVYTLNPRLKHFSDWLLDIIATGDLDAFFPAATREYAPLVEEVWKDP 568

Query:   565 AIQETYKRKDELHFLPDVAEYFLSRAVEVSSNEYEPSDRDILYAEGVTQGNGLAFIEFSL 624
             AIQ TY+RKDELHFLPDVAEYFLSRA+EVSSNEYEPS+RDI+YAEGVTQGNGLAF+EFSL
Sbjct:   569 AIQATYRRKDELHFLPDVAEYFLSRAMEVSSNEYEPSERDIVYAEGVTQGNGLAFMEFSL 628

Query:   625 DDRSPMSETYTDNLEVQPQPLTKYQLIRVNAKGMNEGCKWVEMFEDVRVVVFCVALSDYD 684
              D SPMSE+Y +N +    P  KYQLIRVNAKGMN+ CKWVEMFEDVR V+FC++LSDYD
Sbjct:   629 SDHSPMSESYPENPDALSSPQPKYQLIRVNAKGMNDSCKWVEMFEDVRAVIFCISLSDYD 688

Query:   685 QMWICPESSGSGTLLQNKMIQSKELFEMMIRHPCFKDTPFVLILNKYDLFEEKVNRVHLS 744
             Q+ I PESSG+    QNKMIQSKELFE M++HPCFKDTPF+LILNKYD FEEK+NR  L+
Sbjct:   689 QINITPESSGT-VQYQNKMIQSKELFESMVKHPCFKDTPFILILNKYDQFEEKLNRAPLT 747

Query:   745 TCEWFNDFSPVRTHHNNQSLAHQAYYYVAMKFKDLYASLTGRKLFVWQARARDRVTVDEA 804
             +C+WF+DF PVRT++N QSLA+QAY+YVAMKFK LY S+TG+KLFVWQARARDR  VDE 
Sbjct:   748 SCDWFSDFCPVRTNNNVQSLAYQAYFYVAMKFKLLYFSITGQKLFVWQARARDRANVDEG 807

Query:   805 FKYIREVLKWDDEKEDNYY-GGAEDSFYSTDMSSSPFVRQE 844
             FKY+REVLKWD+EKE++Y  GG EDSFYSTDMSSSP+  +E
Sbjct:   808 FKYVREVLKWDEEKEESYLNGGGEDSFYSTDMSSSPYRPEE 848
GO:0001664 "G-protein coupled receptor binding" evidence=IBA
GO:0003924 "GTPase activity" evidence=IBA
GO:0004871 "signal transducer activity" evidence=IEA;ISS;IBA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005834 "heterotrimeric G-protein complex" evidence=IBA
GO:0006184 "GTP catabolic process" evidence=IBA
GO:0007165 "signal transduction" evidence=IEA
GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA;ISS
GO:0007188 "adenylate cyclase-modulating G-protein coupled receptor signaling pathway" evidence=IBA
GO:0019001 "guanyl nucleotide binding" evidence=IEA
GO:0031234 "extrinsic to internal side of plasma membrane" evidence=IBA
GO:0031683 "G-protein beta/gamma-subunit complex binding" evidence=IBA
GO:0005634 "nucleus" evidence=IDA
GO:0009737 "response to abscisic acid stimulus" evidence=IGI
GO:0009744 "response to sucrose stimulus" evidence=IGI
GO:0009749 "response to glucose stimulus" evidence=IGI
GO:0009750 "response to fructose stimulus" evidence=IGI
GO:0010555 "response to mannitol stimulus" evidence=IGI
GO:2000067 "regulation of root morphogenesis" evidence=IGI
GO:0009630 "gravitropism" evidence=IGI;RCA
GO:0009652 "thigmotropism" evidence=IGI
GO:0009723 "response to ethylene stimulus" evidence=RCA;IMP
GO:0048364 "root development" evidence=IGI
UNIPROTKB|Q9LI02 P0029D06.12 "cDNA clone:J023031J07, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2046738 XLG1 "AT2G23460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0IM71 Os12g0593000 "Os12g0593000 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q0IZ94 Os10g0117800 "Os10g0117800 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2116204 XLG2 "AT4G34390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005529 GP ALPHA 1 "AT2G26300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0DJ33 GPA1 "Guanine nucleotide-binding protein alpha-1 subunit" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|P0C7Q4 GNAT3 "Guanine nucleotide-binding protein G(t) subunit alpha-3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R3I0 GNAT3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query844
pfam00503329 pfam00503, G-alpha, G-protein alpha subunit 2e-83
cd00066315 cd00066, G-alpha, Alpha subunit of G proteins (gua 2e-83
smart00275342 smart00275, G_alpha, G protein alpha subunit 9e-47
>gnl|CDD|215955 pfam00503, G-alpha, G-protein alpha subunit Back     alignment and domain information 
 Score =  269 bits (691), Expect = 2e-83
 Identities = 116/397 (29%), Positives = 174/397 (43%), Gaps = 68/397 (17%)

Query: 427 KVQKLLLLGLQGAGTSTIFKQAKFLYGNKFTAEELQDIKLMIQSNMYRYLSILLDGRERF 486
           +  KLLLLG   +G STI KQ K L+G  F+ EE +  + +I SN+ R L  LL+  E  
Sbjct: 1   REIKLLLLGAGESGKSTILKQMKILHGGGFSDEEREQYRAVIYSNIIRSLKTLLEALENL 60

Query: 487 EEEATARMNAQGSHDQISEAGGEADPSETTQCIYSINPRLKHFSDWLLDIIATGDLDAFF 546
           E E                               S +          L  I    LD   
Sbjct: 61  EIE------------------------------SSNSKPENEEIAKKLKSILDSLLDVDE 90

Query: 547 PAATREYAPLVDEVWKDPAIQETYKRKDELHFLPDVAEYFLSRAVEVSSNEYEPSDRDIL 606
              + E A  + E+W DP IQE Y R +E   L D A+YFL     ++S +Y P+D+DIL
Sbjct: 91  TRFSEELAEDIKELWNDPGIQEVYNRSNEFQ-LSDSAKYFLDNLDRIASPDYVPTDQDIL 149

Query: 607 YAEGVTQGNGLAFIEFSLDDRSPMSETYTDNLEVQPQPLTKYQLIRVNAKGMNEGCKWVE 666
            A   T   G+   +F                        K++L  V  +  +E  KW+ 
Sbjct: 150 RARVKT--TGIIETKFDFKGL-------------------KFRLFDVGGQ-RSERKKWIH 187

Query: 667 MFEDVRVVVFCVALSDYDQMWICPESSGSGTLLQNKMIQSKELFEMMIRHPCFKDTPFVL 726
            FEDV  ++F V+LS+YDQ  +  E         N++ +S  LFE +   P FK+TP +L
Sbjct: 188 CFEDVTAIIFVVSLSEYDQ--VLYEDDS-----TNRLEESLNLFEEICNSPWFKNTPIIL 240

Query: 727 ILNKYDLFEEKVNRVHLSTCEWFNDFSPVRTHHNNQSLAHQAYYYVAMKFKDLYASLTGR 786
            LNK DLFEEK+ +  LS    F ++        + +    A  Y+  KF +L  + + R
Sbjct: 241 FLNKKDLFEEKLKKGPLSDY--FPEYE------GDPNDYESASKYIRNKFLELNKNNSER 292

Query: 787 KLFVWQARARDRVTVDEAFKYIREVLKWDDEKEDNYY 823
           K++     A D   V   F+ +++++  ++ KE    
Sbjct: 293 KIYTHFTNATDTENVRFVFEAVKDIILQNNLKESGLL 329

G proteins couple receptors of extracellular signals to intracellular signaling pathways. The G protein alpha subunit binds guanyl nucleotide and is a weak GTPase. A set of residues that are unique to G-alpha as compared to its ancestor the Arf-like family form a ring of residues centered on the nucleotide binding site. A Ggamma is found fused to an inactive Galpha in the Dictyostelium protein gbqA. Length = 329
>gnl|CDD|206639 cd00066, G-alpha, Alpha subunit of G proteins (guanine nucleotide binding) Back     alignment and domain information
>gnl|CDD|214595 smart00275, G_alpha, G protein alpha subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 844
KOG0082354 consensus G-protein alpha subunit (small G protein 100.0
KOG0085359 consensus G protein subunit Galphaq/Galphay, small 100.0
smart00275342 G_alpha G protein alpha subunit. Subunit of G prot 100.0
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 100.0
PF00503389 G-alpha: G-protein alpha subunit; InterPro: IPR001 100.0
KOG0099379 consensus G protein subunit Galphas, small G prote 100.0
KOG0071180 consensus GTP-binding ADP-ribosylation factor Arf6 99.81
KOG0070181 consensus GTP-binding ADP-ribosylation factor Arf1 99.79
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.71
KOG0072182 consensus GTP-binding ADP-ribosylation factor-like 99.62
KOG0073185 consensus GTP-binding ADP-ribosylation factor-like 99.58
PLN00223181 ADP-ribosylation factor; Provisional 99.48
KOG0074185 consensus GTP-binding ADP-ribosylation factor-like 99.43
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.41
KOG0075186 consensus GTP-binding ADP-ribosylation factor-like 99.37
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.37
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.34
PTZ00133182 ADP-ribosylation factor; Provisional 99.32
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.31
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.31
KOG0076197 consensus GTP-binding ADP-ribosylation factor-like 99.3
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.25
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.17
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.16
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.15
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.14
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.11
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.06
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.06
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.04
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.02
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.0
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 98.97
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 98.96
PTZ00099176 rab6; Provisional 98.96
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 98.88
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 98.88
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 98.88
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 98.86
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 98.85
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 98.84
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 98.83
KOG0077193 consensus Vesicle coat complex COPII, GTPase subun 98.82
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 98.8
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 98.8
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 98.8
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 98.77
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 98.77
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 98.76
PTZ00369189 Ras-like protein; Provisional 98.75
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 98.75
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 98.74
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 98.74
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 98.74
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 98.73
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 98.69
PLN03071219 GTP-binding nuclear protein Ran; Provisional 98.69
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 98.67
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 98.67
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 98.66
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 98.66
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 98.66
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 98.65
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 98.65
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 98.65
cd04123162 Rab21 Rab21 subfamily. The localization and functi 98.64
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 98.63
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 98.63
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 98.62
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 98.62
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 98.62
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 98.61
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 98.61
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 98.6
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 98.59
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 98.59
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 98.59
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 98.59
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 98.58
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 98.57
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 98.57
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 98.57
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 98.57
PLN03118211 Rab family protein; Provisional 98.57
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 98.55
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 98.54
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 98.54
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 98.54
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 98.54
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 98.53
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 98.53
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 98.5
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 98.5
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 98.48
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 98.48
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 98.47
PLN03108210 Rab family protein; Provisional 98.47
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 98.46
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 98.46
cd00154159 Rab Rab family. Rab GTPases form the largest famil 98.46
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 98.45
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 98.44
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 98.44
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 98.43
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 98.41
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 98.4
cd00876160 Ras Ras family. The Ras family of the Ras superfam 98.4
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 98.4
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 98.38
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 98.37
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 98.37
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 98.37
PLN03110216 Rab GTPase; Provisional 98.34
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 98.32
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 98.28
cd04171164 SelB SelB subfamily. SelB is an elongation factor 98.27
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 98.27
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 98.26
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 98.24
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 98.23
cd00881189 GTP_translation_factor GTP translation factor fami 98.2
KOG0084205 consensus GTPase Rab1/YPT1, small G protein superf 98.18
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 98.17
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 98.16
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 98.15
PRK12299335 obgE GTPase CgtA; Reviewed 98.11
cd04105203 SR_beta Signal recognition particle receptor, beta 98.06
PRK04213201 GTP-binding protein; Provisional 98.03
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 98.02
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 98.0
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 97.98
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 97.97
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 97.97
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 97.97
KOG0078207 consensus GTP-binding protein SEC4, small G protei 97.95
PRK12296 500 obgE GTPase CgtA; Reviewed 97.95
KOG0094221 consensus GTPase Rab6/YPT6/Ryh1, small G protein s 97.94
PRK09866 741 hypothetical protein; Provisional 97.94
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 97.93
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 97.91
cd01881176 Obg_like The Obg-like subfamily consists of five w 97.89
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 97.87
KOG0092200 consensus GTPase Rab5/YPT51 and related small G pr 97.85
PLN00023334 GTP-binding protein; Provisional 97.83
TIGR00231161 small_GTP small GTP-binding protein domain. This m 97.82
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 97.77
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 97.74
COG1100219 GTPase SAR1 and related small G proteins [General 97.72
PRK12297424 obgE GTPase CgtA; Reviewed 97.7
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 97.63
KOG0093193 consensus GTPase Rab3, small G protein superfamily 97.59
PRK15467158 ethanolamine utilization protein EutP; Provisional 97.59
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 97.58
KOG0087222 consensus GTPase Rab11/YPT3, small G protein super 97.55
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 97.52
KOG0395196 consensus Ras-related GTPase [General function pre 97.5
PRK10218 607 GTP-binding protein; Provisional 97.49
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 97.47
PF09439181 SRPRB: Signal recognition particle receptor beta s 97.45
PRK03003 472 GTP-binding protein Der; Reviewed 97.43
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 97.4
PRK05433 600 GTP-binding protein LepA; Provisional 97.39
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 97.38
KOG0086214 consensus GTPase Rab4, small G protein superfamily 97.34
cd01878204 HflX HflX subfamily. A distinct conserved domain w 97.33
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 97.32
CHL00189 742 infB translation initiation factor 2; Provisional 97.31
PRK05306 787 infB translation initiation factor IF-2; Validated 97.29
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 97.29
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 97.28
PRK12298390 obgE GTPase CgtA; Reviewed 97.27
COG2229187 Predicted GTPase [General function prediction only 97.26
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 97.25
PRK12317 425 elongation factor 1-alpha; Reviewed 97.23
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 97.21
PRK00093435 GTP-binding protein Der; Reviewed 97.21
PRK15494339 era GTPase Era; Provisional 97.21
PRK03003472 GTP-binding protein Der; Reviewed 97.2
TIGR00436270 era GTP-binding protein Era. Era is an essential G 97.19
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 97.18
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 97.16
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 97.14
TIGR03680 406 eif2g_arch translation initiation factor 2 subunit 97.14
KOG0095213 consensus GTPase Rab30, small G protein superfamil 97.1
TIGR00483 426 EF-1_alpha translation elongation factor EF-1 alph 97.04
KOG0090238 consensus Signal recognition particle receptor, be 97.03
PRK00093 435 GTP-binding protein Der; Reviewed 97.02
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 97.01
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 96.93
KOG0098216 consensus GTPase Rab2, small G protein superfamily 96.93
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 96.92
KOG1673205 consensus Ras GTPases [General function prediction 96.92
PRK00089292 era GTPase Era; Reviewed 96.92
KOG0081219 consensus GTPase Rab27, small G protein superfamil 96.91
KOG0394210 consensus Ras-related GTPase [General function pre 96.87
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 96.79
KOG3883198 consensus Ras family small GTPase [Signal transduc 96.71
PRK00454196 engB GTP-binding protein YsxC; Reviewed 96.71
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 96.69
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 96.65
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 96.61
PRK11058426 GTPase HflX; Provisional 96.56
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 96.52
TIGR03597 360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 96.48
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 96.48
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 96.47
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 96.47
PRK04000 411 translation initiation factor IF-2 subunit gamma; 96.45
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 96.44
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 96.44
PRK13768253 GTPase; Provisional 96.4
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 96.31
KOG0393198 consensus Ras-related small GTPase, Rho type [Gene 96.27
KOG0088218 consensus GTPase Rab21, small G protein superfamil 96.23
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 96.22
KOG0091213 consensus GTPase Rab39, small G protein superfamil 96.17
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 96.16
PRK12740 668 elongation factor G; Reviewed 96.05
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 95.93
PRK12736 394 elongation factor Tu; Reviewed 95.9
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 95.89
PRK04004 586 translation initiation factor IF-2; Validated 95.86
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 95.83
PF0685858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte 95.74
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 95.71
KOG0097215 consensus GTPase Rab14, small G protein superfamil 95.71
KOG0080209 consensus GTPase Rab18, small G protein superfamil 95.68
KOG0079198 consensus GTP-binding protein H-ray, small G prote 95.58
KOG4252246 consensus GTP-binding protein [Signal transduction 95.49
cd01896233 DRG The developmentally regulated GTP-binding prot 95.45
TIGR02034 406 CysN sulfate adenylyltransferase, large subunit. H 95.32
TIGR00485394 EF-Tu translation elongation factor TU. This align 95.29
KOG0074185 consensus GTP-binding ADP-ribosylation factor-like 95.28
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 95.27
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 95.27
KOG0083192 consensus GTPase Rab26/Rab37, small G protein supe 95.26
PRK00741 526 prfC peptide chain release factor 3; Provisional 95.22
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 95.05
TIGR00503 527 prfC peptide chain release factor 3. This translat 95.04
PRK13351 687 elongation factor G; Reviewed 95.02
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 94.93
PRK14845 1049 translation initiation factor IF-2; Provisional 94.84
PF00025175 Arf: ADP-ribosylation factor family The prints ent 94.71
CHL00071 409 tufA elongation factor Tu 94.62
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 94.51
PRK00098298 GTPase RsgA; Reviewed 94.49
COG1159298 Era GTPase [General function prediction only] 94.47
PRK12289 352 GTPase RsgA; Reviewed 94.35
PRK13796 365 GTPase YqeH; Provisional 94.34
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 94.33
PTZ00327 460 eukaryotic translation initiation factor 2 gamma s 94.12
PRK12735396 elongation factor Tu; Reviewed 94.02
KOG1489366 consensus Predicted GTP-binding protein (ODN super 93.96
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 93.92
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 93.85
PRK12739 691 elongation factor G; Reviewed 93.67
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 93.6
PLN03127447 Elongation factor Tu; Provisional 93.59
PRK08118167 topology modulation protein; Reviewed 93.56
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 93.39
PRK07261171 topology modulation protein; Provisional 93.28
PRK00049396 elongation factor Tu; Reviewed 93.26
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 93.23
COG1160 444 Predicted GTPases [General function prediction onl 93.22
PLN03126 478 Elongation factor Tu; Provisional 93.22
COG0536369 Obg Predicted GTPase [General function prediction 93.14
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 93.08
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 93.07
KOG0462 650 consensus Elongation factor-type GTP-binding prote 93.0
TIGR00231161 small_GTP small GTP-binding protein domain. This m 92.98
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 92.95
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 92.91
COG1160444 Predicted GTPases [General function prediction onl 92.85
cd00154159 Rab Rab family. Rab GTPases form the largest famil 92.79
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 92.77
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 92.69
PTZ00141 446 elongation factor 1- alpha; Provisional 92.65
PLN00043 447 elongation factor 1-alpha; Provisional 92.62
PF1355562 AAA_29: P-loop containing region of AAA domain 92.56
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 92.53
COG4639168 Predicted kinase [General function prediction only 92.5
KOG1144 1064 consensus Translation initiation factor 5B (eIF-5B 92.44
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 92.28
KOG1490 620 consensus GTP-binding protein CRFG/NOG1 (ODN super 92.28
PTZ00133182 ADP-ribosylation factor; Provisional 92.21
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 92.2
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 92.18
COG1084346 Predicted GTPase [General function prediction only 92.08
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 92.06
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 92.04
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 91.9
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 91.87
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 91.72
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 91.7
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 91.67
PRK06217183 hypothetical protein; Validated 91.56
cd04123162 Rab21 Rab21 subfamily. The localization and functi 91.54
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 91.44
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 91.44
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 91.28
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 91.25
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 91.16
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 91.14
PLN00223181 ADP-ribosylation factor; Provisional 91.12
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 91.11
KOG0073185 consensus GTP-binding ADP-ribosylation factor-like 91.1
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 91.09
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 91.08
smart00178184 SAR Sar1p-like members of the Ras-family of small 91.02
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 90.98
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 90.98
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 90.97
cd00876160 Ras Ras family. The Ras family of the Ras superfam 90.97
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 90.92
COG1100219 GTPase SAR1 and related small G proteins [General 90.86
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 90.84
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 90.8
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 90.77
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 90.76
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 90.75
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 90.72
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 90.6
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 90.56
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 90.54
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 90.49
PF00005137 ABC_tran: ABC transporter This structure is on hol 90.45
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 90.4
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 90.39
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 90.31
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 90.29
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 90.19
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 90.17
PLN03108210 Rab family protein; Provisional 90.11
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 90.1
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 90.05
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 89.9
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 89.9
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 89.88
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 89.86
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 89.84
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 89.84
PRK12288 347 GTPase RsgA; Reviewed 89.83
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 89.79
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 89.77
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 89.75
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 89.74
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 89.71
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 89.71
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 89.71
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 89.69
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 89.68
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 89.67
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 89.62
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 89.57
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 89.5
KOG0096216 consensus GTPase Ran/TC4/GSP1 (nuclear protein tra 89.5
smart00382148 AAA ATPases associated with a variety of cellular 89.49
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 89.48
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 89.47
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 89.46
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 89.44
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 89.4
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 89.31
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 89.3
TIGR03596 276 GTPase_YlqF ribosome biogenesis GTP-binding protei 89.26
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 89.23
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 89.23
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 89.18
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 88.95
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 88.91
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 88.89
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 88.87
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 88.82
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 88.81
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 88.75
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 88.74
PRK03839180 putative kinase; Provisional 88.73
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 88.71
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 88.63
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 88.63
PTZ00088229 adenylate kinase 1; Provisional 88.63
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 88.61
PRK13949169 shikimate kinase; Provisional 88.6
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 88.41
KOG3886295 consensus GTP-binding protein [Signal transduction 88.35
PRK14532188 adenylate kinase; Provisional 88.34
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 88.25
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 88.18
PTZ00369189 Ras-like protein; Provisional 88.17
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 88.17
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 88.06
PRK00454196 engB GTP-binding protein YsxC; Reviewed 88.06
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 87.84
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 87.81
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 87.78
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 87.76
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 87.73
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 87.72
cd01878204 HflX HflX subfamily. A distinct conserved domain w 87.68
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 87.68
COG0486454 ThdF Predicted GTPase [General function prediction 87.67
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 87.66
PRK14530215 adenylate kinase; Provisional 87.65
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 87.59
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 87.58
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 87.56
PRK05978148 hypothetical protein; Provisional 87.43
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 87.42
PF00004132 AAA: ATPase family associated with various cellula 87.4
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 87.4
PLN03071219 GTP-binding nuclear protein Ran; Provisional 87.39
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 87.38
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 87.36
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 87.24
PRK08233182 hypothetical protein; Provisional 87.12
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 87.08
PRK02496184 adk adenylate kinase; Provisional 86.98
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 86.95
PRK09825176 idnK D-gluconate kinase; Provisional 86.87
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 86.87
PRK00300205 gmk guanylate kinase; Provisional 86.85
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 86.83
PRK09563 287 rbgA GTPase YlqF; Reviewed 86.82
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 86.78
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 86.76
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 86.72
COG4619223 ABC-type uncharacterized transport system, ATPase 86.69
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 86.63
COG2262411 HflX GTPases [General function prediction only] 86.61
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 86.59
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 86.58
PRK13695174 putative NTPase; Provisional 86.51
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 86.48
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 86.48
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 86.37
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 86.26
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 86.26
PF05729166 NACHT: NACHT domain 86.26
PRK14531183 adenylate kinase; Provisional 86.25
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 86.21
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 86.14
COG1126240 GlnQ ABC-type polar amino acid transport system, A 86.14
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 86.13
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 86.12
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 85.96
PRK09435332 membrane ATPase/protein kinase; Provisional 85.96
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 85.9
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 85.84
TIGR00235207 udk uridine kinase. Model contains a number of lon 85.83
PF13173128 AAA_14: AAA domain 85.65
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 85.64
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 85.52
PLN03118211 Rab family protein; Provisional 85.5
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 85.49
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 85.49
PRK08099399 bifunctional DNA-binding transcriptional repressor 85.47
TIGR03238504 dnd_assoc_3 dnd system-associated protein 3. cereu 85.4
cd03269210 ABC_putative_ATPase This subfamily is involved in 85.34
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 85.33
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 85.27
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 85.25
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 85.23
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 85.2
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 85.19
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 85.19
PF13304303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 85.18
cd03234226 ABCG_White The White subfamily represents ABC tran 85.17
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 85.16
PLN03110216 Rab GTPase; Provisional 85.13
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 85.11
PRK00279215 adk adenylate kinase; Reviewed 85.08
PLN02200234 adenylate kinase family protein 85.08
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 85.06
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 85.04
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 85.03
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 84.99
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 84.98
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 84.97
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 84.97
PRK05480209 uridine/cytidine kinase; Provisional 84.87
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 84.87
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 84.81
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 84.79
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 84.77
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 84.76
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 84.74
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 84.74
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 84.62
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 84.54
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 84.53
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 84.5
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 84.44
PRK06762166 hypothetical protein; Provisional 84.44
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 84.4
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 84.38
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 84.33
COG5256 428 TEF1 Translation elongation factor EF-1alpha (GTPa 84.3
PRK14528186 adenylate kinase; Provisional 84.29
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 84.29
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 84.28
>KOG0082 consensus G-protein alpha subunit (small G protein superfamily) [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=4.9e-88  Score=732.29  Aligned_cols=340  Identities=34%  Similarity=0.558  Sum_probs=299.9

Q ss_pred             CcccccccccCchhhhhh-----cceeeEEEeeccCCChhhHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q 042025          408 GHRDEASNYTTVPNYLEQ-----KKVQKLLLLGLQGAGTSTIFKQAKFLYGNKFTAEELQDIKLMIQSNMYRYLSILLDG  482 (844)
Q Consensus       408 ~~~e~~~~S~~Id~~Le~-----k~~iKLLLLGsgeSGKSTI~KQmKiLy~~gFS~eEr~~~r~iIqsNi~~sm~~LLea  482 (844)
                      +.+++...++.|+++|++     ++.+||||||+||||||||+|||||||.+|||++|+..+|.+||+|++++|..|++|
T Consensus         8 e~~~~~~~~~~I~~~l~~~~~~~~~~iKlLLLGageSGKSTI~KQmkilh~~gfs~ee~~~~r~~I~~N~~~~~~~ll~a   87 (354)
T KOG0082|consen    8 EEKEQVKRSKEIDKQLKKEKKKEKKIIKLLLLGAGESGKSTIVKQMKILHGDGFSEEELLEYRPVIYSNIIQSLKALLRA   87 (354)
T ss_pred             hhhhcchhhhhhhHHHHHHHHhhhhheeeeeecCCCCchHHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            455555678899988887     568999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhhHHHHHhhccCCCCCcccccCCCCCCCCccccccccCchhhhhhHHHHhh-hhcCCCCccCcccchhHHHHHHHhc
Q 042025          483 RERFEEEATARMNAQGSHDQISEAGGEADPSETTQCIYSINPRLKHFSDWLLDI-IATGDLDAFFPAATREYAPLVDEVW  561 (844)
Q Consensus       483 ~e~feee~l~~~~~~~~~~e~s~~~~~~~~~~~~~~Iysi~p~~k~fsd~ll~i-~~~g~ld~~~P~~t~E~a~~I~~LW  561 (844)
                      |+.+++         ++.++.                      ...-+..+... ...+++    +++++|++++|.+||
T Consensus        88 ~~~~~i---------~~~~~~----------------------~~~d~~~~~~~~~~~~~~----~~~~~e~~~~i~~lW  132 (354)
T KOG0082|consen   88 METLGI---------NLDDPE----------------------RENDAQKLTLLADAAEEL----GVFSPELAEAIKELW  132 (354)
T ss_pred             HHHhcC---------CCCChh----------------------hhhHHHHHHHhhhccccc----ccCCHHHHHHHHHHH
Confidence            986543         233211                      01111111111 112221    456789999999999


Q ss_pred             CCHHHHHHHhccccccccccchhhcccccccccCCCCCCCccceeEeeccccCCceEEEEEEecCCCCCCccccCcccCC
Q 042025          562 KDPAIQETYKRKDELHFLPDVAEYFLSRAVEVSSNEYEPSDRDILYAEGVTQGNGLAFIEFSLDDRSPMSETYTDNLEVQ  641 (844)
Q Consensus       562 ~DpaIQ~ty~Rr~Ef~~L~DsA~YFLd~l~RI~~~dY~PTd~DILraR~~TtG~GI~e~eF~~~~~~~~~~~~~~~~~~~  641 (844)
                      +||+||+||+||+||+ |+|+|.|||+|++||++|+|+||++||||+|++|+|  |+++.|++.+               
T Consensus       133 ~d~~Iq~~~~r~~e~~-l~Dsa~Yfl~~l~rI~~~~Y~PT~~DIL~~R~~T~G--I~e~~F~~k~---------------  194 (354)
T KOG0082|consen  133 KDPGIQACYERRREFQ-LNDSAKYFLENLDRISSPDYVPTEQDILRSRVPTTG--IVEVEFTIKG---------------  194 (354)
T ss_pred             cCHHHHHHHHcCCcCC-CCccHHHHHHhHHHhcCCCCCCCHHHHHhhccCcCC--eeEEEEEeCC---------------
Confidence            9999999999999999 999999999999999999999999999999999998  9999999985               


Q ss_pred             CCCCceEEEEEeCCCCCCCcccceeccCCccEEEEEeecccccccccCCCCCCCcccccchHHHHHHHHHHHHcCCCCCC
Q 042025          642 PQPLTKYQLIRVNAKGMNEGCKWVEMFEDVRVVVFCVALSDYDQMWICPESSGSGTLLQNKMIQSKELFEMMIRHPCFKD  721 (844)
Q Consensus       642 ~~~~~~~~liDVGGQ~rseR~KW~~~FedV~aIIFVVdLSDYDq~l~~~ED~g~~~~~~NRL~ESl~LFesI~n~p~f~~  721 (844)
                          .+|+++||||| |++|+||+|||++|+||||||+||+|||++  .||.     .+|||+||++||++|||++||.+
T Consensus       195 ----~~f~~~DvGGQ-RseRrKWihcFe~v~aviF~vslSeYdq~l--~ED~-----~~NRM~eS~~LF~sI~n~~~F~~  262 (354)
T KOG0082|consen  195 ----LKFRMFDVGGQ-RSERKKWIHCFEDVTAVIFCVSLSEYDQVL--EEDE-----TTNRMHESLKLFESICNNKWFAN  262 (354)
T ss_pred             ----CceEEEeCCCc-HHHhhhHHHhhcCCCEEEEEEehhhhhhhc--cccc-----chhHHHHHHHHHHHHhcCccccc
Confidence                58999999999 999999999999999999999999999999  6775     59999999999999999999999


Q ss_pred             CcEEEEecccchhhhhhhccccccccccCCCCCCcCCCCChhhHHHHHHHHHHHHHhhhccCCCCcEEEEEEeecCCCCH
Q 042025          722 TPFVLILNKYDLFEEKVNRVHLSTCEWFNDFSPVRTHHNNQSLAHQAYYYVAMKFKDLYASLTGRKLFVWQARARDRVTV  801 (844)
Q Consensus       722 tpiILfLNK~DLfeeKI~~spLs~c~~FPDF~g~~~~~n~~sl~e~A~~YI~~KFl~L~~s~~~Rklyvh~T~AtDte~I  801 (844)
                      ++|||||||+|||+|||+++|++.  |||||.|.    ++   .++|.+||.++|.+++++. .|++|+|+||||||++|
T Consensus       263 tsiiLFLNK~DLFeEKi~~~~~~~--~Fpdy~G~----~~---~~~a~~yI~~kF~~l~~~~-~k~iy~h~T~AtDT~nv  332 (354)
T KOG0082|consen  263 TSIILFLNKKDLFEEKIKKVPLTD--CFPDYKGV----NT---YEEAAKYIRKKFEELNKNK-DKKIYVHFTCATDTQNV  332 (354)
T ss_pred             CcEEEEeecHHHHHHHhccCchhh--hCcCCCCC----CC---hHHHHHHHHHHHHHHhccc-CCcceEEEEeeccHHHH
Confidence            999999999999999998899875  59999985    22   6789999999999999753 49999999999999999


Q ss_pred             HHHHHHHHHHHhhhhhcccCC
Q 042025          802 DEAFKYIREVLKWDDEKEDNY  822 (844)
Q Consensus       802 ~evF~~V~e~Ik~~~~k~~~~  822 (844)
                      +.+|++|.|+|+|.++|..|+
T Consensus       333 ~~vf~av~d~Ii~~nlk~~gl  353 (354)
T KOG0082|consen  333 QFVFDAVTDTIIQNNLKDAGL  353 (354)
T ss_pred             HHHHHHHHHHHHHHHHHHhcC
Confidence            999999999999999999875

>KOG0085 consensus G protein subunit Galphaq/Galphay, small G protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] Back     alignment and domain information
>KOG0099 consensus G protein subunit Galphas, small G protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>KOG0072 consensus GTP-binding ADP-ribosylation factor-like protein ARL1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only] Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>KOG0395 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>KOG1673 consensus Ras GTPases [General function prediction only] Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0394 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only] Back     alignment and domain information
>KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only] Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>KOG0083 consensus GTPase Rab26/Rab37, small G protein superfamily [General function prediction only] Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>COG4639 Predicted kinase [General function prediction only] Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>KOG0096 consensus GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>KOG3886 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>PRK05978 hypothetical protein; Provisional Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query844
2xtz_A354 Crystal Structure Of The G Alpha Protein Atgpa1 Fro 1e-45
1shz_A340 Crystal Structure Of The P115rhogef Rgrgs Domain In 4e-22
3umr_A354 Crystal Structure Of The G202d Mutant Of Human G-Al 7e-21
4g5o_A330 Structure Of Lgn Gl4GALPHAI3(Q147L) COMPLEX Length 5e-20
1gg2_A353 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 1e-19
4g5r_A330 Structure Of Lgn Gl4GALPHAI3 COMPLEX Length = 330 1e-19
2ihb_A323 Crystal Structure Of The Heterodimeric Complex Of H 1e-19
3onw_A328 Structure Of A G-Alpha-I1 Mutant With Enhanced Affi 1e-19
2zjy_A356 Structure Of The K349p Mutant Of Gi Alpha 1 Subunit 2e-19
2ode_A350 Crystal Structure Of The Heterodimeric Complex Of H 2e-19
3ffb_A360 Crystal Structure Of A Fast Activating G Protein Mu 2e-19
1gp2_A353 G Protein Heterotrimer Gi_alpha_1 Beta_1 Gamma_2 Wi 3e-19
3qi2_A328 A Galpha P-Loop Mutation Prevents Transition To The 3e-19
3ums_A354 Crystal Structure Of The G202a Mutant Of Human G-Al 3e-19
2xns_A327 Crystal Structure Of Human G Alpha I1 Bound To A De 4e-19
1as0_A353 Gtp-Gamma-S Bound G42v Gia1 Length = 353 4e-19
1y3a_A329 Structure Of G-Alpha-I1 Bound To A Gdp-Selective Pe 4e-19
4g5q_A330 Structure Of Lgn Gl4GALPHAI1 COMPLEX Length = 330 4e-19
1kjy_A325 Crystal Structure Of Human G[alpha]i1 Bound To The 4e-19
2gtp_A323 Crystal Structure Of The Heterodimeric Complex Of H 5e-19
2ik8_A324 Crystal Structure Of The Heterodimeric Complex Of H 5e-19
3qe0_A325 A Galpha-I1 P-Loop Mutation Prevents Transition To 5e-19
1svk_A353 Structure Of The K180p Mutant Of Gi Alpha Subunit B 5e-19
2g83_A313 Structure Of Activated G-alpha-i1 Bound To A Nucleo 6e-19
3ah8_A355 Structure Of Heterotrimeric G Protein Galpha-Q Beta 6e-19
2bcj_Q353 Crystal Structure Of G Protein-coupled Receptor Kin 6e-19
3c7k_A333 Molecular Architecture Of Galphao And The Structura 8e-19
1gil_A353 Structure Of Active Conformations Of Gia1 And The M 8e-19
3ohm_A327 Crystal Structure Of Activated G Alpha Q Bound To I 8e-19
4gnk_A353 Crystal Structure Of Galphaq In Complex With Full-l 9e-19
3d7m_A354 Crystal Structure Of The G Protein Fast-Exchange Do 1e-18
1bh2_A315 A326s Mutant Of An Inhibitory Alpha Subunit Length 1e-18
1fqj_A325 Crystal Structure Of The Heterotrimeric Complex Of 3e-18
3v00_C356 Studies Of A Constitutively Active G-Alpha Subunit 3e-18
4ekc_A347 Structure Of Human Regulator Of G Protein Signaling 5e-18
1got_A350 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 2e-17
1tnd_A324 The 2.2 Angstroms Crystal Structure Of Transducin-A 5e-17
1zcb_A362 Crystal Structure Of G Alpha 13 In Complex With Gdp 7e-16
3cx7_A338 Crystal Structure Of Pdzrhogef Rgrgs Domain In A Co 1e-15
3cx6_A338 Crystal Structure Of Pdzrhogef Rgrgs Domain In A Co 1e-15
1zca_A359 Crystal Structure Of G Alpha 12 In Complex With Gdp 9e-15
1azs_C402 Complex Of Gs-Alpha With The Catalytic Domains Of M 2e-13
1cs4_C394 Complex Of Gs-Alpha With The Catalytic Domains Of M 3e-13
1cjk_C402 Complex Of Gs-Alpha With The Catalytic Domains Of M 1e-12
1cul_C380 Complex Of Gs-Alpha With The Catalytic Domains Of M 1e-12
3sn6_A380 Crystal Structure Of The Beta2 Adrenergic Receptor- 1e-12
4fid_A340 Crystal Structure Of A Heterotrimeric G-Protein Sub 2e-11
>pdb|2XTZ|A Chain A, Crystal Structure Of The G Alpha Protein Atgpa1 From Arabidopsis Thaliana Length = 354 Back     alignment and structure 
Iteration: 1

 Score =  181 bits (459), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 125/377 (33%), Positives = 190/377 (50%), Gaps = 60/377 (15%)
Query: 442 STIFKQAKFLYGNKFTAEELQDIKLMIQSNMYRYLSILLDGRERFEEEATARMNAQGSHD 501
           STIFKQ K L+   F   EL+    +I +N+Y+ + +L DG + F +  T       S +
Sbjct: 23  STIFKQIKLLFQTGFDEGELKSYVPVIHANVYQTIKLLHDGTKEFAQNETDSAKYMLSSE 82
Query: 502 QISEAGGEADPSETTQCIYSINPRLKHFSDWLLDIIATGDLDAFFPAATREYAPLVDEVW 561
            I+                 I  +L             G LD  +P  T++ A  ++ +W
Sbjct: 83  SIA-----------------IGEKLSEIG---------GRLD--YPRLTKDIAEGIETLW 114
Query: 562 KDPAIQETYKRKDELHFLPDVAEYFLSRAVEVSSNEYEPSDRDILYAEGVTQGNGLAFIE 621
           KDPAIQET  R +EL  +PD  +Y +     +S   Y P+  D+LYA    +  G+  I+
Sbjct: 115 KDPAIQETXARGNELQ-VPDXTKYLMENLKRLSDINYIPTKEDVLYAR--VRTTGVVEIQ 171
Query: 622 FSLDDRSPMSETYTDNLEVQPQPLTKYQLIRVNAKGMNEGCKWVEMFEDVRVVVFCVALS 681
           FS     P+ E      EV       Y+L  V  +  NE  KW+ +FE V  V+FC A+S
Sbjct: 172 FS-----PVGENKKSG-EV-------YRLFDVGGQ-RNERRKWIHLFEGVTAVIFCAAIS 217
Query: 682 DYDQMWICPESSGSGTLLQNKMIQSKELFEMMIRHPCFKDTPFVLILNKYDLFEEKVNRV 741
           +YDQ     E        +N+M+++KELF+ +++ PCF+ T F+L LNK+D+FE+KV  V
Sbjct: 218 EYDQTLFEDEQ-------KNRMMETKELFDWVLKQPCFEKTSFMLFLNKFDIFEKKVLDV 270
Query: 742 HLSTCEWFNDFSPVRTHHNNQSLAHQAYYYVAMKFKDLYASLTG-----RKLFVWQARAR 796
            L+ CEWF D+ PV +    Q + H AY +V  KF++LY   T      R   +++  A 
Sbjct: 271 PLNVCEWFRDYQPVSS--GKQEIEH-AYEFVKKKFEELYYQNTAPDRVDRVFKIYRTTAL 327
Query: 797 DRVTVDEAFKYIREVLK 813
           D+  V + FK + E L+
Sbjct: 328 DQKLVKKTFKLVDETLR 344
>pdb|1SHZ|A Chain A, Crystal Structure Of The P115rhogef Rgrgs Domain In A Complex With Galpha(13):galpha(i1) Chimera Length = 340 Back     alignment and structure
>pdb|3UMR|A Chain A, Crystal Structure Of The G202d Mutant Of Human G-Alpha-I1 Length = 354 Back     alignment and structure
>pdb|4G5O|A Chain A, Structure Of Lgn Gl4GALPHAI3(Q147L) COMPLEX Length = 330 Back     alignment and structure
>pdb|1GG2|A Chain A, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 353 Back     alignment and structure
>pdb|4G5R|A Chain A, Structure Of Lgn Gl4GALPHAI3 COMPLEX Length = 330 Back     alignment and structure
>pdb|3ONW|A Chain A, Structure Of A G-Alpha-I1 Mutant With Enhanced Affinity For The Rgs14 Goloco Motif. Length = 328 Back     alignment and structure
>pdb|2ZJY|A Chain A, Structure Of The K349p Mutant Of Gi Alpha 1 Subunit Bound To Alf4 And Gdp Length = 356 Back     alignment and structure
>pdb|2ODE|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs8 And Activated Gi Alpha 3 Length = 350 Back     alignment and structure
>pdb|1GP2|A Chain A, G Protein Heterotrimer Gi_alpha_1 Beta_1 Gamma_2 With Gdp Bound Length = 353 Back     alignment and structure
>pdb|3QI2|A Chain A, A Galpha P-Loop Mutation Prevents Transition To The Activated State: G42r Bound To Rgs14 Goloco Length = 328 Back     alignment and structure
>pdb|3UMS|A Chain A, Crystal Structure Of The G202a Mutant Of Human G-Alpha-I1 Length = 354 Back     alignment and structure
>pdb|2XNS|A Chain A, Crystal Structure Of Human G Alpha I1 Bound To A Designed Helical Peptide Derived From The Goloco Motif Of Rgs14 Length = 327 Back     alignment and structure
>pdb|1AS0|A Chain A, Gtp-Gamma-S Bound G42v Gia1 Length = 353 Back     alignment and structure
>pdb|1Y3A|A Chain A, Structure Of G-Alpha-I1 Bound To A Gdp-Selective Peptide Provides Insight Into Guanine Nucleotide Exchange Length = 329 Back     alignment and structure
>pdb|4G5Q|A Chain A, Structure Of Lgn Gl4GALPHAI1 COMPLEX Length = 330 Back     alignment and structure
>pdb|1KJY|A Chain A, Crystal Structure Of Human G[alpha]i1 Bound To The Goloco Motif Of Rgs14 Length = 325 Back     alignment and structure
>pdb|2GTP|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs1 And Activated Gi Alpha 1 Length = 323 Back     alignment and structure
>pdb|2IK8|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs16 And Activated Gi Alpha 1 Length = 324 Back     alignment and structure
>pdb|3QE0|A Chain A, A Galpha-I1 P-Loop Mutation Prevents Transition To The Activated State Length = 325 Back     alignment and structure
>pdb|1SVK|A Chain A, Structure Of The K180p Mutant Of Gi Alpha Subunit Bound To Alf4 And Gdp Length = 353 Back     alignment and structure
>pdb|2G83|A Chain A, Structure Of Activated G-alpha-i1 Bound To A Nucleotide- State-selective Peptide: Minimal Determinants For Recognizing The Active Form Of A G Protein Alpha Subunit Length = 313 Back     alignment and structure
>pdb|3AH8|A Chain A, Structure Of Heterotrimeric G Protein Galpha-Q Beta Gamma In Complex With An Inhibitor Ym-254890 Length = 355 Back     alignment and structure
>pdb|2BCJ|Q Chain Q, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 353 Back     alignment and structure
>pdb|3C7K|A Chain A, Molecular Architecture Of Galphao And The Structural Basis For Rgs16-Mediated Deactivation Length = 333 Back     alignment and structure
>pdb|1GIL|A Chain A, Structure Of Active Conformations Of Gia1 And The Mechanism Of Gtp Hydrolysis Length = 353 Back     alignment and structure
>pdb|3OHM|A Chain A, Crystal Structure Of Activated G Alpha Q Bound To Its Effector Phospholipase C Beta 3 Length = 327 Back     alignment and structure
>pdb|4GNK|A Chain A, Crystal Structure Of Galphaq In Complex With Full-length Human Plcbeta3 Length = 353 Back     alignment and structure
>pdb|3D7M|A Chain A, Crystal Structure Of The G Protein Fast-Exchange Double Mutant I56cQ333C Length = 354 Back     alignment and structure
>pdb|1BH2|A Chain A, A326s Mutant Of An Inhibitory Alpha Subunit Length = 315 Back     alignment and structure
>pdb|1FQJ|A Chain A, Crystal Structure Of The Heterotrimeric Complex Of The Rgs Domain Of Rgs9, The Gamma Subunit Of Phosphodiesterase And The GtI1 CHIMERA ALPHA SUBUNIT [(RGS9)-(Pdegamma)- (GtI1ALPHA)-(Gdp)-(Alf4-)-(Mg2+)] Length = 325 Back     alignment and structure
>pdb|3V00|C Chain C, Studies Of A Constitutively Active G-Alpha Subunit Provide Insights Into The Mechanism Of G Protein Activation. Length = 356 Back     alignment and structure
>pdb|4EKC|A Chain A, Structure Of Human Regulator Of G Protein Signaling 2 (rgs2) In Complex With Murine Galpha-q(r183c) Length = 347 Back     alignment and structure
>pdb|1GOT|A Chain A, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 350 Back     alignment and structure
>pdb|1TND|A Chain A, The 2.2 Angstroms Crystal Structure Of Transducin-Alpha Complexed With Gtp Gamma S Length = 324 Back     alignment and structure
>pdb|1ZCB|A Chain A, Crystal Structure Of G Alpha 13 In Complex With Gdp Length = 362 Back     alignment and structure
>pdb|3CX7|A Chain A, Crystal Structure Of Pdzrhogef Rgrgs Domain In A Complex With Galpha-13 Bound To Gdp-Alf4 Length = 338 Back     alignment and structure
>pdb|3CX6|A Chain A, Crystal Structure Of Pdzrhogef Rgrgs Domain In A Complex With Galpha-13 Bound To Gdp Length = 338 Back     alignment and structure
>pdb|1ZCA|A Chain A, Crystal Structure Of G Alpha 12 In Complex With Gdp, Mg2+ And Alf4- Length = 359 Back     alignment and structure
>pdb|1AZS|C Chain C, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase Length = 402 Back     alignment and structure
>pdb|1CS4|C Chain C, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With 2'-Deoxy-Adenosine 3'- Monophosphate, Pyrophosphate And Mg Length = 394 Back     alignment and structure
>pdb|1CJK|C Chain C, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With Adenosine 5'-(Alpha Thio)-Triphosphate (Rp), Mg, And Mn Length = 402 Back     alignment and structure
>pdb|1CUL|C Chain C, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With 2',5'-Dideoxy-Adenosine 3'- Triphosphate And Mg Length = 380 Back     alignment and structure
>pdb|3SN6|A Chain A, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 380 Back     alignment and structure
>pdb|4FID|A Chain A, Crystal Structure Of A Heterotrimeric G-Protein Subunit From Entamoeba Histolytica, Ehg-Alpha-1 Length = 340 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query844
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 2e-79
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 7e-71
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 3e-69
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 2e-64
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 2e-62
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Length = 354 Back     alignment and structure
 Score =  259 bits (663), Expect = 2e-79
 Identities = 121/402 (30%), Positives = 189/402 (47%), Gaps = 60/402 (14%)

Query: 425 QKKVQKLLLLGLQGAGTSTIFKQAKFLYGNKFTAEELQDIKLMIQSNMYRYLSILLDGRE 484
              ++KLLLLG   +G STIFKQ K L+   F   EL+    +I +N+Y+ + +L DG +
Sbjct: 6   GIHIRKLLLLGAGESGKSTIFKQIKLLFQTGFDEGELKSYVPVIHANVYQTIKLLHDGTK 65

Query: 485 RFEEEATARMNAQGSHDQISEAGGEADPSETTQCIYSINPRLKHFSDWLLDIIATGDLDA 544
            F +  T       S + I+                              + ++      
Sbjct: 66  EFAQNETDSAKYMLSSESIAIG----------------------------EKLSEIGGRL 97

Query: 545 FFPAATREYAPLVDEVWKDPAIQETYKRKDELHFLPDVAEYFLSRAVEVSSNEYEPSDRD 604
            +P  T++ A  ++ +WKDPAIQET  R +EL   PD  +Y +     +S   Y P+  D
Sbjct: 98  DYPRLTKDIAEGIETLWKDPAIQETCARGNELQV-PDCTKYLMENLKRLSDINYIPTKED 156

Query: 605 ILYAEGVTQGNGLAFIEFSLDDRSPMSETYTDNLEVQPQPLTKYQLIRVNAKGMNEGCKW 664
           +LYA   T G               + E     +    +    Y+L  V  +  NE  KW
Sbjct: 157 VLYARVRTTG---------------VVEIQFSPVGENKKSGEVYRLFDVGGQ-RNERRKW 200

Query: 665 VEMFEDVRVVVFCVALSDYDQMWICPESSGSGTLLQNKMIQSKELFEMMIRHPCFKDTPF 724
           + +FE V  V+FC A+S+YDQ     E        +N+M+++KELF+ +++ PCF+ T F
Sbjct: 201 IHLFEGVTAVIFCAAISEYDQTLF--EDEQ-----KNRMMETKELFDWVLKQPCFEKTSF 253

Query: 725 VLILNKYDLFEEKVNRVHLSTCEWFNDFSPVRTHHNNQSLAHQAYYYVAMKFKDLYASLT 784
           +L LNK+D+FE+KV  V L+ CEWF D+ PV +          AY +V  KF++LY   T
Sbjct: 254 MLFLNKFDIFEKKVLDVPLNVCEWFRDYQPVSSGKQE---IEHAYEFVKKKFEELYYQNT 310

Query: 785 G-----RKLFVWQARARDRVTVDEAFKYIREVLKWDDEKEDN 821
                 R   +++  A D+  V + FK + E L+  +  E  
Sbjct: 311 APDRVDRVFKIYRTTALDQKLVKKTFKLVDETLRRRNLLEAG 352
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Length = 402 Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Length = 353 Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Length = 327 Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Length = 362 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query844
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 100.0
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 100.0
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 100.0
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 100.0
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 100.0
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 100.0
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 99.54
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 99.46
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.33
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.31
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.3
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.3
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.29
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.29
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.25
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.22
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.22
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.22
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.19
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.17
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.13
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.13
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.12
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.11
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.1
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.09
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.09
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.08
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.06
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.04
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.02
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.02
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.02
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.02
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 98.99
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 98.99
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 98.91
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 98.89
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 98.89
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 98.87
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 98.86
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 98.86
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 98.86
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 98.85
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 98.84
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 98.84
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 98.84
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 98.83
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 98.83
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 98.82
3o47_A329 ADP-ribosylation factor GTPase-activating protein 98.81
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 98.81
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 98.81
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 98.8
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 98.79
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 98.79
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 98.79
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 98.79
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 98.79
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 98.78
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 98.78
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 98.77
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 98.76
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 98.76
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 98.76
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 98.76
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 98.76
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 98.75
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 98.74
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 98.73
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 98.73
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 98.73
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 98.71
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 98.7
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 98.69
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 98.69
3llu_A196 RAS-related GTP-binding protein C; structural geno 98.69
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 98.69
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 98.68
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 98.68
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 98.67
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 98.67
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 98.67
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 98.67
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 98.66
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 98.66
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 98.66
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 98.65
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 98.65
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 98.65
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 98.63
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 98.63
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 98.62
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 98.62
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 98.61
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 98.6
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 98.59
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 98.59
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 98.59
2fh5_B214 SR-beta, signal recognition particle receptor beta 98.58
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 98.58
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 98.57
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 98.57
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 98.56
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 98.48
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 98.45
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 98.32
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 98.3
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 98.3
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 97.59
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 98.2
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 98.19
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 98.19
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 98.17
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 98.16
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 98.14
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 98.12
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 98.09
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 98.06
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 97.99
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 97.98
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 97.93
2wji_A165 Ferrous iron transport protein B homolog; membrane 97.89
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 97.88
2ged_A193 SR-beta, signal recognition particle receptor beta 97.83
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 97.83
1nrj_B218 SR-beta, signal recognition particle receptor beta 97.72
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 97.72
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 97.71
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 97.7
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 97.68
3iby_A256 Ferrous iron transport protein B; G protein, G dom 97.59
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 97.58
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 97.56
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 97.52
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 97.5
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 97.47
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 97.47
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 97.43
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 97.43
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 97.42
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 97.4
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 97.4
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 97.4
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 97.4
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 97.38
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 97.37
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 97.36
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 97.3
1wb1_A 482 Translation elongation factor SELB; selenocysteine 97.29
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 97.27
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 97.25
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 97.25
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 97.22
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 97.18
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 97.11
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 97.1
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 97.0
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 96.99
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 96.97
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 96.93
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 96.92
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 96.83
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 96.8
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 96.78
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 96.77
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 96.76
3lxx_A239 GTPase IMAP family member 4; structural genomics c 96.76
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 96.75
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 96.75
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 96.63
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 96.61
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 96.61
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 96.6
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 96.51
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 96.49
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 96.49
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 96.48
3lxw_A247 GTPase IMAP family member 1; immunity, structural 96.48
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 96.42
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 96.37
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 96.28
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 96.11
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 96.1
2yv5_A 302 YJEQ protein; hydrolase, GTPase, permutation, stru 95.87
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 95.69
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 95.44
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 95.32
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 95.01
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 94.76
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 94.64
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 94.45
2www_A349 Methylmalonic aciduria type A protein, mitochondri 94.15
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 94.07
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 94.0
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 93.88
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 93.83
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 93.35
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 93.31
1wxq_A 397 GTP-binding protein; structural genomics, riken st 93.29
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 93.17
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 93.17
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 93.01
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 92.97
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 92.95
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 92.93
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 92.91
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 92.86
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 92.81
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 92.79
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 92.76
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 92.75
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 92.74
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 92.7
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 92.69
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 92.68
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 92.66
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 92.58
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 92.55
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 92.54
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 92.47
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 92.47
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 92.44
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 92.43
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 92.4
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 92.34
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 92.31
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 92.31
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 92.28
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 92.27
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 92.26
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 92.22
2wji_A165 Ferrous iron transport protein B homolog; membrane 92.18
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 92.17
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 92.16
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 92.12
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 92.06
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 91.99
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 91.97
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 91.95
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 91.94
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 91.92
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 91.91
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 91.9
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 91.88
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 91.88
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 91.86
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 91.79
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 91.72
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 91.71
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 91.7
3t1o_A198 Gliding protein MGLA; G domain containing protein, 91.68
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 91.66
2fh5_B214 SR-beta, signal recognition particle receptor beta 91.65
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 91.62
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 91.58
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 91.53
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 91.52
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 91.5
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 91.46
2ged_A193 SR-beta, signal recognition particle receptor beta 91.44
2hf9_A226 Probable hydrogenase nickel incorporation protein 91.43
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 91.41
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 91.37
3llu_A196 RAS-related GTP-binding protein C; structural geno 91.36
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 91.32
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 91.32
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 91.32
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 91.31
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 91.29
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 91.28
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 91.28
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 91.26
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 91.25
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 91.23
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 91.14
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 91.1
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 91.04
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 90.96
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 90.93
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 90.83
1nrj_B218 SR-beta, signal recognition particle receptor beta 90.81
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 90.81
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 90.8
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 90.8
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 90.76
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 90.76
4a74_A231 DNA repair and recombination protein RADA; hydrola 90.75
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 90.73
1kag_A173 SKI, shikimate kinase I; transferase, structural g 90.57
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 90.44
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 90.43
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 90.43
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 90.41
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 90.39
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 90.36
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 90.33
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 90.26
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 89.73
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 90.18
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 90.12
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 90.11
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 90.1
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 90.07
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 90.01
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 90.0
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 89.99
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 89.89
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 89.82
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 89.79
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 89.65
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 89.58
3lxx_A239 GTPase IMAP family member 4; structural genomics c 89.51
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 89.4
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 89.34
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 89.29
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 89.28
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 89.25
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 89.19
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 89.14
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 89.11
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 89.07
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 89.02
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 88.94
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 88.91
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 88.89
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 88.88
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 88.81
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 88.64
3cnl_A262 YLQF, putative uncharacterized protein; circular p 88.63
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 88.62
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 88.61
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 88.6
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 88.48
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 88.45
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 88.44
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 88.43
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 88.43
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 88.42
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 88.41
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 88.4
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 88.39
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 88.34
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 88.33
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 88.18
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 88.18
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 88.11
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 88.07
1via_A175 Shikimate kinase; structural genomics, transferase 88.06
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 88.04
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 87.96
3vaa_A199 Shikimate kinase, SK; structural genomics, center 87.93
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 87.8
3kta_A182 Chromosome segregation protein SMC; structural mai 87.75
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 87.57
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 87.55
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 87.52
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 87.44
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 87.43
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 87.4
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 87.34
1sgw_A214 Putative ABC transporter; structural genomics, P p 87.33
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 87.33
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 87.32
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 87.32
1ji0_A240 ABC transporter; ATP binding protein, structural g 87.29
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 87.24
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 87.21
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 87.15
1g6h_A257 High-affinity branched-chain amino acid transport 87.13
2eyu_A261 Twitching motility protein PILT; pilus retraction 87.11
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 87.1
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 87.08
1b0u_A262 Histidine permease; ABC transporter, transport pro 86.93
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 86.93
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 86.88
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 86.82
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 86.81
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 86.79
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 86.69
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 86.66
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 86.66
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 86.65
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 86.6
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 86.53
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 86.52
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 86.51
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 86.44
3lxw_A247 GTPase IMAP family member 1; immunity, structural 86.4
2ghi_A260 Transport protein; multidrug resistance protein, M 86.38
2cvh_A220 DNA repair and recombination protein RADB; filamen 86.29
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 86.28
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 86.24
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 86.19
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 86.18
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 86.12
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 86.0
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 85.98
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 85.98
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 85.97
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 85.93
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 85.92
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 85.77
3tlx_A243 Adenylate kinase 2; structural genomics, structura 85.74
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 85.58
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 85.36
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 85.29
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 85.26
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 85.22
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 85.2
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 85.2
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 85.12
2vli_A183 Antibiotic resistance protein; transferase, tunica 85.05
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 85.03
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 85.01
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 84.97
2hf9_A226 Probable hydrogenase nickel incorporation protein 84.88
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 84.82
3o47_A329 ADP-ribosylation factor GTPase-activating protein 84.8
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 84.76
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 84.73
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 84.68
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 84.65
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 84.57
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 84.54
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 84.53
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 84.46
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 84.46
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 84.42
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 84.37
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 84.35
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 84.25
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 84.24
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 84.2
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 84.08
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 83.93
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 83.91
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 83.85
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 83.7
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 83.69
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 83.65
2chg_A226 Replication factor C small subunit; DNA-binding pr 83.51
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 83.48
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 83.46
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 83.28
3iby_A256 Ferrous iron transport protein B; G protein, G dom 83.26
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 83.25
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 83.23
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 83.19
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 83.01
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 82.97
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 82.92
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 82.89
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 82.8
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 82.74
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 82.67
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 82.67
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 82.45
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 82.41
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 82.38
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 82.16
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 82.11
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 82.08
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 82.05
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 82.05
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 82.01
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 81.94
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 81.82
3bos_A242 Putative DNA replication factor; P-loop containing 81.68
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 81.68
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 81.62
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 81.52
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 81.41
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 81.33
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 81.26
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 81.24
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 81.21
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 81.15
2ewv_A372 Twitching motility protein PILT; pilus retraction 81.07
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 81.05
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 80.98
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 80.96
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 80.95
3dpu_A535 RAB family protein; roccor, G-domain, COR, GTP-bin 80.74
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 80.67
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 80.55
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 80.52
2kjq_A149 DNAA-related protein; solution structure, NESG, st 80.49
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 80.47
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 80.46
1p9r_A418 General secretion pathway protein E; bacterial typ 80.4
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 80.25
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 80.22
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 80.07
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
Probab=100.00  E-value=5.5e-73  Score=613.43  Aligned_cols=323  Identities=27%  Similarity=0.482  Sum_probs=287.6

Q ss_pred             hcceeeEEEeeccCCChhhHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHhhccCCCCCccc
Q 042025          425 QKKVQKLLLLGLQGAGTSTIFKQAKFLYGNKFTAEELQDIKLMIQSNMYRYLSILLDGRERFEEEATARMNAQGSHDQIS  504 (844)
Q Consensus       425 ~k~~iKLLLLGsgeSGKSTI~KQmKiLy~~gFS~eEr~~~r~iIqsNi~~sm~~LLea~e~feee~l~~~~~~~~~~e~s  504 (844)
                      .++++||||||+||||||||+|||||||++||+++|+..||.+|++|++++|+.||++|+.|++         .++    
T Consensus         4 ~~~~~klLlLG~geSGKSTi~KQmkiih~~gfs~~e~~~~~~~i~~N~~~~~~~li~a~~~l~i---------~~~----   70 (327)
T 3ohm_A            4 ARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKI---------PYK----   70 (327)
T ss_dssp             -CCEEEEEEECSTTSSHHHHHHHHHHHHSCCCCHHHHHTTHHHHHHHHHHHHHHHHHHHHHTTC---------CCS----
T ss_pred             hcccceEEEEcCCCccHHHHHHHHHHHHcCCCCHHHHHHHHHHHHHhHHHHHHHHHHHHHhcCC---------CCC----
Confidence            4689999999999999999999999999999999999999999999999999999999998752         222    


Q ss_pred             ccCCCCCCCCccccccccCchhhhhhHHHHhhhhcCCCCccCcccchhHHHHHHHhcCCHHHHHHHhccccccccccchh
Q 042025          505 EAGGEADPSETTQCIYSINPRLKHFSDWLLDIIATGDLDAFFPAATREYAPLVDEVWKDPAIQETYKRKDELHFLPDVAE  584 (844)
Q Consensus       505 ~~~~~~~~~~~~~~Iysi~p~~k~fsd~ll~i~~~g~ld~~~P~~t~E~a~~I~~LW~DpaIQ~ty~Rr~Ef~~L~DsA~  584 (844)
                                        +|.++.++++++++.....     ..++++++++|.+||+||+||+||+||+||+ |+|+|.
T Consensus        71 ------------------~~~~~~~~~~~~~~~~~~~-----~~~~~e~~~~i~~lW~d~~iq~~~~r~~e~~-l~d~~~  126 (327)
T 3ohm_A           71 ------------------YEHNKAHAQLVREVDVEKV-----SAFENPYVDAIKSLWNDPGIQECYDRRREYQ-LSDSTK  126 (327)
T ss_dssp             ------------------STHHHHHHHHHHTCCGGGC-----CCCCTTHHHHHHHHHTCHHHHHHHHGGGGSC-CCTTHH
T ss_pred             ------------------CchhHHHHHHHhccccccc-----ccccHHHHHHHHHHHcCHHHHHHHHccccce-ecccHH
Confidence                              3556778888876533221     1246799999999999999999999999999 999999


Q ss_pred             hcccccccccCCCCCCCccceeEeeccccCCceEEEEEEecCCCCCCccccCcccCCCCCCceEEEEEeCCCCCCCcccc
Q 042025          585 YFLSRAVEVSSNEYEPSDRDILYAEGVTQGNGLAFIEFSLDDRSPMSETYTDNLEVQPQPLTKYQLIRVNAKGMNEGCKW  664 (844)
Q Consensus       585 YFLd~l~RI~~~dY~PTd~DILraR~~TtG~GI~e~eF~~~~~~~~~~~~~~~~~~~~~~~~~~~liDVGGQ~rseR~KW  664 (844)
                      |||++++||+.++|.||++|||++|.+|+|  +.+..|.++.                   +++++||+||| +++|++|
T Consensus       127 yfl~~l~Ri~~~~Y~PT~~Dilr~r~~TiG--i~~~~~~~~~-------------------v~l~iwDtgGQ-e~~R~~w  184 (327)
T 3ohm_A          127 YYLNDLDRVADPSYLPTQQDVLRVRVPTTG--IIEYPFDLQS-------------------VIFRMVDVGGQ-RSERRKW  184 (327)
T ss_dssp             HHHTTHHHHHSTTCCCCHHHHTTCCCCCCS--EEEEEEEETT-------------------EEEEEEEECCS-HHHHTTG
T ss_pred             HHHHHHHHHhccCCCccccchhcccCceee--EEEEEEEeec-------------------eeeEEEEcCCc-hhHHHHH
Confidence            999999999999999999999999999998  8888888753                   68999999999 8999999


Q ss_pred             eeccCCccEEEEEeecccccccccCCCCCCCcccccchHHHHHHHHHHHHcCCCCCCCcEEEEecccchhhhhhhccccc
Q 042025          665 VEMFEDVRVVVFCVALSDYDQMWICPESSGSGTLLQNKMIQSKELFEMMIRHPCFKDTPFVLILNKYDLFEEKVNRVHLS  744 (844)
Q Consensus       665 ~~~FedV~aIIFVVdLSDYDq~l~~~ED~g~~~~~~NRL~ESl~LFesI~n~p~f~~tpiILfLNK~DLfeeKI~~spLs  744 (844)
                      .+||+++++||||+|+|+|||++  .|+.     ..|||++++.+|++++++++|.++|+|||+||+||+++||+++||+
T Consensus       185 ~~yf~~~~~iIfV~dls~ydq~l--~d~~-----~~nr~~es~~~~~~i~~~~~~~~~~iiL~~NK~DL~~~ki~~~~l~  257 (327)
T 3ohm_A          185 IHCFENVTSIMFLVALSEYDQVL--VESD-----NENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLV  257 (327)
T ss_dssp             GGGCSSCSEEEEEEEGGGGGCBC--SSCT-----TSBHHHHHHHHHHHHHTSGGGTTCEEEEEEECHHHHHHHTTTSCGG
T ss_pred             HHHhCCCCEEEEEEECccccccc--cccc-----cHhHHHHHHHHHHHHhhhhccCCceEEEEEECchhhhhhhccchHh
Confidence            99999999999999999999999  5554     4899999999999999999999999999999999999999999998


Q ss_pred             cccccCCCCCCcCCCCChhhHHHHHHHHHHHHHhhhccCCCCcEEEEEEeecCCCCHHHHHHHHHHHHhhhhhcccCC
Q 042025          745 TCEWFNDFSPVRTHHNNQSLAHQAYYYVAMKFKDLYASLTGRKLFVWQARARDRVTVDEAFKYIREVLKWDDEKEDNY  822 (844)
Q Consensus       745 ~c~~FPDF~g~~~~~n~~sl~e~A~~YI~~KFl~L~~s~~~Rklyvh~T~AtDte~I~evF~~V~e~Ik~~~~k~~~~  822 (844)
                      .  |||+|.|..   ++   .++|.+||.++|++++. ...+.+|.|+|||+|+.+|+.+|+.|.++|+..+++..|+
T Consensus       258 ~--~fp~y~g~~---~~---~e~a~~fi~~~F~~~~~-~~~~~i~~~~TsA~d~~nV~~vF~~v~~~Il~~~l~~~~l  326 (327)
T 3ohm_A          258 D--YFPEYDGPQ---RD---AQAAREFILKMFVDLNP-DSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNL  326 (327)
T ss_dssp             G--TCTTCCSCS---SC---HHHHHHHHHHHHHSSCT-TTTSCEEEEECCTTCHHHHHHHHHHHHHHHHHTTCC----
T ss_pred             h--hchhccCCC---CC---HHHHHHHHHHHHHhhcc-cccCCcEEEEEEeecCHHHHHHHHHHHHHHHHHhHHhcCC
Confidence            5  599999731   12   78999999999999874 3468899999999999999999999999999999988764
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 844
d1zcaa1122 a.66.1.1 (A:83-204) Transducin (alpha subunit), in 7e-20
d1zcba1126 a.66.1.1 (A:76-201) Transducin (alpha subunit), in 1e-19
d1tada1121 a.66.1.1 (A:57-177) Transducin (alpha subunit), in 4e-19
d1cipa1121 a.66.1.1 (A:61-181) Transducin (alpha subunit), in 2e-18
d1azta2221 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha sub 7e-17
d1svsa1195 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha sub 1e-15
d2bcjq1117 a.66.1.1 (Q:67-183) Transducin (alpha subunit), in 2e-14
d1azta1114 a.66.1.1 (A:88-201) Transducin (alpha subunit), in 2e-14
d1zcba2200 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha sub 1e-12
d2bcjq2200 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha sub 1e-10
>d1zcaa1 a.66.1.1 (A:83-204) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure

class: All alpha proteins
fold: Transducin (alpha subunit), insertion domain
superfamily: Transducin (alpha subunit), insertion domain
family: Transducin (alpha subunit), insertion domain
domain: Transducin (alpha subunit), insertion domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 83.8 bits (207), Expect = 7e-20
 Identities = 30/153 (19%), Positives = 54/153 (35%), Gaps = 33/153 (21%)

Query: 456 FTAEELQDIKLMIQSNMYRYLSILLDGRERFEEEATARMNAQGSHDQISEAGGEADPSET 515
           F  + L + +  I  N+ +   +L+D R++                              
Sbjct: 1   FDQKALLEFRDTIFDNILKGSRVLVDARDKLG---------------------------- 32

Query: 516 TQCIYSINPRLKHFSDWLLDIIATGDLDAFFPAATREYAPLVDEVWKDPAIQETYKRKDE 575
              I   +   +    +L+       L    PA  + Y P +  +W+D  I+E + R+ E
Sbjct: 33  ---IPWQHSENEKHGMFLMAFENKAGLP-VEPATFQLYVPALSALWRDSGIREAFSRRSE 88

Query: 576 LHFLPDVAEYFLSRAVEVSSNEYEPSDRDILYA 608
                +  +YFL     +    Y PS +DIL A
Sbjct: 89  FQL-GESVKYFLDNLDRIGQLNYFPSKQDILLA 120
>d1zcba1 a.66.1.1 (A:76-201) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1tada1 a.66.1.1 (A:57-177) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} Length = 121 Back     information, alignment and structure
>d1cipa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 121 Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Length = 221 Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 195 Back     information, alignment and structure
>d2bcjq1 a.66.1.1 (Q:67-183) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 Back     information, alignment and structure
>d1azta1 a.66.1.1 (A:88-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} Length = 114 Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query844
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 100.0
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.97
d1tada1121 Transducin (alpha subunit), insertion domain {Cow 99.94
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.94
d1cipa1121 Transducin (alpha subunit), insertion domain {Rat 99.93
d1zcaa1122 Transducin (alpha subunit), insertion domain {Mous 99.93
d2bcjq1117 Transducin (alpha subunit), insertion domain {Mous 99.93
d1zcba1126 Transducin (alpha subunit), insertion domain {Mous 99.92
d1azta1114 Transducin (alpha subunit), insertion domain {Cow 99.88
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.88
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.34
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.33
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.3
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.3
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.2
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 98.88
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 98.88
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 98.88
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 98.87
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 98.86
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 98.85
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 98.85
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.83
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 98.8
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 98.78
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 98.77
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 98.76
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 98.76
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 98.75
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 98.73
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.73
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 98.69
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.67
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 98.67
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 98.67
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 98.66
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 98.66
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 98.65
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 98.64
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 98.63
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.63
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 98.62
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 98.61
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.6
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 98.6
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 98.6
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 98.6
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 98.58
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 98.57
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 98.57
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 98.56
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 98.54
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 98.54
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 98.52
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 98.52
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 98.51
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 98.46
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.42
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 98.42
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 98.38
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 98.11
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 97.92
d2fh5b1207 Signal recognition particle receptor beta-subunit 97.58
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 97.57
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 97.57
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 97.52
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 97.29
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 97.26
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 97.19
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 97.09
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 97.05
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 96.94
d1nrjb_209 Signal recognition particle receptor beta-subunit 96.91
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 96.58
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 96.12
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 95.95
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.92
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 95.9
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 95.36
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.16
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 95.11
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 94.87
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.77
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 94.73
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 94.63
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.57
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.4
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.26
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.13
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 94.1
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 93.95
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 93.91
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.85
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 93.78
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 93.68
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 93.67
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 93.65
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 93.6
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 93.57
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 93.49
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 93.38
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 93.38
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 93.35
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 93.34
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.3
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 93.27
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 93.22
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.19
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 93.15
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 93.12
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 92.98
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 92.98
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 92.9
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 92.85
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 92.84
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 92.79
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 92.77
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 92.75
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 92.66
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 92.59
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 92.54
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 92.53
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 92.52
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.51
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 92.46
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 92.39
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 92.36
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 92.34
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 92.32
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 92.31
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 92.25
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 92.12
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 92.05
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 92.01
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 91.97
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 91.91
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 91.9
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 91.88
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 91.88
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 91.88
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 91.83
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 91.75
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 91.7
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 91.64
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 91.63
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 91.62
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 91.45
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 91.43
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 91.42
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 91.34
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 91.3
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 91.26
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 91.24
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 91.2
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 91.17
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 91.13
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 91.06
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 90.99
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 90.66
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 90.53
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 90.44
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 90.29
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 90.28
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 90.03
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 89.97
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 89.68
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 89.65
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 89.38
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 89.36
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 89.11
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 88.84
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 88.61
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 88.53
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 88.44
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 88.42
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 88.4
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 87.97
d2fh5b1207 Signal recognition particle receptor beta-subunit 87.88
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 87.81
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 87.6
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 87.37
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 87.26
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 87.26
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 87.18
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 87.06
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 86.93
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 86.91
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 86.74
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 86.52
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 86.41
d1nrjb_209 Signal recognition particle receptor beta-subunit 86.31
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 86.27
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 86.24
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 85.97
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 85.72
d2awna2232 Maltose transport protein MalK, N-terminal domain 85.33
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 85.18
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 85.15
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 84.93
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 84.59
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 84.15
d2hyda1255 Putative multidrug export ATP-binding/permease pro 84.12
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 84.04
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 83.64
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 83.6
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 83.5
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 83.3
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 83.29
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 83.28
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 83.05
d1g2912240 Maltose transport protein MalK, N-terminal domain 82.93
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 82.81
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 82.67
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 82.66
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 82.63
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 82.4
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 81.87
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 81.62
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 81.43
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 81.4
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 80.83
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 80.5
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 80.26
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 80.02
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Transducin (alpha subunit)
species: Cow (Bos taurus) [TaxId: 9913]

Probab=100.00  E-value=3.7e-35  Score=295.83  Aligned_cols=180  Identities=22%  Similarity=0.407  Sum_probs=155.5

Q ss_pred             cccCCceEEEEEEecCCCCCCccccCcccCCCCCCceEEEEEeCCCCCCCcccceeccCCccEEEEEeecccccccccCC
Q 042025          611 VTQGNGLAFIEFSLDDRSPMSETYTDNLEVQPQPLTKYQLIRVNAKGMNEGCKWVEMFEDVRVVVFCVALSDYDQMWICP  690 (844)
Q Consensus       611 ~TtG~GI~e~eF~~~~~~~~~~~~~~~~~~~~~~~~~~~liDVGGQ~rseR~KW~~~FedV~aIIFVVdLSDYDq~l~~~  690 (844)
                      +|.|  +.+..|.++.                   +++++||+||| +..|.+|.+||++++++|||+|+++|++.+  .
T Consensus        33 pTiG--~~~~~~~~~~-------------------~~~~~~D~~Gq-~~~r~~w~~~~~~~~~ii~v~d~s~~~~~~--~   88 (221)
T d1azta2          33 LTSG--IFETKFQVDK-------------------VNFHMFDVGGQ-RDERRKWIQCFNDVTAIIFVVASSSYNMVI--R   88 (221)
T ss_dssp             CCCS--CEEEEEEETT-------------------EEEEEEECCCS-TTTTTGGGGGCTTCSEEEEEEETTGGGCBC--T
T ss_pred             CCCC--eEEEEEEECc-------------------EEEEEEecCcc-ceeccchhhhcccccceEEEEEcccccccc--c
Confidence            4666  8888887763                   68999999999 899999999999999999999999999998  5


Q ss_pred             CCCCCcccccchHHHHHHHHHHHHcCCCCCCCcEEEEecccchhhhhhhccccccccccCCCCCCcCCC------CChhh
Q 042025          691 ESSGSGTLLQNKMIQSKELFEMMIRHPCFKDTPFVLILNKYDLFEEKVNRVHLSTCEWFNDFSPVRTHH------NNQSL  764 (844)
Q Consensus       691 ED~g~~~~~~NRL~ESl~LFesI~n~p~f~~tpiILfLNK~DLfeeKI~~spLs~c~~FPDF~g~~~~~------n~~sl  764 (844)
                      ++.     ..|||.|++.+|++++++++|.++|||||+||+||+++|+...+...++|||||.+....+      .++..
T Consensus        89 ~~~-----~~~r~~e~~~~~~~il~~~~~~~~~iil~~NK~Dl~~~k~~~~~~~~~~~f~~~~~~~~~~~~~~~~g~~~~  163 (221)
T d1azta2          89 EDN-----QTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPR  163 (221)
T ss_dssp             TTS-----CSBHHHHHHHHHHHHHTCGGGSSCEEEEEEECHHHHHHHHHHCSSCHHHHCGGGGGCCCCTTCCCCTTCCHH
T ss_pred             ccc-----chHHHHHHHHHHHHHhcChhhCCCcEEEEechhhhhhhhhccCcccHHHhCccccccCCcccccccCCCchh
Confidence            554     4899999999999999999999999999999999999999875444446899998753321      22345


Q ss_pred             HHHHHHHHHHHHHhhhccC--CCCcEEEEEEeecCCCCHHHHHHHHHHHHhhhhhcc
Q 042025          765 AHQAYYYVAMKFKDLYASL--TGRKLFVWQARARDRVTVDEAFKYIREVLKWDDEKE  819 (844)
Q Consensus       765 ~e~A~~YI~~KFl~L~~s~--~~Rklyvh~T~AtDte~I~evF~~V~e~Ik~~~~k~  819 (844)
                      ++.|.+||+++|+++++..  .+|.+|+|+|||+|+.+|+.+|+.|+++|.++++|+
T Consensus       164 ~~~a~~~i~~~f~~~~~~~~~~~~~~y~h~T~A~Dt~ni~~vf~~v~d~I~~~~l~~  220 (221)
T d1azta2         164 VTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQ  220 (221)
T ss_dssp             HHHHHHHHHHHHHHHHTSSCTTSCCEEEEECCTTCHHHHHHHHHTTHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHhccCCCCCCceeeeecceeccHHHHHHHHHHHHHHHHHHhhc
Confidence            8889999999999987543  358899999999999999999999999999999885
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tada1 a.66.1.1 (A:57-177) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cipa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zcaa1 a.66.1.1 (A:83-204) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcjq1 a.66.1.1 (Q:67-183) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba1 a.66.1.1 (A:76-201) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azta1 a.66.1.1 (A:88-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure