Citrus Sinensis ID: 042055

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----
MGIFDKEDSDMKSKLVLEICSISTTAIGCAHRRISPPSPAESHFIDWYRLLGVDEEATIETIRKRYHKLALQLHPDKNKHRKAEIAFKLISEAYTCLSDTAKRRAFNLERWKKFCIECNRIPYTSCKSPVNSRASKYKAWNPAAWSRSYKILRNLRDIKERFKEEAKVIENCLSAAASRKESLLVNPSSNLFQSRHRTQKETPVFDPSDYLFQGYPHLRNRMFIKPQSFWYFPRENMEKCDEASG
ccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccc
ccccccccccHHHHccHHHHEccccccccccEEEccccccccccccHHHHHcccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHccccccccccEEEcccccEHcccccccccccccc
mgifdkedsdMKSKLVLEICSISTtaigcahrrisppspaeshfidwyrllgvdeeATIETIRKRYHKLALQlhpdknkhRKAEIAFKLISEAYTCLSDTAKRRAFNLERWKKFCIecnripytsckspvnsraskykawnpaawsRSYKILRNLRDIKERFKEEAKVIENCLSAAASRKesllvnpssnlfqsrhrtqketpvfdpsdylfqgyphlrnrmfikpqsfwyfprenmekcdeasg
mgifdkedsdmkSKLVLEICSISTTAIGCAHRRISPPSPAESHFIDWYRLLGVDEEATIETIRKRYHKLalqlhpdknkhRKAEIAFKLISEAYTCLSDTAKRRAFNLERWKKFCiecnripytsckspvnsraskykawnpaawsrsyKILRNLRDIKERFKEEAKVIENCLSAaasrkesllvnpssnlfqsrhrtqketpvfdpsDYLFQGYPHLRNRMFIKPQSFWYFPRENMEKCDEASG
MGIFDKEDSDMKSKLVLEICSISTTAIGCAHRRISPPSPAESHFIDWYRLLGVDEEATIETIRKRYHKLALQLHPDKNKHRKAEIAFKLISEAYTCLSDTAKRRAFNLERWKKFCIECNRIPYTSCKSPVNSRASKYKAWNPAAWSRSYKILRNLRDIKERFKEEAKVIENCLSAAASRKESLLVNPSSNLFQSRHRTQKETPVFDPSDYLFQGYPHLRNRMFIKPQSFWYFPRENMEKCDEASG
**************LVLEICSISTTAIGCAHRRIS*****ESHFIDWYRLLGVDEEATIETIRKRYHKLALQLHPDKNKHRKAEIAFKLISEAYTCLSDTAKRRAFNLERWKKFCIECNRIPYTSCKSPVNSRASKYKAWNPAAWSRSYKILRNLRDIKERFKEEAKVIENCLS******************************FDPSDYLFQGYPHLRNRMFIKPQSFWYFP************
**************LVLEICSISTT*******************IDWYRLLGVDEEATIETIRKRYHKLALQLHPDKNKHRKAEIAFKLISEAYTCLSDTAKRRAFNLERWK*************************************************************************************************YLFQGYPHLRNRMFIKPQSFWYFPR***********
***********KSKLVLEICSISTTAIGCAHRRISPPSPAESHFIDWYRLLGVDEEATIETIRKRYHKLALQLHPDKNKHRKAEIAFKLISEAYTCLSDTAKRRAFNLERWKKFCIECNRIPYTSCK************WNPAAWSRSYKILRNLRDIKERFKEEAKVIENCLSAAASRKESLLVNPSSNLFQSRHRTQKETPVFDPSDYLFQGYPHLRNRMFIKPQSFWYFPRENMEKCDEASG
*********DMKSKLVLEICSISTTAIGCAHRRISPPSPAESHFIDWYRLLGVDEEATIETIRKRYHKLALQLHPDKNKHRKAEIAFKLISEAYTCLSDTAKRRAFNLERWKKFCIECNRIP*****************W*PAAWSRSYKILRNLRDIKERFKEEAKVIENCLSAAASRKESLLVNPSSNLFQSRHRTQKETPVFDPSDYLFQGYPHLRNRMFIKPQSFWYFPREN*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGIFDKEDSDMKSKLVLEICSISTTAIGCAHRRISPPSPAESHFIDWYRLLGVDEEATIETIRKRYHKLALQLHPDKNKHRKAEIAFKLISEAYTCLSDTAKRRAFNLERWKKFCIECNRIPYTSCKSPVNSRASKYKAWNPAAWSRSYKILRNLRDIKERFKEEAKVIENCLSAAASRKESLLVNPSSNLFQSRHRTQKETPVFDPSDYLFQGYPHLRNRMFIKPQSFWYFPRENMEKCDEASG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query245 2.2.26 [Sep-21-2011]
Q8TQR1 382 Chaperone protein DnaJ OS yes no 0.253 0.162 0.548 2e-12
Q9FH28354 Chaperone protein dnaJ 49 no no 0.253 0.175 0.5 6e-12
P0CW06 389 Chaperone protein DnaJ OS yes no 0.253 0.159 0.516 9e-12
P0CW07 389 Chaperone protein DnaJ OS yes no 0.253 0.159 0.516 9e-12
Q9D832 337 DnaJ homolog subfamily B yes no 0.253 0.183 0.5 5e-11
Q9UXR9 387 Chaperone protein DnaJ OS N/A no 0.253 0.160 0.532 6e-11
Q24133 334 DnaJ protein homolog 1 OS no no 0.253 0.185 0.516 1e-10
Q9RUG2 376 Chaperone protein DnaJ OS yes no 0.257 0.167 0.492 1e-10
Q54IP0539 DnaJ homolog subfamily C no no 0.257 0.116 0.478 3e-10
A6Q486 373 Chaperone protein DnaJ OS yes no 0.257 0.168 0.531 4e-10
>sp|Q8TQR1|DNAJ_METAC Chaperone protein DnaJ OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dnaJ PE=3 SV=1 Back     alignment and function desciption
 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/62 (54%), Positives = 45/62 (72%)

Query: 46  DWYRLLGVDEEATIETIRKRYHKLALQLHPDKNKHRKAEIAFKLISEAYTCLSDTAKRRA 105
           D+Y +LG+ ++A++E I+K Y KLALQ HPD+NK   AE  FK ISEAY  LSDT KR  
Sbjct: 6   DYYEILGLPKDASVEDIKKTYRKLALQYHPDRNKDPGAEDKFKEISEAYAVLSDTEKRAQ 65

Query: 106 FN 107
           ++
Sbjct: 66  YD 67
Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins.
Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) (taxid: 188937)
>sp|Q9FH28|DNJ49_ARATH Chaperone protein dnaJ 49 OS=Arabidopsis thaliana GN=ATJ49 PE=2 SV=2 Back     alignment and function description
>sp|P0CW06|DNAJ_METMZ Chaperone protein DnaJ OS=Methanosarcina mazei GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|P0CW07|DNAJ_METMA Chaperone protein DnaJ OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q9D832|DNJB4_MOUSE DnaJ homolog subfamily B member 4 OS=Mus musculus GN=Dnajb4 PE=2 SV=1 Back     alignment and function description
>sp|Q9UXR9|DNAJ_METTE Chaperone protein DnaJ OS=Methanosarcina thermophila GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q24133|DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster GN=DnaJ-1 PE=1 SV=3 Back     alignment and function description
>sp|Q9RUG2|DNAJ_DEIRA Chaperone protein DnaJ OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=dnaJ PE=3 SV=2 Back     alignment and function description
>sp|Q54IP0|DNJC7_DICDI DnaJ homolog subfamily C member 7 homolog OS=Dictyostelium discoideum GN=dnajc7 PE=1 SV=1 Back     alignment and function description
>sp|A6Q486|DNAJ_NITSB Chaperone protein DnaJ OS=Nitratiruptor sp. (strain SB155-2) GN=dnaJ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query245
356564611268 PREDICTED: uncharacterized protein LOC10 0.938 0.858 0.593 5e-72
356521823249 PREDICTED: uncharacterized protein LOC10 0.942 0.927 0.580 6e-71
356532543306 PREDICTED: uncharacterized protein LOC10 0.979 0.784 0.540 3e-69
255551867260 conserved hypothetical protein [Ricinus 0.902 0.85 0.589 2e-68
356558155270 PREDICTED: uncharacterized protein LOC10 0.951 0.862 0.536 3e-66
224130368277 predicted protein [Populus trichocarpa] 0.942 0.833 0.590 6e-66
449433421267 PREDICTED: uncharacterized J domain-cont 0.914 0.838 0.516 3e-57
449526018267 PREDICTED: uncharacterized J domain-cont 0.914 0.838 0.508 3e-56
224107040 360 predicted protein [Populus trichocarpa] 0.804 0.547 0.585 7e-56
147770752289 hypothetical protein VITISV_016048 [Viti 0.640 0.543 0.518 4e-44
>gi|356564611|ref|XP_003550545.1| PREDICTED: uncharacterized protein LOC100801809 [Glycine max] Back     alignment and taxonomy information
 Score =  276 bits (706), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 143/241 (59%), Positives = 176/241 (73%), Gaps = 11/241 (4%)

Query: 1   MGIFDKEDSDMKSKLVLEICSISTTAIGCAHRRI-SPPSPAESHFIDWYRLLGVDEEATI 59
           MG   KE SD K+KLVLEICSIST ++ C H  + S P      FIDWY +LGV+E A +
Sbjct: 1   MGRMGKE-SDSKTKLVLEICSISTRSVLCVHHTLLSKP------FIDWYCILGVEENAGV 53

Query: 60  ETIRKRYHKLALQLHPDKNKHRKAEIAFKLISEAYTCLSDTAKRRAFNLERWKKFCIECN 119
             IRKRYHKLALQ+HPDKNKH  AEIAFKL+SEAY CLS+ AKR+AF+LER K FC EC 
Sbjct: 54  NAIRKRYHKLALQVHPDKNKHPNAEIAFKLVSEAYACLSNAAKRKAFDLERCKHFCFECK 113

Query: 120 RIPYTSCKSPVNSRASKYKAWNPAAWSRSYKILRNLRDIKERFKEEAKVIENCL-SAAAS 178
           RIPYTS   P NS  S +KAWN    SRS+K+ RN+RD++ERF +EAKVIENCL + + S
Sbjct: 114 RIPYTSSNVPGNSSGSVFKAWNMITRSRSFKLWRNIRDMRERFMDEAKVIENCLRTNSMS 173

Query: 179 RKESLLVNPSSNLFQSR--HRTQKETPVFDPSDYLFQGYPHLRNRMFIKPQSFWYFPREN 236
           RKES   + +  L +S+  HR +KETPVF+PSDYL+QGYPHLR+ ++    +FWY  R +
Sbjct: 174 RKESPPYDSAGFLHRSKSMHRFEKETPVFNPSDYLYQGYPHLRSNIYKNSSTFWYLQRNS 233

Query: 237 M 237
           M
Sbjct: 234 M 234

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356521823|ref|XP_003529550.1| PREDICTED: uncharacterized protein LOC100816858 [Glycine max] Back     alignment and taxonomy information
>gi|356532543|ref|XP_003534831.1| PREDICTED: uncharacterized protein LOC100781104 [Glycine max] Back     alignment and taxonomy information
>gi|255551867|ref|XP_002516979.1| conserved hypothetical protein [Ricinus communis] gi|223544067|gb|EEF45593.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356558155|ref|XP_003547373.1| PREDICTED: uncharacterized protein LOC100778573 [Glycine max] Back     alignment and taxonomy information
>gi|224130368|ref|XP_002328591.1| predicted protein [Populus trichocarpa] gi|222838573|gb|EEE76938.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449433421|ref|XP_004134496.1| PREDICTED: uncharacterized J domain-containing protein C4H3.01-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449526018|ref|XP_004170012.1| PREDICTED: uncharacterized J domain-containing protein C4H3.01-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224107040|ref|XP_002314354.1| predicted protein [Populus trichocarpa] gi|222863394|gb|EEF00525.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147770752|emb|CAN62468.1| hypothetical protein VITISV_016048 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query245
TAIR|locus:4010713734229 AT3G06778 "AT3G06778" [Arabido 0.885 0.947 0.426 3.5e-43
TAIR|locus:2163786 726 AT5G53150 [Arabidopsis thalian 0.367 0.123 0.455 4.6e-14
TAIR|locus:2122950 558 AT4G19570 [Arabidopsis thalian 0.265 0.116 0.569 1.7e-13
DICTYBASE|DDB_G0290017176 DDB_G0290017 "DnaJ homolog sub 0.261 0.363 0.484 2.9e-13
TAIR|locus:2151714241 AT5G37750 [Arabidopsis thalian 0.265 0.269 0.538 6.2e-13
RGD|708544223 LOC56764 "dnaj-like protein" [ 0.281 0.309 0.436 9.1e-13
UNIPROTKB|Q2T9S2195 LOC780805 "Uncharacterized pro 0.289 0.364 0.453 1.9e-12
ZFIN|ZDB-GENE-050522-76199 zgc:110447 "zgc:110447" [Danio 0.281 0.346 0.449 3.1e-12
TAIR|locus:2182508287 AT5G37440 [Arabidopsis thalian 0.273 0.233 0.537 3.7e-12
FB|FBgn0052640132 CG32640 [Drosophila melanogast 0.253 0.469 0.483 6.4e-12
TAIR|locus:4010713734 AT3G06778 "AT3G06778" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 456 (165.6 bits), Expect = 3.5e-43, P = 3.5e-43
 Identities = 102/239 (42%), Positives = 144/239 (60%)

Query:    10 DMKSKLVLEICSISTTAIGCAH-RRISPPSPAESHFIDWYRLLGVDEEATIETIRKRYHK 68
             D K+ LV +I ++S + I C H  RIS    + S FIDWY +LG+ E+A ++ IRKRYHK
Sbjct:     9 DPKAALVSDILALSRSPISCIHINRIS----SGSCFIDWYLILGIQEDAEVKVIRKRYHK 64

Query:    69 LALQLHPDKNKHRKAEIAFKLISEAYTCLSDTAKRRAFNLERWKKFCIECNRIPYTSCKS 128
             LAL++HPDKN H KA+IAFKLI EAY CLSD  KRR+FN++R    C++C+R+ +   KS
Sbjct:    65 LALKVHPDKNNHPKADIAFKLIHEAYLCLSDETKRRSFNIDRRNNICLKCSRVSH---KS 121

Query:   129 PVNSRASKYKAWNPAAWSRSYKILRNLRDIKERFKEEAKVIENCLSAAASRKESLLVNPS 188
               N   SK     P       +  + L+DI+++F+EE  VIE CL   ++       N +
Sbjct:   122 KENRNDSK-----PN------RFCQTLKDIRDKFREENMVIERCLKTNSAFFMGNRTNET 170

Query:   189 SNLF--QSRHRTQKETPVFDPSDYLFQGYPHLRNRMF-IKPQSFWYFPRENMEKCDEAS 244
               ++    ++R  KE+PVF+PSDY   GYPH+RNR+F     S W     +   C  +S
Sbjct:   171 PPVYGIPKQNRINKESPVFNPSDYRLWGYPHVRNRVFDYNLSSDWNMFTRSRSTCVHSS 229
GO:0005575 "cellular_component" evidence=ND
GO:0006457 "protein folding" evidence=IEA
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
TAIR|locus:2163786 AT5G53150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122950 AT4G19570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290017 DDB_G0290017 "DnaJ homolog subfamily C member 5B" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2151714 AT5G37750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|708544 LOC56764 "dnaj-like protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q2T9S2 LOC780805 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-76 zgc:110447 "zgc:110447" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2182508 AT5G37440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0052640 CG32640 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
pfam0022663 pfam00226, DnaJ, DnaJ domain 6e-21
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 2e-19
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 1e-18
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 1e-17
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 3e-17
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 3e-17
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 2e-16
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 2e-15
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 1e-14
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 3e-14
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 3e-14
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 4e-14
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 4e-14
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 1e-13
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 2e-13
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 2e-13
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 2e-13
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 3e-13
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 4e-13
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 5e-13
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 6e-13
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 4e-12
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 4e-12
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 5e-12
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 7e-12
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 2e-11
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 1e-10
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 2e-10
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 2e-10
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 4e-10
PRK10266 306 PRK10266, PRK10266, curved DNA-binding protein Cbp 8e-10
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 2e-09
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 2e-09
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 1e-08
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 3e-08
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 4e-08
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 1e-05
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 3e-05
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 1e-04
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information 
 Score = 83.0 bits (206), Expect = 6e-21
 Identities = 32/63 (50%), Positives = 41/63 (65%), Gaps = 1/63 (1%)

Query: 46  DWYRLLGVDEEATIETIRKRYHKLALQLHPDKNKHRKA-EIAFKLISEAYTCLSDTAKRR 104
           D+Y +LGV  +A+ E I+K Y KLAL+ HPDKN    A E  FK I+EAY  LSD  KR 
Sbjct: 1   DYYEILGVPRDASDEEIKKAYRKLALKYHPDKNPGDPAAEEKFKEINEAYEVLSDPEKRA 60

Query: 105 AFN 107
            ++
Sbjct: 61  IYD 63

DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 245
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 100.0
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 99.97
PRK14296 372 chaperone protein DnaJ; Provisional 99.97
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.96
PRK14287 371 chaperone protein DnaJ; Provisional 99.96
PRK14298 377 chaperone protein DnaJ; Provisional 99.96
PRK14288 369 chaperone protein DnaJ; Provisional 99.96
PRK14286 372 chaperone protein DnaJ; Provisional 99.96
PRK14276 380 chaperone protein DnaJ; Provisional 99.96
PRK14280 376 chaperone protein DnaJ; Provisional 99.96
PRK14278 378 chaperone protein DnaJ; Provisional 99.96
PRK14279 392 chaperone protein DnaJ; Provisional 99.96
PRK14282 369 chaperone protein DnaJ; Provisional 99.96
PRK14285 365 chaperone protein DnaJ; Provisional 99.95
PRK14277 386 chaperone protein DnaJ; Provisional 99.95
PRK10767 371 chaperone protein DnaJ; Provisional 99.95
PRK14283 378 chaperone protein DnaJ; Provisional 99.95
PRK14301 373 chaperone protein DnaJ; Provisional 99.95
PRK14295 389 chaperone protein DnaJ; Provisional 99.95
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.95
PRK14284 391 chaperone protein DnaJ; Provisional 99.95
PRK14281 397 chaperone protein DnaJ; Provisional 99.95
PRK14294 366 chaperone protein DnaJ; Provisional 99.95
PRK14297 380 chaperone protein DnaJ; Provisional 99.95
PRK14300 372 chaperone protein DnaJ; Provisional 99.94
PRK14291 382 chaperone protein DnaJ; Provisional 99.94
PRK14293 374 chaperone protein DnaJ; Provisional 99.94
PRK14290 365 chaperone protein DnaJ; Provisional 99.94
PRK14289 386 chaperone protein DnaJ; Provisional 99.93
PRK14292 371 chaperone protein DnaJ; Provisional 99.93
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 99.92
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 99.91
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.81
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.8
PRK14299291 chaperone protein DnaJ; Provisional 99.8
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.78
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.78
KOG0691296 consensus Molecular chaperone (DnaJ superfamily) [ 99.77
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.75
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.72
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.7
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 99.67
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.67
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.63
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.62
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.62
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.61
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.58
PHA03102153 Small T antigen; Reviewed 99.57
PRK01356166 hscB co-chaperone HscB; Provisional 99.57
PRK05014171 hscB co-chaperone HscB; Provisional 99.55
PRK03578176 hscB co-chaperone HscB; Provisional 99.51
PRK00294173 hscB co-chaperone HscB; Provisional 99.48
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.43
KOG0714 306 consensus Molecular chaperone (DnaJ superfamily) [ 99.41
KOG0722329 consensus Molecular chaperone (DnaJ superfamily) [ 99.4
PTZ00100116 DnaJ chaperone protein; Provisional 99.32
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.31
PRK01773173 hscB co-chaperone HscB; Provisional 99.24
PHA02624 647 large T antigen; Provisional 99.24
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 99.23
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.12
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 99.1
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 99.07
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 98.62
KOG0568342 consensus Molecular chaperone (DnaJ superfamily) [ 98.38
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 98.36
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.36
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 97.8
PLN03165111 chaperone protein dnaJ-related; Provisional 96.6
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.57
KOG0431453 consensus Auxilin-like protein and related protein 96.49
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.44
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 95.97
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 90.31
KOG0724 335 consensus Zuotin and related molecular chaperones 88.24
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 85.62
TIGR02642186 phage_xxxx uncharacterized phage protein. This unc 85.01
TIGR02642186 phage_xxxx uncharacterized phage protein. This unc 84.58
PRK14277 386 chaperone protein DnaJ; Provisional 83.84
PTZ00037 421 DnaJ_C chaperone protein; Provisional 83.77
PRK14278 378 chaperone protein DnaJ; Provisional 83.25
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 82.75
PF11833194 DUF3353: Protein of unknown function (DUF3353); In 82.31
PF1344662 RPT: A repeated domain in UCH-protein 82.16
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-39  Score=297.19  Aligned_cols=182  Identities=23%  Similarity=0.235  Sum_probs=130.7

Q ss_pred             ccCcccccccCCCCCHHHHHHHHHHHHHHhCCCCCC-CchHHHHHHHHHHHHHhccchHHHHHHHHHhhhhhccc-cCCC
Q 042055           44 FIDWYRLLGVDEEATIETIRKRYHKLALQLHPDKNK-HRKAEIAFKLISEAYTCLSDTAKRRAFNLERWKKFCIE-CNRI  121 (245)
Q Consensus        44 ~~d~Y~iLgv~~~as~~~Ik~ayr~la~~~HPDk~~-~~~a~~~f~~i~~Ay~vLsdp~~R~~YD~~~~~~~~~~-~~~~  121 (245)
                      .+|||+||||+++||.+|||+|||+||++||||+|+ +++|+++|++|++||+|||||++|++||+++...+... .+..
T Consensus         3 ~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~gg~gg~   82 (371)
T COG0484           3 KRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKAGGFGGF   82 (371)
T ss_pred             ccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccccCCcCCC
Confidence            479999999999999999999999999999999999 89999999999999999999999999999998877511 1111


Q ss_pred             CCCCCCC-CCCCCCCCccccCC--CccCc-----h------hHHHHHHHHHHHHHHHHHHH-HHHHHhccccccccCCCC
Q 042055          122 PYTSCKS-PVNSRASKYKAWNP--AAWSR-----S------YKILRNLRDIKERFKEEAKV-IENCLSAAASRKESLLVN  186 (245)
Q Consensus       122 ~~~~~~~-~~~~~~~~~~~w~~--~~~~r-----~------~~~~~~l~~~~~~~~~e~~v-ce~C~g~g~k~~~~~~~~  186 (245)
                      .+...+. ....++.+|.+...  ..+++     +      ++|.++.......+...+.+ |+.|.|+|+++++.+.+|
T Consensus        83 g~~~fgg~~~DIF~~~FgGg~~~~~~~~~~~rG~Dl~~~l~isleEa~~G~~~~i~~~~~~~C~~C~GsGak~gt~~~tC  162 (371)
T COG0484          83 GFGGFGGDFGDIFEDFFGGGGGGRRRPNRPRRGADLRYNLEITLEEAVFGVKKEIRVTRSVTCSTCHGSGAKPGTDPKTC  162 (371)
T ss_pred             CcCCCCCCHHHHHHHhhcCCCcccCCCCCcccCCceEEEEEeEhhhhccCceeeEecceeeECCcCCCCCCCCCCCCCcC
Confidence            1111110 11111222211100  00111     1      23444444445777777888 999999999999999877


Q ss_pred             CCCCcccceeEEeeecccccccccccCCCCcccceeecCCCc
Q 042055          187 PSSNLFQSRHRTQKETPVFDPSDYLFQGYPHLRNRMFIKPQS  228 (245)
Q Consensus       187 ~~~~C~G~~~~~~q~~p~f~~~~~~~C~~C~G~G~iik~p~~  228 (245)
                      ++  |+|++.+.+.... +..+++++|+.|+|+|++|++|+.
T Consensus       163 ~t--C~G~G~v~~~~~~-g~~~~~~~C~~C~G~G~~i~~pC~  201 (371)
T COG0484         163 PT--CNGSGQVRTVQRT-GFFSFQQTCPTCNGTGKIIKDPCG  201 (371)
T ss_pred             CC--CCCcCeEEEEEee-eEEEEEEECCCCccceeECCCCCC
Confidence            77  8888544333322 555567899999999999987753

>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03165 chaperone protein dnaJ-related; Provisional Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 3e-11
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 1e-10
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 2e-10
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 9e-10
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 1e-09
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 1e-09
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 3e-09
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 1e-08
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 5e-08
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 9e-08
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 1e-07
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 3e-07
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 3e-07
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 7e-07
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 1e-06
3lz8_A 329 Structure Of A Putative Chaperone Dnaj From Klebsie 2e-06
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 8e-06
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 1e-05
2l6l_A155 Solution Structure Of Human J-Protein Co-Chaperone, 2e-05
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 7e-05
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 7e-05
2ys8_A90 Solution Structure Of The Dnaj-Like Domain From Hum 4e-04
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure 
Iteration: 1

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 45/72 (62%), Gaps = 2/72 (2%)
Query: 38  SPAESHFIDWYRLLGVDEEATIETIRKRYHKLALQLHPDKNKHRK--AEIAFKLISEAYT 95
           S   S   ++Y +LGV   A+ E I+K Y KLAL+ HPDKN   K  AE  FKL+SEAY 
Sbjct: 2   SSGSSGMANYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKLVSEAYE 61
Query: 96  CLSDTAKRRAFN 107
            LSD+ KR  ++
Sbjct: 62  VLSDSKKRSLYD 73
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|2YS8|A Chain A, Solution Structure Of The Dnaj-Like Domain From Human Ras- Associated Protein Rap1 Length = 90 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 1e-22
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 3e-21
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 4e-20
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 2e-19
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 3e-19
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 3e-19
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 9e-19
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 1e-18
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 2e-18
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 2e-18
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 3e-18
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 4e-18
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 4e-18
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 4e-18
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 5e-18
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 1e-17
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 3e-17
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 9e-17
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 1e-16
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 3e-16
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 3e-15
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 7e-14
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 1e-13
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-13
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 1e-12
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 4e-12
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 6e-12
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 4e-10
2guz_A71 Mitochondrial import inner membrane translocase su 8e-09
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 1e-08
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 2e-08
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 3e-08
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 4e-07
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 5e-07
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
 Score = 87.9 bits (218), Expect = 1e-22
 Identities = 23/59 (38%), Positives = 31/59 (52%)

Query: 46  DWYRLLGVDEEATIETIRKRYHKLALQLHPDKNKHRKAEIAFKLISEAYTCLSDTAKRR 104
           D + +LGV   A+ + + K Y KLA+ LHPDK     +E AFK +  A T L    K  
Sbjct: 28  DSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLKNIKSG 86
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query245
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.87
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.87
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.86
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.86
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.86
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.86
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.85
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.85
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.85
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.85
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.84
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.83
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.83
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.83
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.81
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.8
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.79
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.79
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.78
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.75
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.73
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.73
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.72
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.72
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.7
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.7
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.7
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.69
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.69
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.67
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.66
2guz_A71 Mitochondrial import inner membrane translocase su 99.63
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.62
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.11
2guz_B65 Mitochondrial import inner membrane translocase su 98.9
1nlt_A 248 Protein YDJ1, mitochondrial protein import protein 98.08
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 97.94
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 97.78
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 92.03
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 90.79
2bx9_A53 Anti-trap, AT, tryptophan RNA-binding attenuator p 90.61
1nlt_A 248 Protein YDJ1, mitochondrial protein import protein 84.47
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 82.35
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.87  E-value=1.8e-22  Score=149.88  Aligned_cols=73  Identities=40%  Similarity=0.661  Sum_probs=68.7

Q ss_pred             cccCcccccccCCCCCHHHHHHHHHHHHHHhCCCCCCCchHHHHHHHHHHHHHhccchHHHHHHHHHhhhhhc
Q 042055           43 HFIDWYRLLGVDEEATIETIRKRYHKLALQLHPDKNKHRKAEIAFKLISEAYTCLSDTAKRRAFNLERWKKFC  115 (245)
Q Consensus        43 ~~~d~Y~iLgv~~~as~~~Ik~ayr~la~~~HPDk~~~~~a~~~f~~i~~Ay~vLsdp~~R~~YD~~~~~~~~  115 (245)
                      ...|||+||||+++|+.++||+|||+|++++|||+++.+.+++.|+.|++||++|+||.+|..||..+...+.
T Consensus         5 ~~~~~y~iLgv~~~as~~eIk~ayr~l~~~~HPDk~~~~~a~~~f~~i~~Ay~~L~d~~~R~~Yd~~~~~~~~   77 (88)
T 2ctr_A            5 SSGSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFT   77 (88)
T ss_dssp             CCCSHHHHHTCCTTCCHHHHHHHHHHHHHHTCTTTCCSHHHHHHHHHHHHHHHHHHSSHHHHHHHHTCHHHHT
T ss_pred             CCCCHHHHcCcCCCCCHHHHHHHHHHHHHHHCcCCCCChHHHHHHHHHHHHHHHHCCHHHHHHHHHhCccccc
Confidence            4579999999999999999999999999999999999888999999999999999999999999998877664
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 245
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 1e-13
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 1e-11
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 2e-11
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 2e-11
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 1e-10
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 1e-10
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 5e-09
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 1e-05
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 62.8 bits (152), Expect = 1e-13
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 7/72 (9%)

Query: 46  DWYRLLGVDEEATIETIRKRYHKLALQLHPDKN-------KHRKAEIAFKLISEAYTCLS 98
           DWY +LG D  A +  ++++Y KL L  HPDK           +    F  I +A+  L 
Sbjct: 17  DWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAWKILG 76

Query: 99  DTAKRRAFNLER 110
           +   ++ ++L+R
Sbjct: 77  NEETKKKYDLQR 88
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query245
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.9
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.84
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.78
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.76
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.72
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.68
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.67
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 98.2
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 98.01
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 81.66
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.90  E-value=3.6e-24  Score=153.06  Aligned_cols=69  Identities=42%  Similarity=0.718  Sum_probs=64.6

Q ss_pred             cCcccccccCCCCCHHHHHHHHHHHHHHhCCCCCC-CchHHHHHHHHHHHHHhccchHHHHHHHHHhhhh
Q 042055           45 IDWYRLLGVDEEATIETIRKRYHKLALQLHPDKNK-HRKAEIAFKLISEAYTCLSDTAKRRAFNLERWKK  113 (245)
Q Consensus        45 ~d~Y~iLgv~~~as~~~Ik~ayr~la~~~HPDk~~-~~~a~~~f~~i~~Ay~vLsdp~~R~~YD~~~~~~  113 (245)
                      .|||+||||+++||.++||+|||++++++|||+++ ++.+++.|+.|++||+||+||.+|..||.++..+
T Consensus         3 ~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~   72 (75)
T d1xbla_           3 QDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAA   72 (75)
T ss_dssp             CCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSS
T ss_pred             CCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCccc
Confidence            69999999999999999999999999999999998 5678889999999999999999999999987554
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure