Citrus Sinensis ID: 042087

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
VYGLDINPRAIKISWIKLYLNALHESFSKLFCHCHCKRSFVLRGYLWGYERRVEFDESDLLAYCRHHDIQLEGIVGCRPQVLNPNSNAMSKIITENASEEFLYSLSNYCGLQVGRYSK
ccccccccccHHHHHHHHHHHHHcccccEEEEEccccccEEEccccccccEEEEccHHHHHcccccccccccEEEEccccccccccHHHHHHHHHcccHHHHHHHccccccccccccc
cccccccHHHHHHHHHHHHHHHcccccccEEEEccccEEEEEcccccccHcEEEEEHHHHHHHHHHcccEEcEEEcccccccccccHHHHHHHHccccHHHHHHHHHHHHEEEccccc
vygldinpraIKISWIKLYLNALHESFSKLfchchckrsfvlrgylwgyerrvefdesdLLAYCRHhdiqlegivgcrpqvlnpnsnaMSKIITENASEEFLYSLSNycglqvgrysk
vygldinpraiKISWIKLYLNALHESFSKLFCHCHCKRSFVLRGYLWGYERRVEFDESDLLAYCRHHDIQLEGIVGCRPQVLNPNSNAMSKIITENASEEFLYSLSnycglqvgrysk
VYGLDINPRAIKISWIKLYLNALHESFSKLFCHCHCKRSFVLRGYLWGYERRVEFDESDLLAYCRHHDIQLEGIVGCRPQVLNPNSNAMSKIITENASEEFLYSLSNYCGLQVGRYSK
***LDINPRAIKISWIKLYLNALHESFSKLFCHCHCKRSFVLRGYLWGYERRVEFDESDLLAYCRHHDIQLEGIVGCRPQ**************************************
VYGLD**PRAIKISWIKLYLNALHESFSKLFCHCHCKRSFVLRGYLWGYERRVEFDESDLLAYCRHHDIQLEGIVGCRPQVLNPN***********ASEEFLYSLSNYCGLQVGRY**
VYGLDINPRAIKISWIKLYLNALHESFSKLFCHCHCKRSFVLRGYLWGYERRVEFDESDLLAYCRHHDIQLEGIVGCRPQVLNPNSNAMSKIITENASEEFLYSLSNYCGLQVGRYSK
VYGLDINPRAIKISWIKLYLNALHESFSKLFCHCHCKRSFVLRGYLWGYERRVEFDESDLLAYCRHHDIQLEGIVGCRPQVLNPNSNAMSKIITENASEEFLYSLSNYCGLQVGRYS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VYGLDINPRAIKISWIKLYLNALHESFSKLFCHCHCKRSFVLRGYLWGYERRVEFDESDLLAYCRHHDIQLEGIVGCRPQVLNPNSNAMSKIITENASEEFLYSLSNYCGLQVGRYSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query118 2.2.26 [Sep-21-2011]
Q9LTB2 1071 Methionine S-methyltransf yes no 0.855 0.094 0.625 8e-33
Q9SWR3 1088 Methionine S-methyltransf N/A no 0.855 0.092 0.607 4e-32
Q8W519 1091 Methionine S-methyltransf N/A no 0.855 0.092 0.589 3e-31
Q9MBC2 1088 Methionine S-methyltransf N/A no 0.855 0.092 0.598 5e-31
>sp|Q9LTB2|MMT1_ARATH Methionine S-methyltransferase OS=Arabidopsis thaliana GN=MMT1 PE=2 SV=1 Back     alignment and function desciption
 Score =  138 bits (348), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 70/112 (62%), Positives = 82/112 (73%), Gaps = 11/112 (9%)

Query: 1   VYGLDINPRAIKISWIKLYLNALHESFSKLFCHCHCKRSFVLRGYLWGYERRVEFDESDL 60
           VYGLDINPRA+KISWI LYLNAL ++   ++     K++ +          RVEF ESDL
Sbjct: 141 VYGLDINPRAVKISWINLYLNALDDNGEPVYDEE--KKTLL---------DRVEFYESDL 189

Query: 61  LAYCRHHDIQLEGIVGCRPQVLNPNSNAMSKIITENASEEFLYSLSNYCGLQ 112
           L YCR + IQLE IVGC PQ+LNPN  AMSK+ITENASEEFL+SLSNYC LQ
Sbjct: 190 LGYCRDNKIQLERIVGCIPQILNPNPEAMSKLITENASEEFLHSLSNYCALQ 241
Catalyzes the S-methylmethionine (SMM) biosynthesis from adenosyl-L-homocysteine (AdoMet) and methionine. SMM biosynthesis (by MMT1) and degradation (by HMT-1, HMT-2 and HMT-3) constitute the SMM cycle in plants, which is probably required to achieve short term control of AdoMet level. Also able to catalyze the selenium-methylmethionine (SeMM) from AdoMet and selenium-methionine (SeMet). May play a role in phoem sulfur transport; such function is however not essential.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 2
>sp|Q9SWR3|MMT1_WOLBI Methionine S-methyltransferase OS=Wollastonia biflora GN=MMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q8W519|MMT1_MAIZE Methionine S-methyltransferase OS=Zea mays GN=MMT1 PE=2 SV=2 Back     alignment and function description
>sp|Q9MBC2|MMT1_HORVU Methionine S-methyltransferase OS=Hordeum vulgare GN=MMT1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
255569806 1001 Methionine S-methyltransferase, putative 0.855 0.100 0.642 1e-32
449431900 1084 PREDICTED: methionine S-methyltransferas 0.855 0.093 0.651 1e-32
449478096 1084 PREDICTED: methionine S-methyltransferas 0.855 0.093 0.651 1e-32
15240558 1071 methionine S-methyltransferase [Arabidop 0.855 0.094 0.625 3e-31
5733429 1071 methionine S-methyltransferase [Arabidop 0.855 0.094 0.625 3e-31
356541838 1090 PREDICTED: methionine S-methyltransferas 0.855 0.092 0.633 4e-31
297792265 1070 methionine S-methyltransferase [Arabidop 0.855 0.094 0.625 8e-31
356559151 1091 PREDICTED: methionine S-methyltransferas 0.855 0.092 0.633 1e-30
225465288 1092 PREDICTED: methionine S-methyltransferas 0.855 0.092 0.633 1e-30
297739444 1089 unnamed protein product [Vitis vinifera] 0.855 0.092 0.633 1e-30
>gi|255569806|ref|XP_002525867.1| Methionine S-methyltransferase, putative [Ricinus communis] gi|223534872|gb|EEF36561.1| Methionine S-methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 85/112 (75%), Gaps = 11/112 (9%)

Query: 1   VYGLDINPRAIKISWIKLYLNALHESFSKLFCHCHCKRSFVLRGYLWGYERRVEFDESDL 60
           VYGLDINPRA+K+SWI LYLNAL E+   ++     ++  +L         RV+F ESDL
Sbjct: 57  VYGLDINPRAVKVSWINLYLNALDENGQPIY---DAEKKTLLD--------RVQFHESDL 105

Query: 61  LAYCRHHDIQLEGIVGCRPQVLNPNSNAMSKIITENASEEFLYSLSNYCGLQ 112
           L+YCR HDIQLE IVGC PQ+LNPN +AMSK+ITENASEEFLYSLSNYC LQ
Sbjct: 106 LSYCRDHDIQLERIVGCIPQILNPNPDAMSKMITENASEEFLYSLSNYCALQ 157

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449431900|ref|XP_004133738.1| PREDICTED: methionine S-methyltransferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449478096|ref|XP_004155222.1| PREDICTED: methionine S-methyltransferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15240558|ref|NP_199792.1| methionine S-methyltransferase [Arabidopsis thaliana] gi|50401175|sp|Q9LTB2.1|MMT1_ARATH RecName: Full=Methionine S-methyltransferase; AltName: Full=AdoMet:Met S-methyltransferase gi|8978257|dbj|BAA98148.1| methionine S-methyltransferase [Arabidopsis thaliana] gi|20453177|gb|AAM19829.1| AT5g49810/K21G20_2 [Arabidopsis thaliana] gi|27363322|gb|AAO11580.1| At5g49810/K21G20_2 [Arabidopsis thaliana] gi|332008475|gb|AED95858.1| methionine S-methyltransferase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|5733429|gb|AAD49574.1| methionine S-methyltransferase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356541838|ref|XP_003539379.1| PREDICTED: methionine S-methyltransferase-like [Glycine max] Back     alignment and taxonomy information
>gi|297792265|ref|XP_002864017.1| methionine S-methyltransferase [Arabidopsis lyrata subsp. lyrata] gi|297309852|gb|EFH40276.1| methionine S-methyltransferase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356559151|ref|XP_003547864.1| PREDICTED: methionine S-methyltransferase-like [Glycine max] Back     alignment and taxonomy information
>gi|225465288|ref|XP_002270977.1| PREDICTED: methionine S-methyltransferase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297739444|emb|CBI29626.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
TAIR|locus:2155466 1071 MMT "methionine S-methyltransf 0.855 0.094 0.625 4e-28
TAIR|locus:2155466 MMT "methionine S-methyltransferase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 326 (119.8 bits), Expect = 4.0e-28, P = 4.0e-28
 Identities = 70/112 (62%), Positives = 82/112 (73%)

Query:     1 VYGLDINPRAIKISWIKLYLNALHESFSKLFCHCHCKRSFVLRGYLWGYERRVEFDESDL 60
             VYGLDINPRA+KISWI LYLNAL ++   ++     ++  +L         RVEF ESDL
Sbjct:   141 VYGLDINPRAVKISWINLYLNALDDNGEPVYDE---EKKTLLD--------RVEFYESDL 189

Query:    61 LAYCRHHDIQLEGIVGCRPQVLNPNSNAMSKIITENASEEFLYSLSNYCGLQ 112
             L YCR + IQLE IVGC PQ+LNPN  AMSK+ITENASEEFL+SLSNYC LQ
Sbjct:   190 LGYCRDNKIQLERIVGCIPQILNPNPEAMSKLITENASEEFLHSLSNYCALQ 241


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.325   0.140   0.452    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      118       118   0.00091  102 3  11 22  0.44    30
                                                     29  0.47    32


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  575 (61 KB)
  Total size of DFA:  140 KB (2086 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  12.21u 0.18s 12.39t   Elapsed:  00:00:00
  Total cpu time:  12.21u 0.18s 12.39t   Elapsed:  00:00:00
  Start:  Thu May  9 15:23:59 2013   End:  Thu May  9 15:23:59 2013
GO:0003824 "catalytic activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0008757 "S-adenosylmethionine-dependent methyltransferase activity" evidence=ISS;IMP
GO:0009058 "biosynthetic process" evidence=IEA
GO:0016740 "transferase activity" evidence=IEA
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0001887 "selenium compound metabolic process" evidence=IMP
GO:0046500 "S-adenosylmethionine metabolic process" evidence=IMP
GO:0005829 "cytosol" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
MMT
MMT; S-adenosylmethionine-dependent methyltransferase; Arabidopsis thaliana methionine S-methyltransferase, an enzyme that catalyzes S -methylmethionine formation. ; Catalyzes the S-methylmethionine (SMM) biosynthesis from adenosyl-L-homocysteine (AdoMet) and methionine. SMM biosynthesis (by MMT1) and degradation (by HMT-1, HMT-2 and HMT-3) constitute the SMM cycle in plants, which is probably required to achieve short term control of AdoMet level. Also able to catalyze the selenium-methylmethionine (SeMM) from AdoMet and selenium- methionine (SeMet). May play a role in phoem sulfur tr [...] (1071 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
ATMS1
ATMS1; 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase/ copper ion bindi [...] (765 aa)
   • •• 0.921
ATMS2
AtMS2; 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase/ methionine synth [...] (765 aa)
   • •  0.919
ATMGL
ATMGL (ARABIDOPSIS THALIANA METHIONINE GAMMA-LYASE); catalytic/ methionine gamma-lyase; Encodes [...] (441 aa)
     •• 0.905
ATMS3
ATMS3 (methionine synthase 3); 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltrans [...] (812 aa)
     •  0.899
AT4G13780
methionine--tRNA ligase, putative / methionyl-tRNA synthetase, putative / MetRS, putative; meth [...] (797 aa)
     •  0.899
OVA1
OVA1 (OVULE ABORTION 1); ATP binding / aminoacyl-tRNA ligase/ methionine-tRNA ligase/ nucleotid [...] (616 aa)
     •  0.899
HMT2
HMT2 (HOMOCYSTEINE METHYLTRANSFERASE 2); homocysteine S-methyltransferase; Encodes a homocystei [...] (333 aa)
      • 0.780
MTO2
MTO2 (METHIONINE OVER-ACCUMULATOR 2); threonine synthase; threonine synthase (526 aa)
      • 0.629
MTHFR1
MTHFR1 (METHYLENETETRAHYDROFOLATE REDUCTASE 1); methylenetetrahydrofolate reductase (NADPH); me [...] (592 aa)
   •  • 0.606
MTO1
MTO1 (METHIONINE OVERACCUMULATION 1); cystathionine gamma-synthase; encodes a cystathionine gam [...] (563 aa)
      • 0.599

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
PLN02672 1082 PLN02672, PLN02672, methionine S-methyltransferase 1e-48
>gnl|CDD|215360 PLN02672, PLN02672, methionine S-methyltransferase Back     alignment and domain information 
 Score =  165 bits (419), Expect = 1e-48
 Identities = 65/112 (58%), Positives = 81/112 (72%), Gaps = 11/112 (9%)

Query: 1   VYGLDINPRAIKISWIKLYLNALHESFSKLFCHCHCKRSFVLRGYLWGYERRVEFDESDL 60
           VYGLDINPRA+K++WI LYLNAL +    ++      ++ +          RVEF ESDL
Sbjct: 145 VYGLDINPRAVKVAWINLYLNALDDDGLPVYDGE--GKTLL---------DRVEFYESDL 193

Query: 61  LAYCRHHDIQLEGIVGCRPQVLNPNSNAMSKIITENASEEFLYSLSNYCGLQ 112
           L YCR ++I+L+ IVGC PQ+LNPN  AMSK++TENASEEFLYSLSNYC LQ
Sbjct: 194 LGYCRDNNIELDRIVGCIPQILNPNPEAMSKLVTENASEEFLYSLSNYCALQ 245

Length = 1082

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 118
PLN02672 1082 methionine S-methyltransferase 99.76
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 97.05
COG2890280 HemK Methylase of polypeptide chain release factor 96.37
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 92.9
TIGR00536284 hemK_fam HemK family putative methylases. The gene 91.9
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 91.27
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 90.84
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 90.65
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 89.96
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 89.24
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 88.62
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 88.35
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 87.7
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 86.34
PF02384 311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 86.07
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 86.06
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 85.58
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 85.42
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 85.31
smart00650169 rADc Ribosomal RNA adenine dimethylases. 84.68
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 83.91
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 82.07
COG4123248 Predicted O-methyltransferase [General function pr 81.85
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 81.46
>PLN02672 methionine S-methyltransferase Back     alignment and domain information 
Probab=99.76  E-value=1.4e-19  Score=165.13  Aligned_cols=103  Identities=63%  Similarity=1.032  Sum_probs=97.4

Q ss_pred             CcccCCCCcchhhhHHHHHHhhhcccccccccccccccchhhcccccccceeeecchhhhhhhhccCCcccceeeecccc
Q 042087            1 VYGLDINPRAIKISWIKLYLNALHESFSKLFCHCHCKRSFVLRGYLWGYERRVEFDESDLLAYCRHHDIQLEGIVGCRPQ   80 (118)
Q Consensus         1 VyGlDiNPrAikiswinlyLNal~~~g~~~~d~~~e~kt~~~~~~~~~l~~RveF~eSDLL~ycr~~~i~ld~IVGCiPQ   80 (118)
                      |+|+||||.|++++|.|+++|+++++|.+.++  .++|+         +.+||+|.++|+++.+++.++++|.||+|.|+
T Consensus       145 v~avDis~~Al~~A~~Na~~n~l~~~~~~~~~--~~~~~---------l~~rV~f~~sDl~~~~~~~~~~fDlIVSNPPY  213 (1082)
T PLN02672        145 VYGLDINPRAVKVAWINLYLNALDDDGLPVYD--GEGKT---------LLDRVEFYESDLLGYCRDNNIELDRIVGCIPQ  213 (1082)
T ss_pred             EEEEECCHHHHHHHHHHHHHcCcccccccccc--ccccc---------ccccEEEEECchhhhccccCCceEEEEECCCc
Confidence            68999999999999999999999999999999  57778         88999999999999998777899999999999


Q ss_pred             ccCCChhHHHHHhhhcccHHHHHhhhcccccccc
Q 042087           81 VLNPNSNAMSKIITENASEEFLYSLSNYCGLQVG  114 (118)
Q Consensus        81 vLnpnp~amsk~itenAsEefLysLSNYc~lQ~~  114 (118)
                      |.++++++|++.++|+.++||||+|+||||||-|
T Consensus       214 I~~~e~~~l~~eV~~~ep~~~~~~~~p~~AL~g~  247 (1082)
T PLN02672        214 ILNPNPEAMSKLVTENASEEFLYSLSNYCALQGF  247 (1082)
T ss_pred             CCCcchhhcChhhhhccccccccccCccccccCC
Confidence            9999999999999999999999999999999863

>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 94.64
3gnl_A 244 Uncharacterized protein, DUF633, LMOF2365_1472; st 94.53
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 94.2
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 93.37
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 93.37
2fpo_A202 Methylase YHHF; structural genomics, putative meth 93.05
3k6r_A278 Putative transferase PH0793; structural genomics, 92.89
2okc_A 445 Type I restriction enzyme stysji M protein; NP_813 92.39
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 92.35
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 92.17
3lpm_A259 Putative methyltransferase; structural genomics, p 91.68
2frn_A278 Hypothetical protein PH0793; structural genomics, 91.49
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 91.29
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 90.57
2esr_A177 Methyltransferase; structural genomics, hypothetic 90.57
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 90.56
2h00_A254 Methyltransferase 10 domain containing protein; st 89.96
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 89.93
3khk_A 544 Type I restriction-modification system methylation 89.91
2b3t_A276 Protein methyltransferase HEMK; translation termin 89.73
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 89.38
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 89.34
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 89.19
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 89.18
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 88.82
3lkd_A 542 Type I restriction-modification system methyltrans 88.69
2b78_A385 Hypothetical protein SMU.776; structure genomics, 88.5
1ws6_A171 Methyltransferase; structural genomics, riken stru 88.06
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 87.95
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 87.86
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 87.57
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 87.26
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 87.07
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 86.78
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 86.73
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 86.7
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 86.66
3ocj_A305 Putative exported protein; structural genomics, PS 86.43
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 85.72
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 85.29
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 84.84
2f46_A156 Hypothetical protein; structural genomics, joint c 84.1
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 83.63
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 83.61
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 83.52
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 83.17
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 82.81
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 82.62
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 82.07
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 81.15
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 81.03
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 80.9
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 80.77
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 80.17
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
Probab=94.64  E-value=0.0081  Score=44.90  Aligned_cols=48  Identities=13%  Similarity=0.118  Sum_probs=37.5

Q ss_pred             CcccCCCCcchhhhHHHHHHhhhcccccccccccccccchhhcccccccceeeecchhhhhhhhccCCcccceee
Q 042087            1 VYGLDINPRAIKISWIKLYLNALHESFSKLFCHCHCKRSFVLRGYLWGYERRVEFDESDLLAYCRHHDIQLEGIV   75 (118)
Q Consensus         1 VyGlDiNPrAikiswinlyLNal~~~g~~~~d~~~e~kt~~~~~~~~~l~~RveF~eSDLL~ycr~~~i~ld~IV   75 (118)
                      |+++||||.|+..+.-|+=.|++                          .+||+|..+|++....+.+ +.|.|+
T Consensus        42 V~avDi~~~al~~A~~N~~~~gl--------------------------~~~i~~~~~d~l~~l~~~~-~~D~Iv   89 (225)
T 3kr9_A           42 AIAGEVVEGPYQSAVKNVEAHGL--------------------------KEKIQVRLANGLAAFEETD-QVSVIT   89 (225)
T ss_dssp             EEEEESSHHHHHHHHHHHHHTTC--------------------------TTTEEEEECSGGGGCCGGG-CCCEEE
T ss_pred             EEEEECCHHHHHHHHHHHHHcCC--------------------------CceEEEEECchhhhcccCc-CCCEEE
Confidence            68999999999999999877765                          3578888899888774432 467665
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 96.36
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 94.76
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 94.17
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 93.38
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 92.68
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 92.01
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 89.94
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 89.81
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 87.02
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 85.03
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 84.98
d2okca1 425 Type I restriction enzyme StySJI M protein {Bacter 81.78
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: N5-glutamine methyltransferase, HemK
domain: N5-glutamine methyltransferase, HemK
species: Escherichia coli [TaxId: 562]

Probab=96.36  E-value=0.00074  Score=50.06  Aligned_cols=58  Identities=17%  Similarity=0.194  Sum_probs=44.9

Q ss_pred             CcccCCCCcchhhhHHHHHHhhhcccccccccccccccchhhcccccccceeeecchhhhhhhhccCCcccceeeecccc
Q 042087            1 VYGLDINPRAIKISWIKLYLNALHESFSKLFCHCHCKRSFVLRGYLWGYERRVEFDESDLLAYCRHHDIQLEGIVGCRPQ   80 (118)
Q Consensus         1 VyGlDiNPrAikiswinlyLNal~~~g~~~~d~~~e~kt~~~~~~~~~l~~RveF~eSDLL~ycr~~~i~ld~IVGCiPQ   80 (118)
                      |+|+||+|+|+++|+-|+=.|+                           ++||+|..||++....  +-..|.||..-|=
T Consensus       135 v~avDis~~Al~~A~~Na~~~~---------------------------~~~v~~~~~d~~~~~~--~~~fDlIvsNPPY  185 (274)
T d2b3ta1         135 IIAVDRMPDAVSLAQRNAQHLA---------------------------IKNIHILQSDWFSALA--GQQFAMIVSNPPY  185 (274)
T ss_dssp             EEEECSSHHHHHHHHHHHHHHT---------------------------CCSEEEECCSTTGGGT--TCCEEEEEECCCC
T ss_pred             eeeccchhHHHhHHHHHHHHhC---------------------------cccceeeecccccccC--CCceeEEEecchh
Confidence            5799999999999999974332                           2579999999998764  3478999998777


Q ss_pred             ccCCChh
Q 042087           81 VLNPNSN   87 (118)
Q Consensus        81 vLnpnp~   87 (118)
                      |-..+.+
T Consensus       186 i~~~~~~  192 (274)
T d2b3ta1         186 IDEQDPH  192 (274)
T ss_dssp             BCTTCHH
T ss_pred             hhhhhhc
Confidence            6544443
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure