Citrus Sinensis ID: 042108
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 406 | ||||||
| 255566233 | 810 | transferase, transferring glycosyl group | 0.933 | 0.467 | 0.816 | 0.0 | |
| 356572682 | 507 | PREDICTED: F-box protein At5g06550-like | 0.933 | 0.747 | 0.828 | 0.0 | |
| 449514803 | 512 | PREDICTED: F-box protein At5g06550-like | 0.958 | 0.759 | 0.794 | 0.0 | |
| 449437518 | 512 | PREDICTED: F-box protein At5g06550-like | 0.958 | 0.759 | 0.794 | 0.0 | |
| 225439323 | 507 | PREDICTED: F-box protein At5g06550 [Viti | 0.943 | 0.755 | 0.790 | 0.0 | |
| 297810763 | 502 | hypothetical protein ARALYDRAFT_487465 [ | 0.980 | 0.792 | 0.771 | 0.0 | |
| 356503873 | 639 | PREDICTED: LOW QUALITY PROTEIN: F-box pr | 0.933 | 0.593 | 0.792 | 0.0 | |
| 79507493 | 502 | uncharacterized protein [Arabidopsis tha | 0.980 | 0.792 | 0.759 | 0.0 | |
| 10178111 | 425 | unnamed protein product [Arabidopsis tha | 0.980 | 0.936 | 0.759 | 1e-180 | |
| 449514805 | 425 | PREDICTED: F-box protein At5g06550-like | 0.916 | 0.875 | 0.765 | 1e-172 |
| >gi|255566233|ref|XP_002524104.1| transferase, transferring glycosyl groups, putative [Ricinus communis] gi|223536672|gb|EEF38314.1| transferase, transferring glycosyl groups, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 677 bits (1748), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 311/381 (81%), Positives = 349/381 (91%), Gaps = 2/381 (0%)
Query: 27 GYNLKSSAPSNT-HGVQPLGNLYFNPGSVNSRNTGLGNLQTLTDELVIDVLGFLDATQLG 85
G++LK+SAPS+ +GVQPLGNLY NPGS+NSRNTGLGNL TLTDELV+D+LG LD T LG
Sbjct: 56 GFSLKNSAPSHIFYGVQPLGNLYLNPGSINSRNTGLGNLHTLTDELVLDILGLLDGTHLG 115
Query: 86 VLATVSKSFYVFANHEPLWRNLALDNLKGEFMFNGSWKSTFVSACYPSFDVGKVNVDGCL 145
+LATVSKSFYVFANHEPLWRNL LDNL G F+FNGSWK T++S+ PSFDV + + L
Sbjct: 116 ILATVSKSFYVFANHEPLWRNLVLDNLNGAFLFNGSWKLTYISSFSPSFDVSCMRISN-L 174
Query: 146 RVRDFYSDYLFQSWLCANLEMKPEWLERDNIARKKCISVEEFVSSFEEPNKPVLLEGCLD 205
RVRDFYSDY+FQSWLCANLEMKPEWLERDNI RKK ISVEEFVS+FEEPNKPVLLEGC+D
Sbjct: 175 RVRDFYSDYIFQSWLCANLEMKPEWLERDNIVRKKGISVEEFVSNFEEPNKPVLLEGCMD 234
Query: 206 NWAALKKWDRDYLVNVCGDVRFAVGPVEMKLEEYFRYSDSVREERPLYLFDPKFADKVPT 265
NWAA WDRDYLV +CGDV+FAVGPVEM+L+EYFRY+D VREERPLYLFDPKFA+KVP+
Sbjct: 235 NWAAFHNWDRDYLVRICGDVKFAVGPVEMRLKEYFRYADQVREERPLYLFDPKFAEKVPS 294
Query: 266 LGGEYEVPVYFREDLFSVLGNERPDYRWVIIGPAGSGSSFHMDPNSTSAWNAIIKGSKKW 325
LG +Y+VP+YFREDLF VLG+ERPDYRW+I+GPAGSGSSFH+DPNSTSAWNA+IKGSKKW
Sbjct: 295 LGSDYKVPMYFREDLFGVLGSERPDYRWIIVGPAGSGSSFHIDPNSTSAWNAVIKGSKKW 354
Query: 326 ILFPPDVVPPGVHPSSDGAEVACPVSIMEWFMNFYGATKNWKKRPIECICKAGEVIFVPN 385
ILFPPDV+P GVHPS DG EVACPVSI+EWFMNFY ATK+WKKRPIEC+CKAGEVIFVPN
Sbjct: 355 ILFPPDVIPSGVHPSPDGTEVACPVSIIEWFMNFYDATKDWKKRPIECVCKAGEVIFVPN 414
Query: 386 GWWHLVINLEESIAITQNYVS 406
GWWHLVINLEES+AITQNYVS
Sbjct: 415 GWWHLVINLEESVAITQNYVS 435
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356572682|ref|XP_003554495.1| PREDICTED: F-box protein At5g06550-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449514803|ref|XP_004164484.1| PREDICTED: F-box protein At5g06550-like isoform 1 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449437518|ref|XP_004136539.1| PREDICTED: F-box protein At5g06550-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225439323|ref|XP_002269129.1| PREDICTED: F-box protein At5g06550 [Vitis vinifera] gi|147840343|emb|CAN75104.1| hypothetical protein VITISV_019348 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297810763|ref|XP_002873265.1| hypothetical protein ARALYDRAFT_487465 [Arabidopsis lyrata subsp. lyrata] gi|297319102|gb|EFH49524.1| hypothetical protein ARALYDRAFT_487465 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356503873|ref|XP_003520725.1| PREDICTED: LOW QUALITY PROTEIN: F-box protein At5g06550-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|79507493|ref|NP_196273.3| uncharacterized protein [Arabidopsis thaliana] gi|75116543|sp|Q67XX3.1|FB252_ARATH RecName: Full=F-box protein At5g06550 gi|51968946|dbj|BAD43165.1| putative protein [Arabidopsis thaliana] gi|51971587|dbj|BAD44458.1| putative protein [Arabidopsis thaliana] gi|332003650|gb|AED91033.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|10178111|dbj|BAB11404.1| unnamed protein product [Arabidopsis thaliana] gi|46518445|gb|AAS99704.1| At5g06550 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449514805|ref|XP_004164485.1| PREDICTED: F-box protein At5g06550-like isoform 2 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 406 | ||||||
| TAIR|locus:2144153 | 502 | AT5G06550 "AT5G06550" [Arabido | 0.931 | 0.752 | 0.759 | 1.4e-165 | |
| DICTYBASE|DDB_G0280485 | 536 | jcdH "transcription factor jum | 0.790 | 0.598 | 0.429 | 1.5e-85 | |
| UNIPROTKB|G4MKL9 | 505 | MGG_04401 "F-box and JmjC doma | 0.896 | 0.720 | 0.391 | 1.2e-65 | |
| TAIR|locus:2032090 | 943 | AT1G78280 [Arabidopsis thalian | 0.859 | 0.370 | 0.368 | 1.9e-62 | |
| DICTYBASE|DDB_G0270006 | 983 | jcdI "transcription factor jum | 0.859 | 0.355 | 0.343 | 5.3e-55 | |
| CGD|CAL0000230 | 552 | orf19.551 [Candida albicans (t | 0.492 | 0.362 | 0.430 | 1.6e-51 | |
| UNIPROTKB|Q5A6K3 | 552 | CaO19.551 "Putative uncharacte | 0.492 | 0.362 | 0.430 | 1.6e-51 | |
| FB|FBgn0038948 | 408 | PSR "phosphatidylserine recept | 0.593 | 0.590 | 0.385 | 5.6e-45 | |
| UNIPROTKB|Q6Q4H1 | 385 | PSR "Bifunctional arginine dem | 0.573 | 0.605 | 0.369 | 7.3e-43 | |
| ZFIN|ZDB-GENE-040426-17 | 403 | jmjd6 "jumonji domain containi | 0.522 | 0.526 | 0.393 | 5.9e-41 |
| TAIR|locus:2144153 AT5G06550 "AT5G06550" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1611 (572.2 bits), Expect = 1.4e-165, P = 1.4e-165
Identities = 288/379 (75%), Positives = 323/379 (85%)
Query: 28 YNLKSSAPSNTHGVQPLGNLYFNPGSVNSRNTGLGNLQTLTDELVIDVLGFLDATQLGVL 87
+ LK +APS HGVQPLGNLYFNPG+VN RNTGLGNLQ L+DELV+D+LG L A LGVL
Sbjct: 47 FKLKIAAPSQEHGVQPLGNLYFNPGAVNVRNTGLGNLQILSDELVLDILGLLGANHLGVL 106
Query: 88 ATVSKSFYVFANHEPLWRNLALDNLKGEFMFNGSWKSTFVSACYPSFDVGKVNVDGCLRV 147
ATV+KSFY+FANHEPLWRNL L+ LKG+F+FNGSW+ST+V+A +P F + + L++
Sbjct: 107 ATVTKSFYIFANHEPLWRNLVLEELKGDFLFNGSWRSTYVAAYHPKFKFAG-DGESNLKI 165
Query: 148 RDFYSDYLFQSWLCANLEMKPEWLERDNIARKKCIXXXXXXXXXXXPNKPVLLEGCLDNW 207
DFYSDYLFQSWLCANLEMKP+WL RDNI R + I PNKPVLLEGCLD W
Sbjct: 166 IDFYSDYLFQSWLCANLEMKPKWLRRDNITRVRGISVEDFITKFEEPNKPVLLEGCLDGW 225
Query: 208 AALKKWDRDYLVNVCGDVRFAVGPVEMKLEEYFRYSDSVREERPLYLFDPKFADKVPTLG 267
A++KW RDYL V GDV FAVGPVEMKLE+YFRYSD REERPLYLFDPKFA+KVP L
Sbjct: 226 PAIEKWSRDYLTKVVGDVEFAVGPVEMKLEKYFRYSDGAREERPLYLFDPKFAEKVPVLD 285
Query: 268 GEYEVPVYFREDLFSVLGNERPDYRWVIIGPAGSGSSFHMDPNSTSAWNAIIKGSKKWIL 327
EY+VPVYFREDLF VLGNERPDYRW+IIGPAGSGSSFH+DPNSTSAWNA+I GSKKW+L
Sbjct: 286 SEYDVPVYFREDLFGVLGNERPDYRWIIIGPAGSGSSFHIDPNSTSAWNAVITGSKKWVL 345
Query: 328 FPPDVVPPGVHPSSDGAEVACPVSIMEWFMNFYGATKNWKKRPIECICKAGEVIFVPNGW 387
FPPDVVPPGVHPS DGAEVACPVSI+EWFMNFY TK+W+K+PIECICKAGEV+FVPNGW
Sbjct: 346 FPPDVVPPGVHPSPDGAEVACPVSIIEWFMNFYDDTKDWEKKPIECICKAGEVMFVPNGW 405
Query: 388 WHLVINLEESIAITQNYVS 406
WHLVINLEESIAITQNY S
Sbjct: 406 WHLVINLEESIAITQNYAS 424
|
|
| DICTYBASE|DDB_G0280485 jcdH "transcription factor jumonji, jmjC domain-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4MKL9 MGG_04401 "F-box and JmjC domain-containing protein" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2032090 AT1G78280 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0270006 jcdI "transcription factor jumonji, jmjC domain-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0000230 orf19.551 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5A6K3 CaO19.551 "Putative uncharacterized protein" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0038948 PSR "phosphatidylserine receptor" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6Q4H1 PSR "Bifunctional arginine demethylase and lysyl-hydroxylase PSR" [Hydra vulgaris (taxid:6087)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-17 jmjd6 "jumonji domain containing 6" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00027131001 | SubName- Full=Putative uncharacterized protein (Chromosome chr8 scaffold_41, whole genome shotgun sequence); (507 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00018070001 | • | 0.491 | |||||||||
| GSVIVG00009477001 | • | 0.451 | |||||||||
| GSVIVG00026943001 | • | 0.412 | |||||||||
| GSVIVG00001542001 | • | 0.410 | |||||||||
| GSVIVG00034559001 | • | 0.401 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 406 | |||
| pfam13621 | 247 | pfam13621, Cupin_8, Cupin-like domain | 1e-21 | |
| pfam02373 | 114 | pfam02373, JmjC, JmjC domain, hydroxylase | 1e-10 | |
| pfam12937 | 47 | pfam12937, F-box-like, F-box-like | 3e-07 |
| >gnl|CDD|222269 pfam13621, Cupin_8, Cupin-like domain | Back alignment and domain information |
|---|
Score = 92.8 bits (231), Expect = 1e-21
Identities = 60/252 (23%), Positives = 97/252 (38%), Gaps = 44/252 (17%)
Query: 185 EEFVSSFEEPNKPVLLEGCLDNWAALKKWD--RDYLVNVCGD--VRFAVGP--------- 231
EEF + KPV+L+G +W A+KKW DYL GD V V P
Sbjct: 2 EEFFREYVAKRKPVVLKGAAKDWPAVKKWTDALDYLKEKYGDVEVSVEVTPPGRADRFFY 61
Query: 232 -----------VEMKLEEY---FRYSDSVREERPLYLFDPKFADKVPTLGGEYEVPVYFR 277
M +++ R LYL + P L + ++P
Sbjct: 62 NDDLSGVNFKEERMPFKDFLDLLRAGSDQETPPYLYLQSSNLDSEFPGLREDNDLP--LA 119
Query: 278 EDLFSVLGNERPDYR-WVIIGPAGSGSSFHMDPNSTSAWNAIIKGSKKWILFPPDVVP-- 334
+ F G W IG G+ +S H D ++ G K++ LFPP VP
Sbjct: 120 PEAF---GKLPQAVNLW--IGNGGTTTSLHYDA--YENLYCVVSGRKRFTLFPPSQVPNL 172
Query: 335 -PGVHPSSDGAEVACPVSIMEWFMNFYGATKNWKKRPIECICKAGEVIFVPNGWWHLVIN 393
PG + G + V + + + + + + G+ +++P GWWH V +
Sbjct: 173 YPGPLDRTGGQPFS-LVDPDNPDLEKF--PRFKDAKALVAELEPGDALYIPAGWWHHVRS 229
Query: 394 LEE-SIAITQNY 404
L++ +IA+ +
Sbjct: 230 LDDFNIAVNYWF 241
|
This cupin like domain shares similarity to the JmjC domain. Length = 247 |
| >gnl|CDD|202224 pfam02373, JmjC, JmjC domain, hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|221867 pfam12937, F-box-like, F-box-like | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 406 | |||
| KOG2130 | 407 | consensus Phosphatidylserine-specific receptor Ptd | 100.0 | |
| PF13621 | 251 | Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU | 100.0 | |
| KOG2132 | 355 | consensus Uncharacterized conserved protein, conta | 99.97 | |
| KOG2131 | 427 | consensus Uncharacterized conserved protein, conta | 99.94 | |
| KOG2508 | 437 | consensus Predicted phospholipase [Lipid transport | 99.91 | |
| PF08007 | 319 | Cupin_4: Cupin superfamily protein; InterPro: IPR0 | 99.65 | |
| PF02373 | 114 | JmjC: JmjC domain, hydroxylase; InterPro: IPR01312 | 99.53 | |
| COG2850 | 383 | Uncharacterized conserved protein [Function unknow | 99.53 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 99.37 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 99.23 | |
| KOG3706 | 629 | consensus Uncharacterized conserved protein [Funct | 99.2 | |
| KOG1356 | 889 | consensus Putative transcription factor 5qNCA, con | 99.14 | |
| KOG1633 | 776 | consensus F-box protein JEMMA and related proteins | 99.11 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.63 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 98.53 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.77 | |
| COG2140 | 209 | Thermophilic glucose-6-phosphate isomerase and rel | 97.4 | |
| KOG3926 | 332 | consensus F-box proteins [Amino acid transport and | 97.38 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 97.21 | |
| smart00558 | 57 | JmjC A domain family that is part of the cupin met | 97.12 | |
| PF00190 | 144 | Cupin_1: Cupin; InterPro: IPR006045 This family re | 96.81 | |
| PF06881 | 109 | Elongin_A: RNA polymerase II transcription factor | 96.8 | |
| TIGR03037 | 159 | anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | 96.46 | |
| PRK13264 | 177 | 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | 96.26 | |
| PF06560 | 182 | GPI: Glucose-6-phosphate isomerase (GPI); InterPro | 96.11 | |
| TIGR03404 | 367 | bicupin_oxalic bicupin, oxalate decarboxylase fami | 95.86 | |
| PF07883 | 71 | Cupin_2: Cupin domain; InterPro: IPR013096 This fa | 95.78 | |
| PRK04190 | 191 | glucose-6-phosphate isomerase; Provisional | 95.63 | |
| PF06052 | 151 | 3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte | 95.39 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 94.94 | |
| COG1917 | 131 | Uncharacterized conserved protein, contains double | 94.72 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 94.49 | |
| KOG2132 | 355 | consensus Uncharacterized conserved protein, conta | 94.39 | |
| TIGR03404 | 367 | bicupin_oxalic bicupin, oxalate decarboxylase fami | 94.33 | |
| COG0662 | 127 | {ManC} Mannose-6-phosphate isomerase [Carbohydrate | 94.18 | |
| smart00835 | 146 | Cupin_1 Cupin. This family represents the conserve | 93.17 | |
| COG4101 | 142 | Predicted mannose-6-phosphate isomerase [Carbohydr | 92.56 | |
| PRK13290 | 125 | ectC L-ectoine synthase; Reviewed | 92.39 | |
| PF05523 | 131 | FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 | 92.19 | |
| TIGR02272 | 335 | gentisate_1_2 gentisate 1,2-dioxygenase. This fami | 92.1 | |
| PF02041 | 167 | Auxin_BP: Auxin binding protein; InterPro: IPR0005 | 91.95 | |
| PF13013 | 109 | F-box-like_2: F-box-like domain | 90.84 | |
| PLN00212 | 493 | glutelin; Provisional | 89.81 | |
| TIGR01221 | 176 | rmlC dTDP-4-dehydrorhamnose 3,5-epimerase. This en | 89.18 | |
| KOG4408 | 386 | consensus Putative Mg2+ and Co2+ transporter CorD | 86.2 | |
| TIGR02466 | 201 | conserved hypothetical protein. This family consis | 85.04 | |
| KOG0958 | 690 | consensus DNA damage-responsive repressor GIS1/RPH | 84.75 | |
| PF13759 | 101 | 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB | 84.68 | |
| COG1898 | 173 | RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and rela | 83.38 | |
| PRK15457 | 233 | ethanolamine utilization protein EutQ; Provisional | 83.35 | |
| TIGR01479 | 468 | GMP_PMI mannose-1-phosphate guanylyltransferase/ma | 82.61 |
| >KOG2130 consensus Phosphatidylserine-specific receptor PtdSerR, contains JmjC domain [Chromatin structure and dynamics; Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-67 Score=492.48 Aligned_cols=285 Identities=45% Similarity=0.885 Sum_probs=262.3
Q ss_pred HhHHHHHhcCChhHHHHHHHhhccCCcccCCchHHHHhhhccCCccCCCccccccceecCccchhhhhhhhhhcccCCcC
Q 042108 90 VSKSFYVFANHEPLWRNLALDNLKGEFMFNGSWKSTFVSACYPSFDVGKVNVDGCLRVRDFYSDYLFQSWLCANLEMKPE 169 (406)
Q Consensus 90 ~~r~~y~~~~~d~lWr~~~~~~~~~~~~~~gsWr~t~~~~~~~~~~~~~~~~~~~~~~~~~~sd~l~~~~~c~~~~~~~~ 169 (406)
|+..+|.+|+++.+||.+++++..+.+ + .+ +||.||+.|+|+...+.+.
T Consensus 1 vs~~~y~~~n~~~~kr~~~~kr~arpe----------l--------------------~~-~~~w~~~~y~e~f~~~~~~ 49 (407)
T KOG2130|consen 1 VSSSMYILCNHEPLKRSLELKRKARPE----------L--------------------YK-MSDWLYKRYYESFTLLDPF 49 (407)
T ss_pred CccceeeecCcchHHHHHHHHHhcChh----------h--------------------hh-hhhHHHHHHHHhccccCcc
Confidence 456789999999999999987643322 1 11 7999999999999998888
Q ss_pred cccCCCccccCCCCHHHHHHHhcCCCCCEEEecCCCcCcccCCCCHHHHHHHhCCceEEEcc------eecchHHHHHhh
Q 042108 170 WLERDNIARKKCISVEEFVSSFEEPNKPVLLEGCLDNWAALKKWDRDYLVNVCGDVRFAVGP------VEMKLEEYFRYS 243 (406)
Q Consensus 170 ~~~~~~I~r~~~ls~e~F~~~y~~~~~PvIi~~~~~~Wpa~~~Wt~~~L~~~~gd~~v~v~~------~~~~l~~f~~~~ 243 (406)
+....++.|..++|.++|.++|.++++||||+|++..|||.++||+++|.++|++++|.++. ++|+|+.|++||
T Consensus 50 ~~dn~~r~~~~~isveeF~~~ferp~kPVll~g~~DgW~A~ekWT~drLskkyrnq~Fkcged~~gnsv~MKmkyY~~Ym 129 (407)
T KOG2130|consen 50 FFDNGNRERRRNISVEEFIERFERPYKPVLLSGLTDGWPASEKWTLDRLSKKYRNQKFKCGEDNNGNSVKMKMKYYIEYM 129 (407)
T ss_pred ccccchhhhhcCCCHHHHHHHhcccCCceEeeccccCCchhhhhhHHHHHHHhcCccccccccCCCcceeeeHHHHHHHH
Confidence 88888999999999999999999999999999999999999999999999999999999974 569999999999
Q ss_pred hccCCCCCeeecCcccccccC--ccccCCCCCCcChhhhhhhcCCC-CCCcceeEeccCCCCCcceecCCCCcceEEEEE
Q 042108 244 DSVREERPLYLFDPKFADKVP--TLGGEYEVPVYFREDLFSVLGNE-RPDYRWVIIGPAGSGSSFHMDPNSTSAWNAIIK 320 (406)
Q Consensus 244 ~~~~~~~~~Yl~d~~~~~~~p--~L~~d~~~P~~f~~d~~~~l~~~-rp~~~~l~iG~~gs~t~~H~D~~~t~~~~~qi~ 320 (406)
+++.|+.|+|+||..|.++.| .|.+||.||.+|++|+|..+|++ ||++||++|||++|||.+|+||..|||||++|+
T Consensus 130 ~~~RddsPLYiFDssFgE~~~~rkLl~dY~VPk~F~dDlF~y~g~e~RPpyRWfvmGParSGtsiHIDPlgTSAWNtll~ 209 (407)
T KOG2130|consen 130 KSTRDDSPLYIFDSSFGEHAPRRKLLEDYSVPKYFRDDLFQYLGEERRPPYRWFVMGPARSGTSIHIDPLGTSAWNTLLQ 209 (407)
T ss_pred hccccCCCeEEecchhhcccchhhhhhhcCcchhhhHHHHHhcCcccCCCceeEEecCCCCCceeEECCcchHHHHHHhh
Confidence 999999999999999999999 89999999999999999999987 999999999999999999999999999999999
Q ss_pred eEEEEEEeCCCCCCCCcccCCCCCcccCCCchhhhhhhhhhhhh----cCCCCcEEEEEcCCCEEEeCCCCeeeeeecCc
Q 042108 321 GSKKWILFPPDVVPPGVHPSSDGAEVACPVSIMEWFMNFYGATK----NWKKRPIECICKAGEVIFVPNGWWHLVINLEE 396 (406)
Q Consensus 321 G~K~w~L~pP~~~~~~l~p~~d~~~v~sp~~~~~w~~~~~p~~~----~~~~~~~~~vl~pGD~LfIP~gWwH~V~nl~~ 396 (406)
|+|+|.||||...+++|.|..++.. ..|+++.+|+..+|+..+ ....+++||+|.|||++|||+||||.|+|+|+
T Consensus 210 GhKrW~LfPp~~p~~lvkv~~~e~g-~~~de~itwf~~~y~rt~~Pswp~E~kPIEc~q~pGEt~fVP~GWWHvVlNle~ 288 (407)
T KOG2130|consen 210 GHKRWVLFPPGTPPELVKVTVDEGG-KQPDEIITWFSTIYPRTQLPSWPDEYKPIECLQKPGETMFVPSGWWHVVLNLEP 288 (407)
T ss_pred ccceeEEcCCCCCCCceeecccccC-CCCcceechhhhccccccCCCCccccCCceeeecCCceEEecCCeEEEEeccCc
Confidence 9999999999999999998877655 689999999999998876 22357899999999999999999999999999
Q ss_pred cEEEeeeccC
Q 042108 397 SIAITQNYVS 406 (406)
Q Consensus 397 sIavt~nFv~ 406 (406)
+|||||||+|
T Consensus 289 TIAiTqNf~s 298 (407)
T KOG2130|consen 289 TIAITQNFAS 298 (407)
T ss_pred eeeeeecccc
Confidence 9999999986
|
|
| >PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A | Back alignment and domain information |
|---|
| >KOG2132 consensus Uncharacterized conserved protein, contains JmjC domain [Chromatin structure and dynamics; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2131 consensus Uncharacterized conserved protein, contains JmjC domain [Chromatin structure and dynamics; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2508 consensus Predicted phospholipase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors | Back alignment and domain information |
|---|
| >PF02373 JmjC: JmjC domain, hydroxylase; InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice [] | Back alignment and domain information |
|---|
| >COG2850 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >KOG3706 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1356 consensus Putative transcription factor 5qNCA, contains JmjC domain [Transcription] | Back alignment and domain information |
|---|
| >KOG1633 consensus F-box protein JEMMA and related proteins with JmjC, PHD, F-box and LRR domains [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >KOG3926 consensus F-box proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >smart00558 JmjC A domain family that is part of the cupin metalloenzyme superfamily | Back alignment and domain information |
|---|
| >PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >PF06881 Elongin_A: RNA polymerase II transcription factor SIII (Elongin) subunit A; InterPro: IPR010684 This family represents a conserved region within RNA polymerase II transcription factor SIII (Elongin) subunit A | Back alignment and domain information |
|---|
| >TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | Back alignment and domain information |
|---|
| >PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | Back alignment and domain information |
|---|
| >PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 | Back alignment and domain information |
|---|
| >TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family | Back alignment and domain information |
|---|
| >PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >PRK04190 glucose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1 | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2132 consensus Uncharacterized conserved protein, contains JmjC domain [Chromatin structure and dynamics; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family | Back alignment and domain information |
|---|
| >COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >smart00835 Cupin_1 Cupin | Back alignment and domain information |
|---|
| >COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13290 ectC L-ectoine synthase; Reviewed | Back alignment and domain information |
|---|
| >PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase [] | Back alignment and domain information |
|---|
| >TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER) | Back alignment and domain information |
|---|
| >PF13013 F-box-like_2: F-box-like domain | Back alignment and domain information |
|---|
| >PLN00212 glutelin; Provisional | Back alignment and domain information |
|---|
| >TIGR01221 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase | Back alignment and domain information |
|---|
| >KOG4408 consensus Putative Mg2+ and Co2+ transporter CorD [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02466 conserved hypothetical protein | Back alignment and domain information |
|---|
| >KOG0958 consensus DNA damage-responsive repressor GIS1/RPH1, jumonji superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13759 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB: 3BVC_B 2RG4_A | Back alignment and domain information |
|---|
| >COG1898 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK15457 ethanolamine utilization protein EutQ; Provisional | Back alignment and domain information |
|---|
| >TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 406 | ||||
| 3ld8_A | 334 | Structure Of Jmjd6 And Fab Fragments Length = 334 | 2e-39 | ||
| 3k2o_A | 336 | Structure Of An Oxygenase Length = 336 | 5e-38 | ||
| 4aap_A | 239 | Crystal Structure Of Jmjd5 Domain Of Human Lysine-S | 7e-10 | ||
| 4gjz_A | 235 | Jmjd5 In Complex With 2-Oxoglutarate Length = 235 | 8e-10 | ||
| 3uyj_A | 248 | Crystal Structure Of Jmjd5 Catalytic Core Domain In | 8e-10 | ||
| 4gjy_A | 235 | Jmjd5 In Complex With N-Oxalylglycine Length = 235 | 2e-09 | ||
| 3k3n_A | 371 | Crystal Structure Of The Catalytic Core Domain Of H | 9e-07 | ||
| 3kv4_A | 447 | Structure Of Phf8 In Complex With Histone H3 Length | 9e-07 | ||
| 3kcx_A | 335 | Factor Inhibiting Hif-1 Alpha In Complex With Clioq | 1e-06 | ||
| 4do0_A | 374 | Crystal Structure Of Human Phf8 In Complex With Dam | 1e-06 | ||
| 2y0i_A | 352 | Factor Inhibiting Hif-1 Alpha In Complex With Tanky | 1e-06 | ||
| 2wwu_A | 371 | Crystal Structure Of The Catalytic Domain Of Phd Fi | 1e-06 | ||
| 2xum_A | 349 | Factor Inhibiting Hif (Fih) Q239h Mutant In Complex | 1e-06 | ||
| 1h2k_A | 349 | Factor Inhibiting Hif-1 Alpha In Complex With Hif-1 | 1e-06 | ||
| 1iz3_A | 349 | Dimeric Structure Of Fih (Factor Inhibiting Hif) Le | 1e-06 | ||
| 1mze_A | 351 | Human Factor Inhibiting Hif (Fih1) Length = 351 | 1e-06 | ||
| 3d8c_A | 349 | Factor Inhibiting Hif-1 Alpha D201g Mutant In Compl | 7e-06 | ||
| 2ilm_A | 349 | Factor Inhibiting Hif-1 Alpha D201a Mutant In Compl | 9e-06 | ||
| 3kv9_A | 397 | Structure Of Kiaa1718 Jumonji Domain Length = 397 | 2e-05 | ||
| 3kv5_D | 488 | Structure Of Kiaa1718, Human Jumonji Demethylase, I | 3e-05 | ||
| 3ptr_B | 392 | Phf2 Jumonji Domain Length = 392 | 8e-05 | ||
| 3n9l_A | 528 | Cekdm7a From C.Elegans, Complex With H3k4me3 Peptid | 3e-04 |
| >pdb|3LD8|A Chain A, Structure Of Jmjd6 And Fab Fragments Length = 334 | Back alignment and structure |
|
| >pdb|3K2O|A Chain A, Structure Of An Oxygenase Length = 336 | Back alignment and structure |
| >pdb|4AAP|A Chain A, Crystal Structure Of Jmjd5 Domain Of Human Lysine-Specific Demethylase 8 (Kdm8) In Complex With N-Oxalylglycine (Nog) Length = 239 | Back alignment and structure |
| >pdb|4GJZ|A Chain A, Jmjd5 In Complex With 2-Oxoglutarate Length = 235 | Back alignment and structure |
| >pdb|3UYJ|A Chain A, Crystal Structure Of Jmjd5 Catalytic Core Domain In Complex With Nickle And Alpha-Kg Length = 248 | Back alignment and structure |
| >pdb|4GJY|A Chain A, Jmjd5 In Complex With N-Oxalylglycine Length = 235 | Back alignment and structure |
| >pdb|3K3N|A Chain A, Crystal Structure Of The Catalytic Core Domain Of Human Phf8 Length = 371 | Back alignment and structure |
| >pdb|3KV4|A Chain A, Structure Of Phf8 In Complex With Histone H3 Length = 447 | Back alignment and structure |
| >pdb|3KCX|A Chain A, Factor Inhibiting Hif-1 Alpha In Complex With Clioquinol Length = 335 | Back alignment and structure |
| >pdb|4DO0|A Chain A, Crystal Structure Of Human Phf8 In Complex With Daminozide Length = 374 | Back alignment and structure |
| >pdb|2Y0I|A Chain A, Factor Inhibiting Hif-1 Alpha In Complex With Tankyrase-2 (Tnks2) Fragment Peptide (21-Mer) Length = 352 | Back alignment and structure |
| >pdb|2WWU|A Chain A, Crystal Structure Of The Catalytic Domain Of Phd Finger Protein 8 Length = 371 | Back alignment and structure |
| >pdb|2XUM|A Chain A, Factor Inhibiting Hif (Fih) Q239h Mutant In Complex With Zn(Ii), Nog And Asp-Substrate Peptide (20-Mer) Length = 349 | Back alignment and structure |
| >pdb|1H2K|A Chain A, Factor Inhibiting Hif-1 Alpha In Complex With Hif-1 Alpha Fragment Peptide Length = 349 | Back alignment and structure |
| >pdb|1IZ3|A Chain A, Dimeric Structure Of Fih (Factor Inhibiting Hif) Length = 349 | Back alignment and structure |
| >pdb|1MZE|A Chain A, Human Factor Inhibiting Hif (Fih1) Length = 351 | Back alignment and structure |
| >pdb|3D8C|A Chain A, Factor Inhibiting Hif-1 Alpha D201g Mutant In Complex With Zn(Ii), Alpha-Ketoglutarate And Hif-1 Alpha 19mer Length = 349 | Back alignment and structure |
| >pdb|2ILM|A Chain A, Factor Inhibiting Hif-1 Alpha D201a Mutant In Complex With Fe(ii), Alpha-ketoglutarate And Hif-1 Alpha 35mer Length = 349 | Back alignment and structure |
| >pdb|3KV9|A Chain A, Structure Of Kiaa1718 Jumonji Domain Length = 397 | Back alignment and structure |
| >pdb|3KV5|D Chain D, Structure Of Kiaa1718, Human Jumonji Demethylase, In Complex With N-Oxalylglycine Length = 488 | Back alignment and structure |
| >pdb|3PTR|B Chain B, Phf2 Jumonji Domain Length = 392 | Back alignment and structure |
| >pdb|3N9L|A Chain A, Cekdm7a From C.Elegans, Complex With H3k4me3 Peptide And Nog Length = 528 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 406 | |||
| 3k2o_A | 336 | Bifunctional arginine demethylase and lysyl-hydro | 4e-81 | |
| 3uyj_A | 248 | Lysine-specific demethylase 8; jellyroll-like all | 1e-69 | |
| 3kv9_A | 397 | JMJC domain-containing histone demethylation prote | 1e-47 | |
| 3al5_A | 338 | HTYW5, JMJC domain-containing protein C2ORF60; tRN | 1e-47 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 3e-45 | |
| 3pua_A | 392 | GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe | 2e-43 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 3e-43 | |
| 3k3o_A | 371 | PHF8, PHD finger protein 8; histone demethylase, c | 4e-43 | |
| 3d8c_A | 349 | Hypoxia-inducible factor 1 alpha inhibitor; FIH, H | 1e-41 | |
| 2yu1_A | 451 | JMJC domain-containing histone demethylation PROT; | 2e-35 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 3e-31 | |
| 1vrb_A | 342 | Putative asparaginyl hydroxylase; 2636534, structu | 2e-13 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 3e-07 | |
| 2xxz_A | 332 | Lysine-specific demethylase 6B; oxidoreductase, hi | 7e-07 | |
| 4diq_A | 489 | Lysine-specific demethylase NO66; structural genom | 1e-06 | |
| 2xdv_A | 442 | MYC-induced nuclear antigen; ribosome biogenesis, | 6e-06 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 9e-06 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 2e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 4ask_A | 510 | Lysine-specific demethylase 6B; oxidoreductase, KD | 3e-05 | |
| 3avr_A | 531 | Lysine-specific demethylase 6A; cupin superfamily, | 6e-05 |
| >3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* Length = 336 | Back alignment and structure |
|---|
Score = 251 bits (642), Expect = 4e-81
Identities = 98/274 (35%), Positives = 146/274 (53%), Gaps = 19/274 (6%)
Query: 148 RDFYSDYLFQSWLCANLEMKPEWLERDNIARKKC--ISVEEFVSSFEEPNKPVLLEGCLD 205
+D + + P + DN+ R +SVEEFV +E P KPV+L +
Sbjct: 22 KDSLDWTRHNY--YESFSLSPAAV-ADNVERADALQLSVEEFVERYERPYKPVVLLNAQE 78
Query: 206 NWAALKKWDRDYLVNVCGDVRFAVG------PVEMKLEEYFRYSDSVREERPLYLFDPKF 259
W+A +KW + L + +F G V+MK++ Y Y +S R++ PLY+FD +
Sbjct: 79 GWSAQEKWTLERLKRKYRNQKFKCGEDNDGYSVKMKMKYYIEYMESTRDDSPLYIFDSSY 138
Query: 260 AD--KVPTLGGEYEVPVYFREDLFSVLG-NERPDYRWVIIGPAGSGSSFHMDPNSTSAWN 316
+ K L +Y+VP +F +DLF G RP YRW ++GP SG+ H+DP TSAWN
Sbjct: 139 GEHPKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWN 198
Query: 317 AIIKGSKKWILFPPDVVPPGVHPSSDGAEVACPVSIMEWFMNFYGATKNWKK----RPIE 372
A+++G K+W LFP + + D +I WF Y T+ +P+E
Sbjct: 199 ALVQGHKRWCLFPTSTPRELIKVTRDEGGNQQDEAI-TWFNVIYPRTQLPTWPPEFKPLE 257
Query: 373 CICKAGEVIFVPNGWWHLVINLEESIAITQNYVS 406
+ K GE +FVP GWWH+V+NL+ +IAITQN+ S
Sbjct: 258 ILQKPGETVFVPGGWWHVVLNLDTTIAITQNFAS 291
|
| >3uyj_A Lysine-specific demethylase 8; jellyroll-like all beta fold, nuclear, oxidored; HET: AKG; 2.35A {Homo sapiens} PDB: 4aap_A* Length = 248 | Back alignment and structure |
|---|
| >3kv9_A JMJC domain-containing histone demethylation protein 1D; jumonji domain lysine demethylase, metal-binding, zinc, zinc-finger; 2.29A {Homo sapiens} PDB: 3kva_A* 3kvb_A* 3u78_A* Length = 397 | Back alignment and structure |
|---|
| >3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* Length = 338 | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Length = 488 | Back alignment and structure |
|---|
| >3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A* Length = 392 | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Length = 447 | Back alignment and structure |
|---|
| >3k3o_A PHF8, PHD finger protein 8; histone demethylase, chromatin modification, methylated H3K9, mental retardation, metal-BI phosphoprotein, zinc-finger; HET: AKG; 2.10A {Homo sapiens} PDB: 3k3n_A* 4do0_A* 2wwu_A* Length = 371 | Back alignment and structure |
|---|
| >3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... Length = 349 | Back alignment and structure |
|---|
| >2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A Length = 451 | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Length = 528 | Back alignment and structure |
|---|
| >1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 Length = 342 | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 | Back alignment and structure |
|---|
| >2xxz_A Lysine-specific demethylase 6B; oxidoreductase, histone demethylation, oxygenase, chromatin modification; HET: 8XQ; 1.80A {Homo sapiens} Length = 332 | Back alignment and structure |
|---|
| >4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} Length = 489 | Back alignment and structure |
|---|
| >2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} Length = 442 | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >4ask_A Lysine-specific demethylase 6B; oxidoreductase, KDM6B, GSK-J1, inhibitor, lysine specific HI demethylase; HET: K0I; 1.86A {Homo sapiens} PDB: 2xue_A* Length = 510 | Back alignment and structure |
|---|
| >3avr_A Lysine-specific demethylase 6A; cupin superfamily, TRI/dimethyllysine demethylase, oxidoredu structural protein complex; HET: M3L OGA EDO; 1.80A {Homo sapiens} PDB: 3avs_A* Length = 531 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 406 | |||
| 3k2o_A | 336 | Bifunctional arginine demethylase and lysyl-hydro | 100.0 | |
| 4gjz_A | 235 | Lysine-specific demethylase 8; JMJC, beta barrel, | 100.0 | |
| 3al5_A | 338 | HTYW5, JMJC domain-containing protein C2ORF60; tRN | 100.0 | |
| 3d8c_A | 349 | Hypoxia-inducible factor 1 alpha inhibitor; FIH, H | 100.0 | |
| 2yu1_A | 451 | JMJC domain-containing histone demethylation PROT; | 100.0 | |
| 3k3o_A | 371 | PHF8, PHD finger protein 8; histone demethylase, c | 100.0 | |
| 3kv9_A | 397 | JMJC domain-containing histone demethylation prote | 100.0 | |
| 3pua_A | 392 | GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe | 100.0 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 100.0 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 100.0 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 99.95 | |
| 1vrb_A | 342 | Putative asparaginyl hydroxylase; 2636534, structu | 99.94 | |
| 2xdv_A | 442 | MYC-induced nuclear antigen; ribosome biogenesis, | 99.82 | |
| 4diq_A | 489 | Lysine-specific demethylase NO66; structural genom | 99.78 | |
| 2ypd_A | 392 | Probable JMJC domain-containing histone demethyla | 99.68 | |
| 2xxz_A | 332 | Lysine-specific demethylase 6B; oxidoreductase, hi | 99.06 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 99.02 | |
| 3avr_A | 531 | Lysine-specific demethylase 6A; cupin superfamily, | 99.01 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 98.82 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 98.82 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 98.54 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 98.41 | |
| 3dxt_A | 354 | JMJC domain-containing histone demethylation PROT; | 98.41 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 98.38 | |
| 4ask_A | 510 | Lysine-specific demethylase 6B; oxidoreductase, KD | 98.36 | |
| 3opt_A | 373 | DNA damage-responsive transcriptional repressor R; | 98.11 | |
| 2ox0_A | 381 | JMJC domain-containing histone demethylation PROT; | 97.9 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 97.16 | |
| 4hfx_A | 97 | Transcription elongation factor B polypeptide 3; s | 96.39 | |
| 2e9q_A | 459 | 11S globulin subunit beta; cucubitin, pumpkin SEED | 96.38 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 96.37 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 96.24 | |
| 1fxz_A | 476 | Glycinin G1; proglycinin, legumin, SEED storage pr | 96.21 | |
| 3fz3_A | 531 | Prunin; TREE NUT allergen, allergy, amandin, almon | 96.16 | |
| 3kgl_A | 466 | Cruciferin; 11S SEED globulin, rapeseed, SEED stor | 95.91 | |
| 3qac_A | 465 | 11S globulin SEED storage protein; 11S SEED storag | 95.71 | |
| 3fjs_A | 114 | Uncharacterized protein with RMLC-like cupin fold; | 95.64 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 95.57 | |
| 1fi2_A | 201 | Oxalate oxidase, germin; beta-jellyroll, oxidoredu | 95.5 | |
| 1x82_A | 190 | Glucose-6-phosphate isomerase; cupin superfamily, | 95.49 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 95.46 | |
| 2d40_A | 354 | Z3393, putative gentisate 1,2-dioxygenase; gentisi | 95.31 | |
| 2y0o_A | 175 | Probable D-lyxose ketol-isomerase; carbohydrate me | 95.25 | |
| 2pfw_A | 116 | Cupin 2, conserved barrel domain protein; cupin do | 95.25 | |
| 3lag_A | 98 | Uncharacterized protein RPA4178; functionally unkn | 95.19 | |
| 4e2g_A | 126 | Cupin 2 conserved barrel domain protein; MCSG, PSI | 95.18 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 95.12 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 95.1 | |
| 1dgw_A | 178 | Canavalin; duplicated swiss-roll beta barrels, loo | 95.05 | |
| 2gm6_A | 208 | Cysteine dioxygenase type I; structural genomics, | 95.02 | |
| 2ozj_A | 114 | Cupin 2, conserved barrel; cupin superfamily prote | 94.98 | |
| 3bu7_A | 394 | Gentisate 1,2-dioxygenase; cupin domain, oxidoredu | 94.93 | |
| 1yhf_A | 115 | Hypothetical protein SPY1581; structural genomics, | 94.83 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 94.82 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 94.82 | |
| 1zvf_A | 176 | 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b | 94.72 | |
| 3kgz_A | 156 | Cupin 2 conserved barrel domain protein; metallopr | 94.68 | |
| 2phl_A | 397 | Phaseolin; plant SEED storage protein(vicilin); HE | 94.66 | |
| 1yfu_A | 174 | 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid | 94.63 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 94.63 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 94.54 | |
| 2fqp_A | 97 | Hypothetical protein BP2299; double-stranded beta- | 94.5 | |
| 2o8q_A | 134 | Hypothetical protein; cpuin-like fold, structural | 94.4 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 94.29 | |
| 3eqe_A | 171 | Putative cystein deoxygenase; YUBC, SR112, NESG, s | 94.27 | |
| 2b8m_A | 117 | Hypothetical protein MJ0764; structural genomics, | 94.09 | |
| 3ibm_A | 167 | Cupin 2, conserved barrel domain protein; cupin 2 | 94.06 | |
| 1lr5_A | 163 | Auxin binding protein 1; beta jellyroll, double st | 94.05 | |
| 3nw4_A | 368 | Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc | 94.04 | |
| 3h8u_A | 125 | Uncharacterized conserved protein with double-STR | 93.9 | |
| 3rns_A | 227 | Cupin 2 conserved barrel domain protein; structura | 93.89 | |
| 1v70_A | 105 | Probable antibiotics synthesis protein; structural | 93.87 | |
| 3nw4_A | 368 | Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc | 93.87 | |
| 3jzv_A | 166 | Uncharacterized protein RRU_A2000; structural geno | 93.79 | |
| 3bu7_A | 394 | Gentisate 1,2-dioxygenase; cupin domain, oxidoredu | 93.77 | |
| 3ht1_A | 145 | REMF protein; cupin fold, Zn-binding, antibiotic b | 93.76 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 93.72 | |
| 2gu9_A | 113 | Tetracenomycin polyketide synthesis protein; X-RAY | 93.56 | |
| 3lwc_A | 119 | Uncharacterized protein; structural genomics, unkn | 93.49 | |
| 2bnm_A | 198 | Epoxidase; oxidoreductase, cupin, HTH, cation-depe | 93.2 | |
| 3ejk_A | 174 | DTDP sugar isomerase; YP_390184.1, structural geno | 93.15 | |
| 2xlg_A | 239 | SLL1785 protein, CUCA; metal binding protein, cupi | 93.13 | |
| 4i4a_A | 128 | Similar to unknown protein; structural genomics, P | 93.11 | |
| 1y3t_A | 337 | Hypothetical protein YXAG; BI cupin, dioxygenase, | 93.0 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 92.77 | |
| 2d40_A | 354 | Z3393, putative gentisate 1,2-dioxygenase; gentisi | 92.68 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 92.57 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 92.54 | |
| 3cew_A | 125 | Uncharacterized cupin protein; all beta-protein, j | 92.53 | |
| 3uss_A | 211 | Putative uncharacterized protein; cupin, three his | 92.43 | |
| 4axo_A | 151 | EUTQ, ethanolamine utilization protein; structural | 92.21 | |
| 3l2h_A | 162 | Putative sugar phosphate isomerase; AFE_0303, stru | 92.14 | |
| 3eln_A | 200 | Cysteine dioxygenase type 1; peroxysulfenate, non- | 92.08 | |
| 3bb6_A | 127 | Uncharacterized protein YEAR; structural genomics, | 92.05 | |
| 1o4t_A | 133 | Putative oxalate decarboxylase; double-stranded be | 91.84 | |
| 3i7d_A | 163 | Sugar phosphate isomerase; YP_168127.1, structural | 91.83 | |
| 2qnk_A | 286 | 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol | 91.45 | |
| 3rns_A | 227 | Cupin 2 conserved barrel domain protein; structura | 91.1 | |
| 1y3t_A | 337 | Hypothetical protein YXAG; BI cupin, dioxygenase, | 90.95 | |
| 3d82_A | 102 | Cupin 2, conserved barrel domain protein; structur | 90.89 | |
| 1o5u_A | 101 | Novel thermotoga maritima enzyme TM1112; cupin, st | 90.88 | |
| 1ep0_A | 185 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; race | 90.81 | |
| 2ixk_A | 184 | DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, l | 90.48 | |
| 3h7j_A | 243 | Bacilysin biosynthesis protein BACB; YWFC, bacilys | 90.3 | |
| 2f4p_A | 147 | Hypothetical protein TM1010; double-stranded beta- | 90.22 | |
| 2opk_A | 112 | Hypothetical protein; putative mannose-6-phosphate | 90.17 | |
| 3h7j_A | 243 | Bacilysin biosynthesis protein BACB; YWFC, bacilys | 89.83 | |
| 3s7i_A | 418 | Allergen ARA H 1, clone P41B; bicupin, vicilin, st | 89.77 | |
| 2q30_A | 110 | Uncharacterized protein; double-stranded beta-heli | 89.3 | |
| 4b29_A | 217 | Dimethylsulfoniopropionate lyase; hydrolase, dimet | 89.21 | |
| 2oa2_A | 148 | BH2720 protein; 10175341, structural genomics, joi | 89.15 | |
| 1vj2_A | 126 | Novel manganese-containing cupin TM1459; structura | 88.81 | |
| 2pa7_A | 141 | DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug | 88.71 | |
| 1fxz_A | 476 | Glycinin G1; proglycinin, legumin, SEED storage pr | 88.71 | |
| 1oi6_A | 205 | PCZA361.16; epimerase, vancomycin group antibiotic | 88.64 | |
| 2e9q_A | 459 | 11S globulin subunit beta; cucubitin, pumpkin SEED | 88.44 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 88.29 | |
| 2i45_A | 107 | Hypothetical protein; neisseria meningitidis cupin | 88.16 | |
| 1dzr_A | 183 | DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, | 88.09 | |
| 1juh_A | 350 | Quercetin 2,3-dioxygenase; cupin, glycoprotein, be | 87.92 | |
| 2pyt_A | 133 | Ethanolamine utilization protein EUTQ; structural | 87.87 | |
| 3bcw_A | 123 | Uncharacterized protein; structural genomics, join | 87.59 | |
| 3ryk_A | 205 | DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat | 87.36 | |
| 1y9q_A | 192 | Transcriptional regulator, HTH_3 family; transcrip | 87.2 | |
| 1upi_A | 225 | DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat | 86.99 | |
| 1vr3_A | 191 | Acireductone dioxygenase; 13543033, structural gen | 86.96 | |
| 1nxm_A | 197 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jell | 86.95 | |
| 3s7i_A | 418 | Allergen ARA H 1, clone P41B; bicupin, vicilin, st | 86.93 | |
| 2vpv_A | 166 | Protein MIF2, MIF2P; nucleus, mitosis, centromere, | 86.82 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 86.51 | |
| 1zrr_A | 179 | E-2/E-2' protein; nickel, cupin, beta helix, methi | 85.87 | |
| 1juh_A | 350 | Quercetin 2,3-dioxygenase; cupin, glycoprotein, be | 85.81 | |
| 2c0z_A | 216 | NOVW; isomerase, epimerase, antibiotic biosynthesi | 84.97 | |
| 2ozi_A | 98 | Hypothetical protein RPA4178; APC6210, putative pr | 84.18 | |
| 3es1_A | 172 | Cupin 2, conserved barrel domain protein; YP_00116 | 83.99 | |
| 1wlt_A | 196 | 176AA long hypothetical DTDP-4-dehydrorhamnose 3, | 83.62 | |
| 1sef_A | 274 | Conserved hypothetical protein; structural genomic | 83.22 | |
| 3qac_A | 465 | 11S globulin SEED storage protein; 11S SEED storag | 82.77 | |
| 4h7l_A | 157 | Uncharacterized protein; structural genomics, PSI- | 82.12 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 80.99 |
| >3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.2e-50 Score=399.38 Aligned_cols=245 Identities=39% Similarity=0.796 Sum_probs=209.3
Q ss_pred hhhcccCCcCcccCCCcccc--CCCCHHHHHHHhcCCCCCEEEecCCCcCcccCCCCHHHHHHHhCCceEEEc------c
Q 042108 160 LCANLEMKPEWLERDNIARK--KCISVEEFVSSFEEPNKPVLLEGCLDNWAALKKWDRDYLVNVCGDVRFAVG------P 231 (406)
Q Consensus 160 ~c~~~~~~~~~~~~~~I~r~--~~ls~e~F~~~y~~~~~PvIi~~~~~~Wpa~~~Wt~~~L~~~~gd~~v~v~------~ 231 (406)
+|..+++.+. ....+|+|+ +.+|+++|.++|+.+++||||+|++++|||+++|+++||++++|+.+|.++ .
T Consensus 32 ~~~~~~~~~~-~~~~~I~Ri~~~~lS~eeF~~~y~~~~~PvVi~g~~~~WpA~~~Wt~~yL~~~~G~~~V~v~~~~~~~~ 110 (336)
T 3k2o_A 32 YYESFSLSPA-AVADNVERADALQLSVEEFVERYERPYKPVVLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYS 110 (336)
T ss_dssp HHHHCCCCGG-GCCCCCCEEEGGGCCHHHHHHHTTTTTCCEEEESTTTTCTHHHHCSHHHHHHHSTTCEEEEEECTTSCE
T ss_pred hhhhhhhchh-hcCCCCCEecCCCCCHHHHHHHhhccCCCEEEeCCcCCChhHhhhhHHHHHHHhCCceEEEEecCCCce
Confidence 3455554332 146789999 579999999999999999999999999999999999999999999999986 4
Q ss_pred eecchHHHHHhhhccCCCCCeeecCccccc--ccCccccCCCCCCcChhhhhhhcCC-CCCCcceeEeccCCCCCcceec
Q 042108 232 VEMKLEEYFRYSDSVREERPLYLFDPKFAD--KVPTLGGEYEVPVYFREDLFSVLGN-ERPDYRWVIIGPAGSGSSFHMD 308 (406)
Q Consensus 232 ~~~~l~~f~~~~~~~~~~~~~Yl~d~~~~~--~~p~L~~d~~~P~~f~~d~~~~l~~-~rp~~~~l~iG~~gs~t~~H~D 308 (406)
+.|+|++|++|+.+..++.++||++..+.+ .+|+|.+||.+|++|.+|+|+.+++ .+++++|+|||++|++|++|+|
T Consensus 111 ~~m~~~~fl~~~~~~~~~~~lYL~d~~~~e~~~~p~L~~dy~~P~~f~~d~~~~~~~~~~p~~~~~~~G~~gs~t~~H~D 190 (336)
T 3k2o_A 111 VKMKMKYYIEYMESTRDDSPLYIFDSSYGEHPKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHID 190 (336)
T ss_dssp EEEEHHHHHHHHHHCCCSSCCCEEESCGGGSTTGGGGGGGCCCCGGGCCCGGGGGCTTTSCCCEEEEEECTTCEEEEECC
T ss_pred eeecHHHHHHHHHhcCCCCCceEecccccccccchhHHHhcCCCcccccchhhhcccccCCCceEEEECCCCccCCcccC
Confidence 789999999999988888899999988764 4899999999999999999988876 4889999999999999999999
Q ss_pred CCCCcceEEEEEeEEEEEEeCCCCCCCCcccCCCCCcccCCCchhhhhhhhhhhhhcC----CCCcEEEEEcCCCEEEeC
Q 042108 309 PNSTSAWNAIIKGSKKWILFPPDVVPPGVHPSSDGAEVACPVSIMEWFMNFYGATKNW----KKRPIECICKAGEVIFVP 384 (406)
Q Consensus 309 ~~~t~~~~~qi~G~K~w~L~pP~~~~~~l~p~~d~~~v~sp~~~~~w~~~~~p~~~~~----~~~~~~~vl~pGD~LfIP 384 (406)
+++|+||++||.|+|+|+||||++.. .+|+......-..+.+..+|+.+.||.++.. .+++++|+|+|||+||||
T Consensus 191 ~~~~~~~~~~v~G~K~~~L~pP~~~~-~ly~~~~~~~~~~~~~~~~w~~~~~P~~~~~~~p~~~~~~~~~l~pGd~l~iP 269 (336)
T 3k2o_A 191 PLGTSAWNALVQGHKRWCLFPTSTPR-ELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGETVFVP 269 (336)
T ss_dssp GGGCEEEEEEEESCEEEEEECTTSCH-HHHCCCHHHHGGGTTCHHHHHHHTGGGGGSTTSCGGGCCEEEEECTTCEEEEC
T ss_pred CCccceeeEEEeeeEEEEEeCCCcch-hcccCcccccCCCccchhhhhhhhCcchhhhcccccCceEEEEECCCCEEEeC
Confidence 99999999999999999999999865 5665321100011234568998899987532 246799999999999999
Q ss_pred CCCeeeeeecCccEEEeeeccC
Q 042108 385 NGWWHLVINLEESIAITQNYVS 406 (406)
Q Consensus 385 ~gWwH~V~nl~~sIavt~nFv~ 406 (406)
+||||+|.|+++||+||+||++
T Consensus 270 ~gw~H~v~~~~~sisv~~~f~~ 291 (336)
T 3k2o_A 270 GGWWHVVLNLDTTIAITQNFAS 291 (336)
T ss_dssp TTCEEEEEESSCEEEEEEEECC
T ss_pred CCCcEEEecCCCeEEEEcccCC
Confidence 9999999999999999999985
|
| >4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* | Back alignment and structure |
|---|
| >3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* | Back alignment and structure |
|---|
| >3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... | Back alignment and structure |
|---|
| >2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A | Back alignment and structure |
|---|
| >3k3o_A PHF8, PHD finger protein 8; histone demethylase, chromatin modification, methylated H3K9, mental retardation, metal-BI phosphoprotein, zinc-finger; HET: AKG; 2.10A {Homo sapiens} PDB: 3k3n_A* 4do0_A* 2wwu_A* | Back alignment and structure |
|---|
| >3kv9_A JMJC domain-containing histone demethylation protein 1D; jumonji domain lysine demethylase, metal-binding, zinc, zinc-finger; 2.29A {Homo sapiens} PDB: 3kva_A* 3kvb_A* 3u78_A* | Back alignment and structure |
|---|
| >3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A* | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 | Back alignment and structure |
|---|
| >2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} | Back alignment and structure |
|---|
| >4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2ypd_A Probable JMJC domain-containing histone demethyla PROT EIN 2C; oxidoreductase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2xxz_A Lysine-specific demethylase 6B; oxidoreductase, histone demethylation, oxygenase, chromatin modification; HET: 8XQ; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >3avr_A Lysine-specific demethylase 6A; cupin superfamily, TRI/dimethyllysine demethylase, oxidoredu structural protein complex; HET: M3L OGA EDO; 1.80A {Homo sapiens} PDB: 3avs_A* | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >3dxt_A JMJC domain-containing histone demethylation PROT; JMJD2D, histone demethylase, H3K9, jumonji domain-CONT protein 2D, oxidoreductase; 1.80A {Homo sapiens} PDB: 3dxu_A* 4hon_A* 4hoo_A 2w2i_A* | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >4ask_A Lysine-specific demethylase 6B; oxidoreductase, KDM6B, GSK-J1, inhibitor, lysine specific HI demethylase; HET: K0I; 1.86A {Homo sapiens} PDB: 2xue_A* 4eyu_A* 4ez4_A* 4ezh_A* | Back alignment and structure |
|---|
| >3opt_A DNA damage-responsive transcriptional repressor R; RPH1, histone demethylase, catalytic core, oxidoreductase; HET: DNA AKG; 2.20A {Saccharomyces cerevisiae} PDB: 3opw_A* | Back alignment and structure |
|---|
| >2ox0_A JMJC domain-containing histone demethylation PROT; double-stranded beta helix, demethylase, oxygenase, SGC, STR genomics, structural genomics consortium, oxidoreductase; HET: MLY ALY OGA; 1.95A {Homo sapiens} PDB: 2oq7_A* 2os2_A* 2ot7_A* 2oq6_A* 2vd7_A* 2ybk_A* 2ybp_A* 2ybs_A* 3njy_A* 3pdq_A* 3u4s_A* 2p5b_A* 2q8c_A* 2q8d_A* 2q8e_A* 2gp5_A* 2gp3_A* 2wwj_A* 2pxj_A* 2xml_A* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >4hfx_A Transcription elongation factor B polypeptide 3; structural genomics, PSI-biology, northeast structural genom consortium, NESG; 2.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} | Back alignment and structure |
|---|
| >1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A | Back alignment and structure |
|---|
| >3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A | Back alignment and structure |
|---|
| >3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} | Back alignment and structure |
|---|
| >3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} | Back alignment and structure |
|---|
| >3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A | Back alignment and structure |
|---|
| >1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} | Back alignment and structure |
|---|
| >1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A | Back alignment and structure |
|---|
| >2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 | Back alignment and structure |
|---|
| >2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} | Back alignment and structure |
|---|
| >3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* | Back alignment and structure |
|---|
| >1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 | Back alignment and structure |
|---|
| >3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* | Back alignment and structure |
|---|
| >1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} | Back alignment and structure |
|---|
| >2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} | Back alignment and structure |
|---|
| >2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A | Back alignment and structure |
|---|
| >3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 | Back alignment and structure |
|---|
| >3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} | Back alignment and structure |
|---|
| >1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* | Back alignment and structure |
|---|
| >3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A | Back alignment and structure |
|---|
| >3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A | Back alignment and structure |
|---|
| >3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A | Back alignment and structure |
|---|
| >3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A | Back alignment and structure |
|---|
| >3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} | Back alignment and structure |
|---|
| >2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A | Back alignment and structure |
|---|
| >3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, JOIN for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A | Back alignment and structure |
|---|
| >4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} | Back alignment and structure |
|---|
| >1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* | Back alignment and structure |
|---|
| >2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A | Back alignment and structure |
|---|
| >3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19 | Back alignment and structure |
|---|
| >4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} | Back alignment and structure |
|---|
| >3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} | Back alignment and structure |
|---|
| >3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A | Back alignment and structure |
|---|
| >3bb6_A Uncharacterized protein YEAR; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Escherichia coli} SCOP: b.82.2.13 | Back alignment and structure |
|---|
| >1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A | Back alignment and structure |
|---|
| >3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* | Back alignment and structure |
|---|
| >3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} | Back alignment and structure |
|---|
| >1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A | Back alignment and structure |
|---|
| >1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A* | Back alignment and structure |
|---|
| >2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A* | Back alignment and structure |
|---|
| >3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* | Back alignment and structure |
|---|
| >2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* | Back alignment and structure |
|---|
| >3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A | Back alignment and structure |
|---|
| >2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} | Back alignment and structure |
|---|
| >2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 | Back alignment and structure |
|---|
| >2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* | Back alignment and structure |
|---|
| >1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A | Back alignment and structure |
|---|
| >1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A | Back alignment and structure |
|---|
| >2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B | Back alignment and structure |
|---|
| >2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >1dzr_A DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 3\,5-hexulose epimerase; 2.17A {Salmonella typhimurium} SCOP: b.82.1.1 PDB: 1dzt_A* | Back alignment and structure |
|---|
| >1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* | Back alignment and structure |
|---|
| >2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 | Back alignment and structure |
|---|
| >3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >3ryk_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, STRU genomics, infectious diseases; HET: TYD; 1.63A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 | Back alignment and structure |
|---|
| >1upi_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} SCOP: b.82.1.1 PDB: 2ixc_A* 1pm7_A* | Back alignment and structure |
|---|
| >1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 | Back alignment and structure |
|---|
| >1nxm_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} SCOP: b.82.1.1 PDB: 1nyw_A* 1nzc_A* 2ixl_A* | Back alignment and structure |
|---|
| >3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A | Back alignment and structure |
|---|
| >2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A | Back alignment and structure |
|---|
| >1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A | Back alignment and structure |
|---|
| >1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* | Back alignment and structure |
|---|
| >2c0z_A NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} SCOP: b.82.1.1 | Back alignment and structure |
|---|
| >3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >1wlt_A 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} SCOP: b.82.1.1 PDB: 2b9u_A | Back alignment and structure |
|---|
| >1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} | Back alignment and structure |
|---|
| >4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 406 | ||||
| d1vrba1 | 319 | b.82.2.11 (A:8-326) Putative asparaginyl hydroxyla | 1e-30 | |
| d1h2ka_ | 335 | b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibit | 3e-30 | |
| d1p22a1 | 118 | a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b | 2e-06 | |
| d1fs1a1 | 41 | a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ | 1e-05 | |
| d2ovrb1 | 102 | a.158.1.1 (B:2263-2364) F-box/WD repeat-containing | 1e-05 | |
| d1nexb1 | 100 | a.158.1.1 (B:270-369) Cdc4 F-box and linker domain | 4e-04 |
| >d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} Length = 319 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Double-stranded beta-helix superfamily: Clavaminate synthase-like family: Asparaginyl hydroxylase-like domain: Putative asparaginyl hydroxylase YxbC species: Bacillus subtilis [TaxId: 1423]
Score = 117 bits (294), Expect = 1e-30
Identities = 31/231 (13%), Positives = 68/231 (29%), Gaps = 11/231 (4%)
Query: 182 ISVEEFVSSFEEPNKPVLLEGCLDNWAALKKWDRDYL------VNVCGDVRFAVGPVEMK 235
+++ EF+ + KP++ G ++ + ++ +++ + + +E
Sbjct: 9 VTMSEFLEEYWP-VKPLVARGEVERFTSIPGFEKVRTLENVLAIYNNPVMVVGDAVIEES 67
Query: 236 LEEYFRYSDSVREERPLYLFDPKFADKVPTLGGEYEVPVYFREDLFSVLGNERPDYRWVI 295
R+ S E Y L + L V
Sbjct: 68 EGITDRFLVSPAEALEWYEKGAALEFDFTDLFIPQVRRWIEKLKAELRLPAGTSSKAIVY 127
Query: 296 IGPAGSGSSFHMDPNSTSAWNAIIKGSKKWILFPPDVVPPGVHPSSDGAEVACPVSIMEW 355
G G H D + I+G K W L + V + P + +
Sbjct: 128 AAKNGGGFKAHFDAYTN--LIFQIQGEKTWKLAKNENVSNPMQHYDLSEAPYYPDDLQSY 185
Query: 356 FMNFYGATKNWKKRPIECICKAGEVIFVPNGWWHLVINLEESIAITQNYVS 406
+ K G ++++P G WH + + ++A+ +
Sbjct: 186 WKGDP--PKEDLPDAEIVNLTPGTMLYLPRGLWHSTKSDQATLALNITFGQ 234
|
| >d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} Length = 335 | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 406 | |||
| d1h2ka_ | 335 | Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum | 100.0 | |
| d1vrba1 | 319 | Putative asparaginyl hydroxylase YxbC {Bacillus su | 99.97 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 99.37 | |
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 99.22 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 99.14 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 99.02 | |
| d1lr5a_ | 160 | Auxin binding protein {Maize (Zea mays) [TaxId: 45 | 97.43 | |
| d1fxza2 | 174 | Seed storage 7S protein {Soybean (Glycine max), pr | 97.26 | |
| g1dgw.1 | 168 | Seed storage 7S protein {Jack bean (Canavalia ensi | 97.01 | |
| d1od5a2 | 173 | Seed storage 7S protein {Soybean (Glycine max), gl | 96.96 | |
| d2phla2 | 162 | Seed storage 7S protein {French bean (Phaseolus vu | 96.95 | |
| d1x82a_ | 190 | Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc | 96.81 | |
| d1uika2 | 185 | Seed storage 7S protein {Soybean (Glycine max), be | 96.75 | |
| d1j58a_ | 372 | Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil | 96.72 | |
| d2b8ma1 | 108 | Hypothetical protein MJ0764 {Archaeon Methanococcu | 96.68 | |
| d2et1a1 | 201 | Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | 96.63 | |
| d1j58a_ | 372 | Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil | 96.62 | |
| d1zvfa1 | 175 | 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea | 96.41 | |
| d1o4ta_ | 115 | Hypothetical protein TM1287 {Thermotoga maritima [ | 96.4 | |
| d1v70a_ | 105 | Hypothetical protein TTHA0104 {Thermus thermophilu | 96.25 | |
| d1yhfa1 | 112 | Hypothetical protein SPy1581 {Streptococcus pyogen | 95.96 | |
| d2d40a1 | 308 | Gentisate 1,2-dioxygenase {Escherichia coli [TaxId | 95.81 | |
| d1uija1 | 170 | Seed storage 7S protein {Soybean (Glycine max), be | 95.81 | |
| d1dgwa_ | 178 | Seed storage 7S protein {Jack bean (Canavalia ensi | 95.46 | |
| d2f4pa1 | 134 | Hypothetical protein TM1010 {Thermotoga maritima [ | 95.41 | |
| d1vj2a_ | 114 | Hypothetical protein TM1459 {Thermotoga maritima [ | 95.38 | |
| d2phda1 | 351 | Gentisate 1,2-dioxygenase {Pseudaminobacter salicy | 95.21 | |
| d1uika1 | 203 | Seed storage 7S protein {Soybean (Glycine max), be | 95.13 | |
| d2d40a1 | 308 | Gentisate 1,2-dioxygenase {Escherichia coli [TaxId | 94.85 | |
| d2pa7a1 | 135 | dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane | 94.85 | |
| d1yfua1 | 174 | 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m | 94.81 | |
| d1y3ta1 | 330 | Hypothetical protein YxaG {Bacillus subtilis [TaxI | 94.8 | |
| d3bu7a1 | 355 | Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ | 94.68 | |
| d1juha_ | 348 | Quercetin 2,3-dioxygenase {Aspergillus japonicus [ | 94.44 | |
| d2phda1 | 351 | Gentisate 1,2-dioxygenase {Pseudaminobacter salicy | 94.35 | |
| d1y3ta1 | 330 | Hypothetical protein YxaG {Bacillus subtilis [TaxI | 94.17 | |
| d3bu7a1 | 355 | Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ | 93.6 | |
| d1wlta1 | 176 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo | 93.46 | |
| d2bnma2 | 122 | Hydroxypropylphosphonic acid epoxidase Fom4, C-ter | 93.05 | |
| d2pyta1 | 128 | Ethanolamine utilization protein EutQ {Salmonella | 92.16 | |
| d3elna1 | 186 | Cysteine dioxygenase type I {Rattus norvegicus [Ta | 91.51 | |
| d2ixca1 | 198 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobac | 91.43 | |
| d1y9qa2 | 99 | Probable transcriptional regulator VC1968, C-termi | 90.87 | |
| d1ep0a_ | 183 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo | 90.63 | |
| d2gm6a1 | 192 | Cysteine dioxygenase type I {Ralstonia eutropha [T | 90.48 | |
| d3bb6a1 | 109 | Uncharacterized protein YeaR {Escherichia coli [Ta | 89.86 | |
| d1sefa_ | 250 | Hypothetical protein EF2996 {Enterococcus faecalis | 89.85 | |
| d2phla1 | 200 | Seed storage 7S protein {French bean (Phaseolus vu | 89.0 | |
| d1juha_ | 348 | Quercetin 2,3-dioxygenase {Aspergillus japonicus [ | 88.76 | |
| d1dzra_ | 183 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmone | 88.75 | |
| d1sfna_ | 245 | Hypothetical protein DR1152 {Deinococcus radiodura | 86.99 | |
| d1nxma_ | 194 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Strepto | 86.64 | |
| d1sq4a_ | 273 | Glyoxylate-induced protein PA1140 {Pseudomonas aer | 85.44 | |
| d1rc6a_ | 253 | Hypothetical protein YlbA {Escherichia coli [TaxId | 84.84 | |
| d1oi6a_ | 202 | dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amyc | 83.12 | |
| d2ixha1 | 184 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudom | 82.62 | |
| d3dl3a1 | 96 | Tellurite resistance protein B, TehB {Vibrio fisch | 82.47 | |
| d2c0za1 | 190 | Novobiocin biosynthesis protein NovW {Streptomyces | 80.84 |
| >d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Double-stranded beta-helix superfamily: Clavaminate synthase-like family: Hypoxia-inducible factor HIF ihhibitor (FIH1) domain: Hypoxia-inducible factor HIF ihhibitor (FIH1) species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=9.5e-39 Score=313.33 Aligned_cols=225 Identities=25% Similarity=0.337 Sum_probs=172.4
Q ss_pred cCCCccccCCCCHHHHHHHhcCCCCCEEEecCCCcCcccCCCCHHHHHHHhCCceEEEcc--------------------
Q 042108 172 ERDNIARKKCISVEEFVSSFEEPNKPVLLEGCLDNWAALKKWDRDYLVNVCGDVRFAVGP-------------------- 231 (406)
Q Consensus 172 ~~~~I~r~~~ls~e~F~~~y~~~~~PvIi~~~~~~Wpa~~~Wt~~~L~~~~gd~~v~v~~-------------------- 231 (406)
....|+|++..+. +.++|+++++||||+|++++|||+ +||.|||++++|+.+|.|+.
T Consensus 24 ~~~~vpr~~~~~~--~~e~y~~~~~PvVi~g~~~~Wpa~-kWt~dyL~~~~Gd~~V~v~~~~~~~~~~~~~~~~~~~~~~ 100 (335)
T d1h2ka_ 24 PTRPIPRLSQSDP--RAEELIENEEPVVLTDTNLVYPAL-KWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNF 100 (335)
T ss_dssp CEEECCEECTTCH--HHHHHHHTTCCEEESCCCTTGGGG-GCCHHHHHHHSCSCCEEEEEESSSBCCCCCGGGGGGGTTC
T ss_pred CCcccCccCCCCc--CHHHHhcCCCCEEEeCCCCCCCcc-cCCHHHHHHhhCCceEEEEEecCccccccccccccccccc
Confidence 3467889987766 557899999999999999999998 69999999999999988741
Q ss_pred ------eecchHHHHHhhhcc---CCCCCeeecCcccccccCccccCCCCCCcCh-hhhhhhcCCCCCCcceeEeccCCC
Q 042108 232 ------VEMKLEEYFRYSDSV---REERPLYLFDPKFADKVPTLGGEYEVPVYFR-EDLFSVLGNERPDYRWVIIGPAGS 301 (406)
Q Consensus 232 ------~~~~l~~f~~~~~~~---~~~~~~Yl~d~~~~~~~p~L~~d~~~P~~f~-~d~~~~l~~~rp~~~~l~iG~~gs 301 (406)
..|++++|++++.+. .....+|+++.......+.+..++..|..+- ..........+....+||||++|+
T Consensus 101 ~~~~~~~~~~~~ef~~~~~~~~~~~~~~~~yl~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~lwiG~~gs 180 (335)
T d1h2ka_ 101 KPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGN 180 (335)
T ss_dssp CCSEEEEEECHHHHHHHHHHHHHTTCCCEEEEEEECCTTSCHHHHHHHHTSCHHHHHHHHHHHTCCCEEECEEEEECTTC
T ss_pred ccccchhcccHHHHHHHHHhccccCCCcceEhhhccccccChhhhcccccCcccccchhhccccccCCcceEEEEcCCCC
Confidence 468999999987542 2345678876544444445555665554322 222222222345567899999999
Q ss_pred CCcceecCCCCcceEEEEEeEEEEEEeCCCCCCCCcccCCC--CCcccCCCchhhhhhhhhhhhhcCCCCcEEEEEcCCC
Q 042108 302 GSSFHMDPNSTSAWNAIIKGSKKWILFPPDVVPPGVHPSSD--GAEVACPVSIMEWFMNFYGATKNWKKRPIECICKAGE 379 (406)
Q Consensus 302 ~t~~H~D~~~t~~~~~qi~G~K~w~L~pP~~~~~~l~p~~d--~~~v~sp~~~~~w~~~~~p~~~~~~~~~~~~vl~pGD 379 (406)
+|++|+|+++ ||++||+|+|+|+||||++.+ .+|+... .....+.++....+...+|.+++ +++++|+|+|||
T Consensus 181 ~t~~H~D~~~--~~~~q~~G~K~~~l~~p~~~~-~~~~~~~~~~~~~~s~~d~~~~d~~~~p~~~~--~~~~~~~l~pGd 255 (335)
T d1h2ka_ 181 VTPAHYDEQQ--NFFAQIKGYKRCILFPPDQFE-CLYPYPVHHPCDRQSQVDFDNPDYERFPNFQN--VVGYETVVGPGD 255 (335)
T ss_dssp EEEEECCSEE--EEEEEEESCEEEEEECGGGHH-HHCBCCTTSTTTTBBCCCTTSCCTTTCGGGGG--CCEEEEEECTTC
T ss_pred CCcccccccc--ceEEEeccceEEEEecccccc-ccccccccCCCCcceeccccCcchhhccchhc--CCceEEEECCCC
Confidence 9999999986 999999999999999999876 5665432 23455677777777888998876 467999999999
Q ss_pred EEEeCCCCeeeeeecCc-cEEEeeec
Q 042108 380 VIFVPNGWWHLVINLEE-SIAITQNY 404 (406)
Q Consensus 380 ~LfIP~gWwH~V~nl~~-sIavt~nF 404 (406)
+||||+||||+|+|+++ +++|+.||
T Consensus 256 ~L~iP~~w~H~V~~~~~~~~sisvn~ 281 (335)
T d1h2ka_ 256 VLYIPMYWWHHIESLLNGGITITVNF 281 (335)
T ss_dssp EEEECTTCEEEEEECTTSCCEEEEEE
T ss_pred EEeeCCCCeEEEEEcCCCCeEEEEEe
Confidence 99999999999999965 66666665
|
| >d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} | Back information, alignment and structure |
|---|
| >d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} | Back information, alignment and structure |
|---|
| >d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} | Back information, alignment and structure |
|---|
| >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} | Back information, alignment and structure |
|---|
| >d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} | Back information, alignment and structure |
|---|
| >d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2gm6a1 b.82.1.19 (A:11-202) Cysteine dioxygenase type I {Ralstonia eutropha [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d3bb6a1 b.82.2.13 (A:1-109) Uncharacterized protein YeaR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} | Back information, alignment and structure |
|---|
| >d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d3dl3a1 b.82.2.13 (A:5-100) Tellurite resistance protein B, TehB {Vibrio fischeri [TaxId: 668]} | Back information, alignment and structure |
|---|
| >d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]} | Back information, alignment and structure |
|---|