Citrus Sinensis ID: 042181
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 417 | ||||||
| 224072422 | 509 | predicted protein [Populus trichocarpa] | 0.637 | 0.522 | 0.608 | 3e-87 | |
| 255583910 | 537 | protease m50 membrane-bound transcriptio | 0.654 | 0.508 | 0.578 | 1e-86 | |
| 356560965 | 539 | PREDICTED: membrane-bound transcription | 0.729 | 0.564 | 0.503 | 5e-80 | |
| 357517351 | 591 | Membrane-bound transcription factor site | 0.707 | 0.499 | 0.508 | 3e-78 | |
| 388510590 | 537 | unknown [Medicago truncatula] | 0.707 | 0.549 | 0.508 | 5e-78 | |
| 238480863 | 374 | Peptidase M50 family protein [Arabidopsi | 0.690 | 0.770 | 0.503 | 1e-75 | |
| 449456427 | 541 | PREDICTED: membrane-bound transcription | 0.693 | 0.534 | 0.478 | 5e-70 | |
| 449497430 | 447 | PREDICTED: LOW QUALITY PROTEIN: membrane | 0.693 | 0.646 | 0.478 | 3e-69 | |
| 238480861 | 488 | Peptidase M50 family protein [Arabidopsi | 0.630 | 0.538 | 0.461 | 2e-65 | |
| 297597298 | 331 | Os01g0654200 [Oryza sativa Japonica Grou | 0.736 | 0.927 | 0.385 | 5e-57 |
| >gi|224072422|ref|XP_002303727.1| predicted protein [Populus trichocarpa] gi|222841159|gb|EEE78706.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 328 bits (841), Expect = 3e-87, Method: Compositional matrix adjust.
Identities = 163/268 (60%), Positives = 198/268 (73%), Gaps = 2/268 (0%)
Query: 16 MVLDVPSTSPLSGYLSPGDVIVSLDGIHIHNEQDWMEVAALLDKYTPQNSSHSK-YPGLR 74
+VLDVPSTSPLSGYLSPGD IVSLDG IHN+Q+WME AL+D+ T Q+S+ SK + GL
Sbjct: 224 VVLDVPSTSPLSGYLSPGDAIVSLDGKRIHNDQEWMETTALIDERTLQSSNLSKSFEGLA 283
Query: 75 AADGRKGYCVSNYMIEESKKIQLLDNQSACPNDFTAFVTVQCFDISISVNVSSEGDQLNK 134
KGYCV +IEES ++ ++NQSACP+D T FV VQCF+ S S NV+ E D +++
Sbjct: 284 IVHQMKGYCVPTSVIEESNEMLFIENQSACPDDLTEFVAVQCFNSSKSDNVNIE-DGISQ 342
Query: 135 LENVYCLNANDIVKLKKCGDGWVTSSTNGSHCVCSKEESCLTPVQLPGLAWVEITYSRPY 194
+ +CLNA D+VKL KCGDGWVT T GS C+CS+EE CL PV LPG WVEIT++ PY
Sbjct: 343 RQRRHCLNAKDVVKLNKCGDGWVTEITKGSSCLCSQEEYCLNPVPLPGSIWVEITFASPY 402
Query: 195 SLECKQLSRSSVSDTRTTDFTDPHCGGTFVFFGDVIFMAQSVSLTQYQPRWASSFGAYLP 254
S EC QL R+S + +DF++ CGGTFVF GD+I MA SV LT YQPRW SF A+LP
Sbjct: 403 SPECLQLGRNSFPASGASDFSEHKCGGTFVFVGDLISMAHSVRLTAYQPRWGFSFSAHLP 462
Query: 255 NILRKSLICIFHVSLTLALLNSLPAYFL 282
NIL KSL+ FHVSLTLALLNSLP +
Sbjct: 463 NILEKSLMYTFHVSLTLALLNSLPFFMF 490
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255583910|ref|XP_002532703.1| protease m50 membrane-bound transcription factor site 2 protease, putative [Ricinus communis] gi|223527549|gb|EEF29670.1| protease m50 membrane-bound transcription factor site 2 protease, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356560965|ref|XP_003548756.1| PREDICTED: membrane-bound transcription factor site-2 protease-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357517351|ref|XP_003628964.1| Membrane-bound transcription factor site-2 protease [Medicago truncatula] gi|355522986|gb|AET03440.1| Membrane-bound transcription factor site-2 protease [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388510590|gb|AFK43361.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|238480863|ref|NP_001154256.1| Peptidase M50 family protein [Arabidopsis thaliana] gi|332658904|gb|AEE84304.1| Peptidase M50 family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449456427|ref|XP_004145951.1| PREDICTED: membrane-bound transcription factor site-2 protease-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449497430|ref|XP_004160399.1| PREDICTED: LOW QUALITY PROTEIN: membrane-bound transcription factor site-2 protease-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|238480861|ref|NP_001154255.1| Peptidase M50 family protein [Arabidopsis thaliana] gi|332658903|gb|AEE84303.1| Peptidase M50 family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297597298|ref|NP_001043746.2| Os01g0654200 [Oryza sativa Japonica Group] gi|55296501|dbj|BAD68697.1| peptidase M50 family protein-like [Oryza sativa Japonica Group] gi|255673514|dbj|BAF05660.2| Os01g0654200 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 417 | ||||||
| TAIR|locus:2120352 | 488 | AT4G20310 [Arabidopsis thalian | 0.450 | 0.385 | 0.495 | 2.3e-66 | |
| UNIPROTKB|K7GQR3 | 448 | K7GQR3 "Uncharacterized protei | 0.148 | 0.138 | 0.353 | 8.2e-05 | |
| UNIPROTKB|F1SQ07 | 458 | F1SQ07 "Uncharacterized protei | 0.148 | 0.135 | 0.353 | 8.7e-05 | |
| UNIPROTKB|O54862 | 510 | MBTPS2 "Membrane-bound transcr | 0.148 | 0.121 | 0.353 | 9.2e-05 | |
| RGD|1566171 | 517 | Mbtps2 "membrane-bound transcr | 0.148 | 0.119 | 0.353 | 9.5e-05 | |
| ZFIN|ZDB-GENE-030131-6598 | 494 | mbtps2 "membrane-bound transcr | 0.148 | 0.125 | 0.369 | 0.0001 | |
| UNIPROTKB|E1BR82 | 520 | E1BR82 "Uncharacterized protei | 0.119 | 0.096 | 0.384 | 0.00011 | |
| UNIPROTKB|E2RJ13 | 518 | MBTPS2 "Uncharacterized protei | 0.148 | 0.119 | 0.353 | 0.00012 | |
| UNIPROTKB|O43462 | 519 | MBTPS2 "Membrane-bound transcr | 0.148 | 0.119 | 0.353 | 0.00012 | |
| UNIPROTKB|Q5RAC8 | 521 | MBTPS2 "Membrane-bound transcr | 0.148 | 0.119 | 0.353 | 0.00012 |
| TAIR|locus:2120352 AT4G20310 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 475 (172.3 bits), Expect = 2.3e-66, Sum P(2) = 2.3e-66
Identities = 101/204 (49%), Positives = 129/204 (63%)
Query: 1 MPLILFPFYKQCEGTMVLDVPSTSPLSGYLSPGDVIVSLDGIHIHNEQDWMEVAALLDKY 60
+P++L PFYK E V+DVPS SPL GYLSPGDVIVSLDGI +H +W+E+AA+LDK
Sbjct: 196 LPVMLSPFYKHGESLTVVDVPSVSPLFGYLSPGDVIVSLDGIQVHKPSEWLELAAILDKE 255
Query: 61 TPQNSSHSKY-PGLRAADGRKGYCVSNYMIEESKKIQLLDNQSACPNDFTAFVTVQCFDI 119
+ S+ S Y G R KGYCV +IEE K ++++NQ CP D TAF T+ C +
Sbjct: 256 NSKTSNGSLYLGGSRRFHHGKGYCVPISLIEEGYKGKMVENQFVCPGDLTAFRTMPCSNA 315
Query: 120 SISVNVSSEGDQLNKLENVYCLNANDIVKLKKCGDGWVTSST--NGSHCVCSKEESCLTP 177
+I VS CL+A DIVKL+KCGDGWVT+S N S CVC + + CL
Sbjct: 316 AIR-EVS------------VCLDAKDIVKLQKCGDGWVTTSDTDNQSDCVCPQGDLCLQA 362
Query: 178 VQLPGLAWVEITYSRPYSLECKQL 201
+Q PG+ W EITY R S +C +L
Sbjct: 363 MQSPGVLWTEITYKRTSSQDCSRL 386
|
|
| UNIPROTKB|K7GQR3 K7GQR3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SQ07 F1SQ07 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O54862 MBTPS2 "Membrane-bound transcription factor site-2 protease" [Cricetulus griseus (taxid:10029)] | Back alignment and assigned GO terms |
|---|
| RGD|1566171 Mbtps2 "membrane-bound transcription factor peptidase, site 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-6598 mbtps2 "membrane-bound transcription factor protease, site 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BR82 E1BR82 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RJ13 MBTPS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O43462 MBTPS2 "Membrane-bound transcription factor site-2 protease" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5RAC8 MBTPS2 "Membrane-bound transcription factor site-2 protease" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pg.C_LG_III001312 | hypothetical protein (509 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 417 | |||
| cd00987 | 90 | cd00987, PDZ_serine_protease, PDZ domain of tryspi | 0.001 |
| >gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis | Back alignment and domain information |
|---|
Score = 37.6 bits (88), Expect = 0.001
Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 6/52 (11%)
Query: 13 EGTMVLDVPSTSP--LSGYLSPGDVIVSLDGIHIHNEQDWMEVAALLDKYTP 62
+G +V V SP +G L PGDVI++++G + + D L + P
Sbjct: 24 KGVLVASVDPGSPAAKAG-LKPGDVILAVNGKPVKSVADLRRA---LAELKP 71
|
May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins. Length = 90 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 417 | |||
| KOG2921 | 484 | consensus Intramembrane metalloprotease (sterol-re | 100.0 | |
| KOG2921 | 484 | consensus Intramembrane metalloprotease (sterol-re | 99.51 | |
| TIGR00054 | 420 | RIP metalloprotease RseP. A model that detects fra | 98.49 | |
| PF13180 | 82 | PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ | 98.31 | |
| cd00986 | 79 | PDZ_LON_protease PDZ domain of ATP-dependent LON s | 98.31 | |
| cd00991 | 79 | PDZ_archaeal_metalloprotease PDZ domain of archaea | 98.24 | |
| cd00136 | 70 | PDZ PDZ domain, also called DHR (Dlg homologous re | 98.06 | |
| cd00987 | 90 | PDZ_serine_protease PDZ domain of tryspin-like ser | 98.03 | |
| cd00992 | 82 | PDZ_signaling PDZ domain found in a variety of Eum | 97.95 | |
| cd00989 | 79 | PDZ_metalloprotease PDZ domain of bacterial and pl | 97.94 | |
| cd00990 | 80 | PDZ_glycyl_aminopeptidase PDZ domain associated wi | 97.9 | |
| cd00988 | 85 | PDZ_CTP_protease PDZ domain of C-terminal processi | 97.84 | |
| smart00228 | 85 | PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als | 97.53 | |
| cd06162 | 277 | S2P-M50_PDZ_SREBP Sterol regulatory element-bindin | 97.41 | |
| TIGR01713 | 259 | typeII_sec_gspC general secretion pathway protein | 97.38 | |
| PF02163 | 192 | Peptidase_M50: Peptidase family M50; InterPro: IPR | 97.34 | |
| PRK10779 | 449 | zinc metallopeptidase RseP; Provisional | 97.32 | |
| PF00595 | 81 | PDZ: PDZ domain (Also known as DHR or GLGF) Coordi | 97.3 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 97.27 | |
| TIGR02038 | 351 | protease_degS periplasmic serine pepetdase DegS. T | 97.25 | |
| PRK10898 | 353 | serine endoprotease; Provisional | 97.25 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 97.22 | |
| PRK10139 | 455 | serine endoprotease; Provisional | 97.18 | |
| PRK10139 | 455 | serine endoprotease; Provisional | 97.13 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 97.12 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 97.1 | |
| cd05709 | 180 | S2P-M50 Site-2 protease (S2P) class of zinc metall | 96.92 | |
| KOG3553 | 124 | consensus Tax interaction protein TIP1 [Cell wall/ | 96.85 | |
| PRK10779 | 449 | zinc metallopeptidase RseP; Provisional | 96.85 | |
| COG0265 | 347 | DegQ Trypsin-like serine proteases, typically peri | 96.7 | |
| TIGR00054 | 420 | RIP metalloprotease RseP. A model that detects fra | 96.69 | |
| TIGR00225 | 334 | prc C-terminal peptidase (prc). A C-terminal pepti | 96.63 | |
| PLN00049 | 389 | carboxyl-terminal processing protease; Provisional | 96.54 | |
| TIGR02860 | 402 | spore_IV_B stage IV sporulation protein B. SpoIVB, | 96.53 | |
| PF12812 | 78 | PDZ_1: PDZ-like domain | 96.41 | |
| cd06158 | 181 | S2P-M50_like_1 Uncharacterized homologs of Site-2 | 96.23 | |
| cd06163 | 182 | S2P-M50_PDZ_RseP-like RseP-like Site-2 proteases ( | 96.18 | |
| TIGR03279 | 433 | cyano_FeS_chp putative FeS-containing Cyanobacteri | 96.12 | |
| PF14685 | 88 | Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 | 96.06 | |
| COG0750 | 375 | Predicted membrane-associated Zn-dependent proteas | 95.88 | |
| cd06164 | 227 | S2P-M50_SpoIVFB_CBS SpoIVFB Site-2 protease (S2P), | 95.45 | |
| cd06161 | 208 | S2P-M50_SpoIVFB SpoIVFB Site-2 protease (S2P), a z | 95.33 | |
| COG3480 | 342 | SdrC Predicted secreted protein containing a PDZ d | 95.24 | |
| COG0793 | 406 | Prc Periplasmic protease [Cell envelope biogenesis | 95.22 | |
| cd06159 | 263 | S2P-M50_PDZ_Arch Uncharacterized Archaeal homologs | 95.01 | |
| PF04495 | 138 | GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: | 94.75 | |
| KOG1320 | 473 | consensus Serine protease [Posttranslational modif | 94.52 | |
| COG1994 | 230 | SpoIVFB Zn-dependent proteases [General function p | 93.88 | |
| KOG3580 | 1027 | consensus Tight junction proteins [Signal transduc | 93.55 | |
| PRK11186 | 667 | carboxy-terminal protease; Provisional | 93.41 | |
| cd06160 | 183 | S2P-M50_like_2 Uncharacterized homologs of Site-2 | 92.99 | |
| KOG3552 | 1298 | consensus FERM domain protein FRM-8 [General funct | 91.2 | |
| COG3975 | 558 | Predicted protease with the C-terminal PDZ domain | 89.81 | |
| PRK09681 | 276 | putative type II secretion protein GspC; Provision | 87.7 | |
| KOG3532 | 1051 | consensus Predicted protein kinase [General functi | 87.27 | |
| KOG1421 | 955 | consensus Predicted signaling-associated protein ( | 84.94 | |
| KOG3209 | 984 | consensus WW domain-containing protein [General fu | 83.89 | |
| KOG3129 | 231 | consensus 26S proteasome regulatory complex, subun | 83.76 |
| >KOG2921 consensus Intramembrane metalloprotease (sterol-regulatory element-binding protein (SREBP) protease) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.3e-45 Score=370.60 Aligned_cols=260 Identities=27% Similarity=0.373 Sum_probs=220.1
Q ss_pred CCcccccceeeCCceEEEEeCCCCCCCC--CCCCCCeEEeeCCeecCChhhHHHHHHhhcccCCCCCCCCCCCCccccCC
Q 042181 1 MPLILFPFYKQCEGTMVLDVPSTSPLSG--YLSPGDVIVSLDGIHIHNEQDWMEVAALLDKYTPQNSSHSKYPGLRAADG 78 (417)
Q Consensus 1 LP~lLsP~Y~~g~Gv~V~~V~~~SPl~g--gL~~GDvI~sINgc~V~~~~dW~~cL~~~~~~~~~~~~~s~~~g~~~~~~ 78 (417)
+|++|+|+|.+|+||.|++|+..||+.| ||++||+|+++|||||++++||.+|+.. ..++
T Consensus 208 lpViLsPfya~g~gV~Vtev~~~Spl~gprGL~vgdvitsldgcpV~~v~dW~ecl~t------------------sl~~ 269 (484)
T KOG2921|consen 208 LPVILSPFYAHGEGVTVTEVPSVSPLFGPRGLSVGDVITSLDGCPVHKVSDWLECLAT------------------SLDK 269 (484)
T ss_pred hhHhhchhhhcCceEEEEeccccCCCcCcccCCccceEEecCCcccCCHHHHHHHHHh------------------hccc
Confidence 6999999999999999999999999999 8999999999999999999999999953 2578
Q ss_pred CceeeecchhHhhhhhhh--ccCCccCCCCCcCccceecceeccccccccccccccccccccccccccccccccc-cCCC
Q 042181 79 RKGYCVSNYMIEESKKIQ--LLDNQSACPNDFTAFVTVQCFDISISVNVSSEGDQLNKLENVYCLNANDIVKLKK-CGDG 155 (417)
Q Consensus 79 ~~GYCVp~s~ides~~~~--~~dg~~~CCd~~ta~~s~lCF~~~~l~~~~~e~~~~~~~~~~~CL~aR~vve~~~-C~~~ 155 (417)
++||||+++.+++...+. .+||+..|||+.+-+..+.||.+. ++ + ...++.||+||.+.|... |++.
T Consensus 270 ~ngycvsas~vq~~sa~~h~~~dg~~~Ccde~n~t~~~vcf~ve--n~--~------n~p~h~clnar~~le~~~~~r~~ 339 (484)
T KOG2921|consen 270 ENGYCVSASLVQGGSAFRHFTHDGKGYCCDESNITEGYVCFMVE--NQ--F------NCPGHDCLNARTMLESNAAIREV 339 (484)
T ss_pred CCCeeecHHHHhccchhhhccccCceEecCCcCCccceeEEEEe--cc--c------CCCCccchHhHhhhhcccccccc
Confidence 999999999999888554 469999999999977779999875 22 1 134589999999998766 5542
Q ss_pred CccccCCCCCCCCCCCCeeeeeeeCCCceEEEEEEecCCchhhhhccCCCcCCCCCCCCCCCCCCceEEEeechhhheee
Q 042181 156 WVTSSTNGSHCVCSKEESCLTPVQLPGLAWVEITYSRPYSLECKQLSRSSVSDTRTTDFTDPHCGGTFVFFGDVIFMAQS 235 (417)
Q Consensus 156 w~~~~~~~s~C~C~~~~~Cv~P~l~~~~~lv~I~~~Rp~s~~~~~~~~~s~~~~~~~~f~~~~~~~~vLFvG~~~eL~~s 235 (417)
+.| -++ .|+.|.+..+++|+.. +++ +|.+- +..+++|+|+|+|+.++
T Consensus 340 --------~vc--~~g-kcI~kl~~~htr~vt~--k~~--------~n~se------------p~~p~~yvahp~~~~~t 386 (484)
T KOG2921|consen 340 --------SVC--LDG-KCIVKLQKCHTRWVTT--KDT--------DNQSE------------PVCPQVYVAHPQEKICT 386 (484)
T ss_pred --------ccc--cCC-ceeeeehhccceEEEE--ecc--------ccCCC------------CCCCeeecCCcceeEEE
Confidence 565 555 9999999999996654 454 33222 46699999999999999
Q ss_pred EeecccccCCCcccCCchHHHHHHHHHHHHHHHHHHHHHccccccccchHHHHHHHHHH-hcccch--hcccccccccee
Q 042181 236 VSLTQYQPRWASSFGAYLPNILRKSLICIFHVSLTLALLNSLPAYFLDGESIFEVTLCF-ITSLSP--RQREKVRHDCRY 312 (417)
Q Consensus 236 V~VS~yvPR~~fl~~~~lP~vLE~fl~YL~slSlALAllN~LPcy~LDGq~IL~tlL~~-l~~l~p--r~r~~il~~c~~ 312 (417)
|.+++|.||+.+ +.+++|+..++|+||+..+|.+||+.|++|||.|||+|||+++++. +..++- ..+.-|-.....
T Consensus 387 v~~~~f~pR~~~-l~~a~p~~~~lfvkyl~~~s~~lai~na~PcF~fdg~~il~~f~~t~l~~~~~~~a~~d~i~~~i~~ 465 (484)
T KOG2921|consen 387 VPALHFGPRLVK-LELANPNKPILFVKYLNEMSEMLAISNATPCFTFDGISILEHFELTALYLFTLSLALGDFIAMPIYA 465 (484)
T ss_pred Eeecccccceee-EeecCCCchhhHHHHHHHHHHHHHHhcCccceeeccHHHHHHHHHHHHHhhhhhhhhhhhheehhhh
Confidence 999999999998 5999999999999999999999999999999999999999999998 444443 677777777777
Q ss_pred hhhhHHHHHh
Q 042181 313 EIQVAIDITV 322 (417)
Q Consensus 313 ~~~~~~~~~~ 322 (417)
+|.++|..+|
T Consensus 466 ~gs~l~a~~l 475 (484)
T KOG2921|consen 466 LGSQLIAHTL 475 (484)
T ss_pred cchHHHHHHH
Confidence 7777666554
|
|
| >KOG2921 consensus Intramembrane metalloprotease (sterol-regulatory element-binding protein (SREBP) protease) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00054 RIP metalloprotease RseP | Back alignment and domain information |
|---|
| >PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C | Back alignment and domain information |
|---|
| >cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases | Back alignment and domain information |
|---|
| >cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) | Back alignment and domain information |
|---|
| >cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis | Back alignment and domain information |
|---|
| >cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements | Back alignment and domain information |
|---|
| >cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases | Back alignment and domain information |
|---|
| >cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts | Back alignment and domain information |
|---|
| >smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 | Back alignment and domain information |
|---|
| >cd06162 S2P-M50_PDZ_SREBP Sterol regulatory element-binding protein (SREBP) Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50A), regulates intramembrane proteolysis (RIP) of SREBP and is part of a signal transduction mechanism involved in sterol and lipid metabolism | Back alignment and domain information |
|---|
| >TIGR01713 typeII_sec_gspC general secretion pathway protein C | Back alignment and domain information |
|---|
| >PF02163 Peptidase_M50: Peptidase family M50; InterPro: IPR008915 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PRK10779 zinc metallopeptidase RseP; Provisional | Back alignment and domain information |
|---|
| >PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >TIGR02038 protease_degS periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >PRK10898 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >cd05709 S2P-M50 Site-2 protease (S2P) class of zinc metalloproteases (MEROPS family M50) cleaves transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms | Back alignment and domain information |
|---|
| >KOG3553 consensus Tax interaction protein TIP1 [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PRK10779 zinc metallopeptidase RseP; Provisional | Back alignment and domain information |
|---|
| >COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00054 RIP metalloprotease RseP | Back alignment and domain information |
|---|
| >TIGR00225 prc C-terminal peptidase (prc) | Back alignment and domain information |
|---|
| >PLN00049 carboxyl-terminal processing protease; Provisional | Back alignment and domain information |
|---|
| >TIGR02860 spore_IV_B stage IV sporulation protein B | Back alignment and domain information |
|---|
| >PF12812 PDZ_1: PDZ-like domain | Back alignment and domain information |
|---|
| >cd06158 S2P-M50_like_1 Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms | Back alignment and domain information |
|---|
| >cd06163 S2P-M50_PDZ_RseP-like RseP-like Site-2 proteases (S2P), zinc metalloproteases (MEROPS family M50A), cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms | Back alignment and domain information |
|---|
| >TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase | Back alignment and domain information |
|---|
| >PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A | Back alignment and domain information |
|---|
| >COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd06164 S2P-M50_SpoIVFB_CBS SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation | Back alignment and domain information |
|---|
| >cd06161 S2P-M50_SpoIVFB SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation | Back alignment and domain information |
|---|
| >COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd06159 S2P-M50_PDZ_Arch Uncharacterized Archaeal homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms | Back alignment and domain information |
|---|
| >PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous | Back alignment and domain information |
|---|
| >KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1994 SpoIVFB Zn-dependent proteases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11186 carboxy-terminal protease; Provisional | Back alignment and domain information |
|---|
| >cd06160 S2P-M50_like_2 Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms | Back alignment and domain information |
|---|
| >KOG3552 consensus FERM domain protein FRM-8 [General function prediction only] | Back alignment and domain information |
|---|
| >COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09681 putative type II secretion protein GspC; Provisional | Back alignment and domain information |
|---|
| >KOG3532 consensus Predicted protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3209 consensus WW domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3129 consensus 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 417 | |||
| 2hga_A | 125 | Conserved protein MTH1368; GFT structural genomics | 2e-05 | |
| 3i18_A | 100 | LMO2051 protein; alpha-beta protein, structural ge | 4e-05 | |
| 2kl1_A | 94 | YLBL protein; structure genomics, structural genom | 8e-05 | |
| 2kjp_A | 91 | Uncharacterized protein YLBL; mixed alpha-beta pro | 2e-04 |
| >2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 | Back alignment and structure |
|---|
Score = 43.3 bits (102), Expect = 2e-05
Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 3/50 (6%)
Query: 13 EGTMVLDVPSTSPLSGYLSPGDVIVSLDGIHIHNEQDWMEVAALLDKYTP 62
+G + V SP S L+PG VI S++G+ + +A L +
Sbjct: 25 DGVQIDSVVPGSPASKVLTPGLVIESINGMPTS---NLTTYSAALKTISV 71
|
| >3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 | Back alignment and structure |
|---|
| >2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94 | Back alignment and structure |
|---|
| >2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 417 | |||
| 3i18_A | 100 | LMO2051 protein; alpha-beta protein, structural ge | 98.44 | |
| 2kjp_A | 91 | Uncharacterized protein YLBL; mixed alpha-beta pro | 98.31 | |
| 2eaq_A | 90 | LIM domain only protein 7; conserved hypothetical | 98.23 | |
| 2kl1_A | 94 | YLBL protein; structure genomics, structural genom | 98.23 | |
| 2jxo_A | 98 | Ezrin-radixin-moesin-binding phosphoprotein 50; nh | 98.15 | |
| 2i6v_A | 87 | General secretion pathway protein C; EPSC, GSPC, P | 98.13 | |
| 2l97_A | 134 | HTRA, putative serine protease; HTRA-PDZ, protein | 98.13 | |
| 2pkt_A | 91 | PDZ and LIM domain protein 1; PDZ domain, structur | 98.11 | |
| 2he4_A | 90 | Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p | 98.1 | |
| 2pa1_A | 87 | PDZ and LIM domain protein 2; PDZ domain, structur | 98.1 | |
| 2pzd_A | 113 | Serine protease HTRA2; PDZ domain, apoptosis, mito | 98.09 | |
| 1mfg_A | 95 | ERB-B2 interacting protein; PDZ domain, protein-pe | 98.07 | |
| 2fcf_A | 103 | Multiple PDZ domain protein; adaptor molecule, pro | 98.04 | |
| 2eeh_A | 100 | PDZ domain-containing protein 7; structural genomi | 98.04 | |
| 2v90_A | 96 | PDZ domain-containing protein 3; membrane, protein | 98.04 | |
| 2dls_A | 93 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 98.02 | |
| 2d90_A | 102 | PDZ domain containing protein 1; structural genomi | 98.02 | |
| 2p3w_A | 112 | Probable serine protease HTRA3; PDZ domain, phage | 98.02 | |
| 2vsp_A | 91 | PDZ domain-containing protein 1; membrane, cytopla | 98.02 | |
| 3r68_A | 95 | Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P | 98.01 | |
| 2rcz_A | 81 | Tight junction protein ZO-1; PDZ, domain-swapping, | 98.0 | |
| 3sfj_A | 104 | TAX1-binding protein 3; PDZ:peptide complex, signa | 98.0 | |
| 2jil_A | 97 | GRIP1 protein, glutamate receptor interacting prot | 98.0 | |
| 1g9o_A | 91 | NHE-RF; PDZ domain, complex, signaling protein; 1. | 97.99 | |
| 1wh1_A | 124 | KIAA1095 protein; PDZ domain, structural genomics, | 97.99 | |
| 2hga_A | 125 | Conserved protein MTH1368; GFT structural genomics | 97.99 | |
| 2h2b_A | 107 | Tight junction protein ZO-1; PDZ domain, phage der | 97.99 | |
| 2ego_A | 96 | General receptor for phosphoinositides 1- associat | 97.98 | |
| 1vb7_A | 94 | PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, | 97.98 | |
| 3cyy_A | 92 | Tight junction protein ZO-1; protein-ligand comple | 97.97 | |
| 2edz_A | 114 | PDZ domain-containing protein 1; CFTR-associated p | 97.97 | |
| 2w4f_A | 97 | Protein LAP4; structural protein, phosphoprotein, | 97.97 | |
| 2kv8_A | 83 | RGS12, regulator of G-protein signaling 12; PDZ do | 97.96 | |
| 3ngh_A | 106 | PDZ domain-containing protein 1; adaptor protein, | 97.96 | |
| 2uzc_A | 88 | Human pdlim5, PDZ and LIM domain 5; metal-binding, | 97.94 | |
| 1n7t_A | 103 | 99-MER peptide of densin-180-like protein; PDZ dom | 97.94 | |
| 3khf_A | 99 | Microtubule-associated serine/threonine-protein ki | 97.93 | |
| 3bpu_A | 88 | Membrane-associated guanylate kinase, WW and PDZ c | 97.93 | |
| 1wi2_A | 104 | Riken cDNA 2700099C19; structural genomics, riken | 97.93 | |
| 2q9v_A | 90 | Membrane-associated guanylate kinase, WW and PDZ c | 97.92 | |
| 1v5l_A | 103 | PDZ and LIM domain 3; actinin alpha 2 associated L | 97.92 | |
| 3tsv_A | 124 | Tight junction protein ZO-1; PDZ, scaffolding, JAM | 97.92 | |
| 2iwq_A | 123 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 97.9 | |
| 1ihj_A | 98 | INAD; intermolecular disulfide bond, PDZ domain, s | 97.9 | |
| 2i04_A | 85 | Membrane-associated guanylate kinase, WW and PDZ d | 97.89 | |
| 1q3o_A | 109 | Shank1; PDZ, GKAP, peptide binding protein; 1.80A | 97.89 | |
| 2vz5_A | 139 | TAX1-binding protein 3; WNT signaling pathway, pro | 97.88 | |
| 1rgw_A | 85 | ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, | 97.88 | |
| 2ejy_A | 97 | 55 kDa erythrocyte membrane protein; GPC, maguk, P | 97.87 | |
| 1uep_A | 103 | Membrane associated guanylate kinase inverted-2 (M | 97.86 | |
| 1wha_A | 105 | KIAA0147 protein, scribble; PDZ domain, cellular s | 97.86 | |
| 1uez_A | 101 | KIAA1526 protein; PDZ domain, structural genomics, | 97.85 | |
| 2e7k_A | 91 | Maguk P55 subfamily member 2; PDZ domain, MPP2 pro | 97.85 | |
| 2f5y_A | 91 | Regulator of G-protein signalling 3 isoform 1; PDZ | 97.85 | |
| 2q3g_A | 89 | PDZ and LIM domain protein 7; structural genomics, | 97.85 | |
| 2edv_A | 96 | FERM and PDZ domain-containing protein 1; cytoskel | 97.84 | |
| 1x5q_A | 110 | LAP4 protein; PDZ domain, scribble homolog protein | 97.83 | |
| 2yt7_A | 101 | Amyloid beta A4 precursor protein-binding family A | 97.83 | |
| 1qav_A | 90 | Alpha-1 syntrophin (residues 77-171); beta-finger, | 97.82 | |
| 2kjd_A | 128 | Sodium/hydrogen exchange regulatory cofactor NHE- | 97.82 | |
| 2i1n_A | 102 | Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig | 97.82 | |
| 2fe5_A | 94 | Presynaptic protein SAP102; PDZ domain, DLG3, huma | 97.81 | |
| 2z17_A | 104 | Pleckstrin homology SEC7 and coiled-coil domains- | 97.81 | |
| 2jre_A | 108 | C60-1 PDZ domain peptide; de novo protein; NMR {Sy | 97.81 | |
| 1m5z_A | 91 | GRIP, AMPA receptor interacting protein; six beta- | 97.8 | |
| 3id1_A | 95 | Regulator of sigma E protease; hydrolase, cell inn | 97.8 | |
| 2yub_A | 118 | LIMK-2, LIM domain kinase 2; PDZ domain, structura | 97.79 | |
| 1uit_A | 117 | Human discs large 5 protein; PDZ domain, HDLG5, ma | 97.78 | |
| 1d5g_A | 96 | Human phosphatase HPTP1E; protein-peptide complex, | 97.77 | |
| 3cbz_A | 108 | Dishevelled-2; PDZ domain, phage derived high affi | 97.77 | |
| 2qg1_A | 92 | Multiple PDZ domain protein; MPDZ, MUPP1, structur | 97.77 | |
| 1x5n_A | 114 | Harmonin; PDZ domain, usher syndrome 1C protein, a | 97.77 | |
| 4e34_A | 87 | Golgi-associated PDZ and coiled-coil motif-contai | 97.76 | |
| 3o46_A | 93 | Maguk P55 subfamily member 7; PDZ domain, structur | 97.76 | |
| 1va8_A | 113 | Maguk P55 subfamily member 5; PDZ domain, palmitoy | 97.76 | |
| 1qau_A | 112 | Neuronal nitric oxide synthase (residues 1-130); b | 97.76 | |
| 3e17_A | 88 | Tight junction protein ZO-2; domain swapping, alte | 97.75 | |
| 2ehr_A | 117 | INAD-like protein; PDZ domain, inadl protein, hina | 97.75 | |
| 2koj_A | 111 | Partitioning defective 3 homolog; PDZ domain, stru | 97.75 | |
| 2dmz_A | 129 | INAD-like protein; PDZ domain, inadl protein, hina | 97.75 | |
| 1ueq_A | 123 | Membrane associated guanylate kinase inverted-2 (M | 97.74 | |
| 2vwr_A | 95 | Ligand of NUMB protein X 2; protein-binding, metal | 97.74 | |
| 2i4s_A | 105 | General secretion pathway protein C; EPSC, GSPC, P | 97.74 | |
| 2awx_A | 105 | Synapse associated protein 97; membrane protein, s | 97.73 | |
| 3kzd_A | 94 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 97.73 | |
| 3qik_A | 101 | Phosphatidylinositol 3,4,5-trisphosphate-dependen | 97.73 | |
| 2o2t_A | 117 | Multiple PDZ domain protein; structural protein, s | 97.72 | |
| 2eeg_A | 94 | PDZ and LIM domain protein 4; PDZ domain, structur | 97.72 | |
| 2opg_A | 98 | Multiple PDZ domain protein; structural protein, s | 97.72 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 97.72 | |
| 1uf1_A | 128 | KIAA1526 protein; PDZ domain, structural genomics, | 97.71 | |
| 1n7e_A | 97 | AMPA receptor interacting protein GRIP; PDZ, prote | 97.71 | |
| 3qe1_A | 107 | Sorting nexin-27, G protein-activated inward RECT | 97.71 | |
| 2vsv_A | 109 | Rhophilin-2; scaffold protein, RHO GTPase binding, | 97.71 | |
| 2fne_A | 117 | Multiple PDZ domain protein; structural protein, s | 97.71 | |
| 1q7x_A | 108 | PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str | 97.71 | |
| 2jik_A | 101 | Synaptojanin-2 binding protein; transmembrane, out | 97.7 | |
| 2kom_A | 121 | Partitioning defective 3 homolog; PAR-3B, PDZ doma | 97.69 | |
| 2gzv_A | 114 | PRKCA-binding protein; protein kinase C, PDZ domai | 97.69 | |
| 2dkr_A | 93 | LIN-7 homolog B; LIN-7B, PDZ, structural genomics, | 97.69 | |
| 1v5q_A | 122 | GRIP1 homolog, glutamate receptor interacting prot | 97.69 | |
| 2qkv_A | 96 | Inactivation-NO-after-potential D protein; PDZ dom | 97.69 | |
| 1kwa_A | 88 | Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca | 97.69 | |
| 2la8_A | 106 | Inactivation-NO-after-potential D protein, KON-TI | 97.68 | |
| 2djt_A | 104 | Unnamed protein product; PDZ domain, structural ge | 97.68 | |
| 1y7n_A | 90 | Amyloid beta A4 precursor protein-binding family A | 97.68 | |
| 2byg_A | 117 | Channel associated protein of synapse-110; DLG2, P | 97.67 | |
| 3i4w_A | 104 | Disks large homolog 4; alpha and beta protein, alt | 97.67 | |
| 2dlu_A | 111 | INAD-like protein; PDZ domain, inadl protein, hina | 97.67 | |
| 2cs5_A | 119 | Tyrosine-protein phosphatase, non-receptor type 4; | 97.65 | |
| 1te0_A | 318 | Protease DEGS; two domains, serine protease, PDZ, | 97.65 | |
| 3gsl_A | 196 | Disks large homolog 4; PDZ domain, tandem, PSD-95, | 97.65 | |
| 2zpm_A | 91 | Regulator of sigma E protease; metalloproteinase, | 97.64 | |
| 2r4h_A | 112 | Membrane-associated guanylate kinase, WW and PDZ c | 97.64 | |
| 1uew_A | 114 | Membrane associated guanylate kinase inverted-2 (M | 97.63 | |
| 1vae_A | 111 | Rhophilin 2, rhophilin, RHO GTPase binding protein | 97.63 | |
| 2csj_A | 117 | TJP2 protein; PDZ domain, structural genomics, NPP | 97.63 | |
| 2eno_A | 120 | Synaptojanin-2-binding protein; mitochondrial oute | 97.62 | |
| 1whd_A | 100 | RGS3, regulator of G-protein signaling 3; PDZ doma | 97.62 | |
| 4amh_A | 106 | Disks large homolog 1; permutation, protein foldin | 97.61 | |
| 1wf7_A | 103 | Enigma homologue protein; PDZ domain, structural g | 97.61 | |
| 1x6d_A | 119 | Interleukin-16; PDZ domain, lymphocyte chemoattrac | 97.61 | |
| 2iwn_A | 97 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 97.6 | |
| 1lcy_A | 325 | HTRA2 serine protease; apoptosis, PDZ domain, casp | 97.6 | |
| 3l4f_D | 132 | SH3 and multiple ankyrin repeat domains protein 1; | 97.6 | |
| 1um1_A | 110 | KIAA1849 protein, RSGI RUH-007; PDZ domain, human | 97.59 | |
| 2yuy_A | 126 | RHO GTPase activating protein 21; PDZ domain, stru | 97.59 | |
| 3axa_A | 106 | Afadin, nectin-3, protein AF-6; PDZ domain, fusion | 97.58 | |
| 2d8i_A | 114 | T-cell lymphoma invasion and metastasis 1 variant; | 97.57 | |
| 3b76_A | 118 | E3 ubiquitin-protein ligase LNX; PDZ, bound ligand | 97.56 | |
| 1uju_A | 111 | Scribble; PDZ domain, cellular signaling, structur | 97.56 | |
| 1wf8_A | 107 | Neurabin-I; PDZ domain, structural genomics, NPPSF | 97.55 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 97.54 | |
| 2g5m_B | 113 | Neurabin-2; spinophilin, PDZ domain, CNS, synaptic | 97.54 | |
| 2dm8_A | 116 | INAD-like protein; PDZ domain, inadl protein, hina | 97.54 | |
| 3stj_A | 345 | Protease DEGQ; serine protease, PDZ domain, protea | 97.53 | |
| 1nf3_C | 128 | PAR-6B; semi-CRIB motif, switch I and II, PDZ doma | 97.52 | |
| 2dc2_A | 103 | GOPC, golgi associated PDZ and coiled-coil motif c | 97.52 | |
| 1tp5_A | 119 | Presynaptic density protein 95; PDZ-peptide ligand | 97.52 | |
| 2db5_A | 128 | INAD-like protein; PDZ domain, hinadl, PALS1- asso | 97.51 | |
| 2eei_A | 106 | PDZ domain-containing protein 1; regulatory factor | 97.51 | |
| 1wfv_A | 103 | Membrane associated guanylate kinase inverted-2; a | 97.51 | |
| 1v62_A | 117 | KIAA1719 protein; structural genomics, synaptic tr | 97.51 | |
| 3hpk_A | 125 | Protein interacting with PRKCA 1; oxidized, PDZ do | 97.5 | |
| 1w9e_A | 166 | Syntenin 1; cell adhesion, adhesion/complex, PDZ d | 97.48 | |
| 3nfk_A | 107 | Tyrosine-protein phosphatase non-receptor type 4; | 97.48 | |
| 1b8q_A | 127 | Protein (neuronal nitric oxide synthase); PDZ doma | 97.47 | |
| 1i16_A | 130 | Interleukin 16, LCF; cytokine, lymphocyte chemoatt | 97.46 | |
| 1wif_A | 126 | RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s | 97.46 | |
| 2daz_A | 124 | INAD-like protein; PDZ domain, inadl protein, hina | 97.45 | |
| 2kpk_A | 129 | Membrane-associated guanylate kinase, WW and PDZ c | 97.44 | |
| 1wfg_A | 131 | Regulating synaptic membrane exocytosis protein 2; | 97.43 | |
| 1ujd_A | 117 | KIAA0559 protein; PDZ domain, structural genomics, | 97.43 | |
| 2d92_A | 108 | INAD-like protein; PDZ domain, inadl protein, hina | 97.42 | |
| 1p1d_A | 196 | PDZ45, glutamate receptor interacting protein; PDZ | 97.42 | |
| 3k1r_A | 192 | Harmonin; protein-protein complex, alternative spl | 97.41 | |
| 3rle_A | 209 | Golgi reassembly-stacking protein 2; PDZ, tether, | 97.41 | |
| 1uhp_A | 107 | Hypothetical protein KIAA1095; PDZ domain, semapho | 97.41 | |
| 1wg6_A | 127 | Hypothetical protein (riken cDNA 2810455B10); stru | 97.38 | |
| 1wi4_A | 109 | Synip, syntaxin binding protein 4; syntaxin4-inter | 97.35 | |
| 2edp_A | 100 | Fragment, shroom family member 4; APX/shroom famil | 97.35 | |
| 2iwo_A | 120 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 97.33 | |
| 3r0h_A | 206 | INAD, inactivation-NO-after-potential D protein; p | 97.31 | |
| 3gsl_A | 196 | Disks large homolog 4; PDZ domain, tandem, PSD-95, | 97.29 | |
| 2lob_A | 112 | Golgi-associated PDZ and coiled-coil motif-contai | 96.39 | |
| 2qt5_A | 200 | Glutamate receptor-interacting protein 1; PDZ-pept | 97.28 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 97.26 | |
| 1um7_A | 113 | Synapse-associated protein 102; PDZ, discs large h | 97.25 | |
| 3qo6_A | 348 | Protease DO-like 1, chloroplastic; protease, HTRA, | 97.25 | |
| 3r0h_A | 206 | INAD, inactivation-NO-after-potential D protein; p | 97.24 | |
| 3rle_A | 209 | Golgi reassembly-stacking protein 2; PDZ, tether, | 97.24 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 97.23 | |
| 1ujv_A | 96 | Membrane associated guanylate kinase inverted-2 (M | 97.19 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 97.18 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 97.16 | |
| 2krg_A | 216 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a | 97.14 | |
| 1p1d_A | 196 | PDZ45, glutamate receptor interacting protein; PDZ | 97.12 | |
| 3num_A | 332 | Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom | 97.1 | |
| 2qt5_A | 200 | Glutamate receptor-interacting protein 1; PDZ-pept | 97.07 | |
| 3egg_C | 170 | Spinophilin; PP1, serine/threonine phosphatase, po | 97.01 | |
| 1v6b_A | 118 | Harmonin isoform A1; structural genomics, usher sy | 97.0 | |
| 4fgm_A | 597 | Aminopeptidase N family protein; structural genomi | 96.99 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 96.91 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 96.87 | |
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 96.82 | |
| 1ufx_A | 103 | KIAA1526 protein; PDZ domain, structural genomics, | 96.79 | |
| 1fc6_A | 388 | Photosystem II D1 protease; D1 C-terminal processi | 96.72 | |
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 96.62 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 96.61 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 96.5 | |
| 1z87_A | 263 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 96.47 | |
| 1r6j_A | 82 | Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap | 96.38 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 96.26 | |
| 1w9e_A | 166 | Syntenin 1; cell adhesion, adhesion/complex, PDZ d | 96.09 | |
| 3k50_A | 403 | Putative S41 protease; structural genomics, joint | 95.91 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 95.79 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 95.7 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 94.73 | |
| 3soe_A | 113 | Membrane-associated guanylate kinase, WW and PDZ c | 94.5 | |
| 3gge_A | 95 | PDZ domain-containing protein GIPC2; structural ge | 94.34 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 94.24 | |
| 3b4r_A | 224 | Putative zinc metalloprotease MJ0392; intramembran | 93.98 |
| >3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A | Back alignment and structure |
|---|
Probab=98.44 E-value=2.1e-07 Score=76.08 Aligned_cols=45 Identities=24% Similarity=0.521 Sum_probs=42.9
Q ss_pred eCCceEEEEeCCCCCCCCCCCCCCeEEeeCCeecCChhhHHHHHH
Q 042181 11 QCEGTMVLDVPSTSPLSGYLSPGDVIVSLDGIHIHNEQDWMEVAA 55 (417)
Q Consensus 11 ~g~Gv~V~~V~~~SPl~ggL~~GDvI~sINgc~V~~~~dW~~cL~ 55 (417)
...|++|.+|.++|||++||++||+|++|||.+|.+.+++.+.|.
T Consensus 5 ~~~Gv~V~~V~~~spA~~GL~~GD~I~~Ing~~v~~~~dl~~~l~ 49 (100)
T 3i18_A 5 TYDGVYVMSVKDDVPAADVLHAGDLITEIDGNAFKSSQEFIDYIH 49 (100)
T ss_dssp CCCCEEEEEECTTSGGGGTCCTTCEEEEETTBCCSSHHHHHHHHH
T ss_pred eCCCEEEEEeCCCCchHHCCCCCCEEEEECCEECCCHHHHHHHHH
Confidence 478999999999999999999999999999999999999999995
|
| >2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} | Back alignment and structure |
|---|
| >2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} | Back alignment and structure |
|---|
| >2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 | Back alignment and structure |
|---|
| >2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* | Back alignment and structure |
|---|
| >2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A | Back alignment and structure |
|---|
| >2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A | Back alignment and structure |
|---|
| >2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 | Back alignment and structure |
|---|
| >1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A | Back alignment and structure |
|---|
| >2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A | Back alignment and structure |
|---|
| >2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A | Back alignment and structure |
|---|
| >3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* | Back alignment and structure |
|---|
| >2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A | Back alignment and structure |
|---|
| >3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A | Back alignment and structure |
|---|
| >2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A | Back alignment and structure |
|---|
| >1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 | Back alignment and structure |
|---|
| >2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A | Back alignment and structure |
|---|
| >2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A | Back alignment and structure |
|---|
| >1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A | Back alignment and structure |
|---|
| >3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A | Back alignment and structure |
|---|
| >3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A | Back alignment and structure |
|---|
| >2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} | Back alignment and structure |
|---|
| >1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* | Back alignment and structure |
|---|
| >2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A | Back alignment and structure |
|---|
| >1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A | Back alignment and structure |
|---|
| >2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A | Back alignment and structure |
|---|
| >1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} | Back alignment and structure |
|---|
| >2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A | Back alignment and structure |
|---|
| >2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A | Back alignment and structure |
|---|
| >2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A | Back alignment and structure |
|---|
| >2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A | Back alignment and structure |
|---|
| >2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A | Back alignment and structure |
|---|
| >3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A | Back alignment and structure |
|---|
| >2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A | Back alignment and structure |
|---|
| >4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A | Back alignment and structure |
|---|
| >3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B | Back alignment and structure |
|---|
| >3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A | Back alignment and structure |
|---|
| >2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 | Back alignment and structure |
|---|
| >2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A | Back alignment and structure |
|---|
| >3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A | Back alignment and structure |
|---|
| >3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A | Back alignment and structure |
|---|
| >1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A | Back alignment and structure |
|---|
| >2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A | Back alignment and structure |
|---|
| >2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A | Back alignment and structure |
|---|
| >2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A | Back alignment and structure |
|---|
| >1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A | Back alignment and structure |
|---|
| >2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A | Back alignment and structure |
|---|
| >2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A | Back alignment and structure |
|---|
| >2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 | Back alignment and structure |
|---|
| >3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A | Back alignment and structure |
|---|
| >2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A | Back alignment and structure |
|---|
| >2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A | Back alignment and structure |
|---|
| >2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A | Back alignment and structure |
|---|
| >2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A | Back alignment and structure |
|---|
| >1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A | Back alignment and structure |
|---|
| >3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A | Back alignment and structure |
|---|
| >1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A | Back alignment and structure |
|---|
| >1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A | Back alignment and structure |
|---|
| >1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A | Back alignment and structure |
|---|
| >3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A | Back alignment and structure |
|---|
| >3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A | Back alignment and structure |
|---|
| >1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A | Back alignment and structure |
|---|
| >1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A | Back alignment and structure |
|---|
| >2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A | Back alignment and structure |
|---|
| >1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A | Back alignment and structure |
|---|
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A | Back alignment and structure |
|---|
| >3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A | Back alignment and structure |
|---|
| >3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >3b4r_A Putative zinc metalloprotease MJ0392; intramembrane protease, CBS domain, hydrolase, metal-binding, transmembrane; 3.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 417 | |||
| d2hgaa1 | 103 | Uncharacterized protein MTH1368 {Methanobacterium | 98.45 | |
| d2z9ia1 | 88 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 98.4 | |
| d1lcya1 | 100 | Mitochondrial serine protease HtrA2 {Human (Homo s | 98.38 | |
| d1ky9b2 | 88 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 98.37 | |
| d1ky9a1 | 94 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 98.31 | |
| d1sota1 | 99 | Stress sensor protease DegS, C-terminal domain {Es | 98.26 | |
| d2i6va1 | 87 | General secretion pathway protein C, EpsC {Vibrio | 97.94 | |
| d1fc6a3 | 92 | Photosystem II D1 C-terminal processing protease { | 97.93 | |
| d1w9ea1 | 85 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 97.78 | |
| d1k32a1 | 91 | Tricorn protease {Archaeon Thermoplasma acidophilu | 97.76 | |
| d2h3la1 | 103 | Erbin {Human (Homo sapiens) [TaxId: 9606]} | 97.58 | |
| d1q3oa_ | 104 | Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId | 97.58 | |
| d2f5ya1 | 77 | Regulator of G-protein signaling 3, RGS3 {Human (H | 97.57 | |
| d1x5qa1 | 97 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 97.55 | |
| d1m5za_ | 91 | Glutamate receptor interacting protein {Rat (Rattu | 97.47 | |
| d2csja1 | 104 | Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc | 97.45 | |
| d1wh1a_ | 124 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 97.43 | |
| d1x5na1 | 101 | Harmonin {Human (Homo sapiens) [TaxId: 9606]} | 97.43 | |
| d2fcfa1 | 96 | Multiple PDZ domain protein {Human (Homo sapiens) | 97.42 | |
| d1rgwa_ | 85 | Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax | 97.4 | |
| d1qaua_ | 112 | Neuronal nitric oxide synthase, NNOS {Rat (Rattus | 97.38 | |
| d1wi2a_ | 104 | PDZ domain containing protein 11, Pdzk11 {Mouse (M | 97.36 | |
| d1g9oa_ | 91 | Na+/H+ exchanger regulatory factor, NHERF {Human ( | 97.35 | |
| d1ozia_ | 99 | Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 | 97.35 | |
| d1rgra_ | 93 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 97.33 | |
| d1vaea_ | 111 | Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | 97.33 | |
| d1uf1a_ | 128 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 97.33 | |
| d1ihja_ | 94 | Inad {Fruit fly (Drosophila melanogaster) [TaxId: | 97.32 | |
| d1vb7a_ | 94 | PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta | 97.31 | |
| d1rzxa_ | 98 | GTPase-binding domain of the cell polarity protein | 97.26 | |
| d2fe5a1 | 92 | Synapse-associated protein 102 {Human (Homo sapien | 97.26 | |
| d1wf8a1 | 94 | Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | 97.26 | |
| d1kwaa_ | 88 | Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | 97.25 | |
| d1t2ma1 | 92 | Afadin {Human (Homo sapiens) [TaxId: 9606]} | 97.24 | |
| d1uepa_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 97.2 | |
| d2cs5a1 | 106 | Tyrosine-protein phosphatase non-receptor type 4, | 97.2 | |
| d2f0aa1 | 92 | Segment polarity protein dishevelled homolog Dvl-2 | 97.19 | |
| d1uhpa_ | 107 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 97.18 | |
| d1qava_ | 90 | Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | 97.16 | |
| d1whaa_ | 105 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 97.15 | |
| d1uita_ | 117 | Discs large 5 protein KIAA0583 {Human (Homo sapien | 97.14 | |
| d1tp5a1 | 102 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 97.11 | |
| d1wi4a1 | 96 | Syntaxin binding protein 4 {Mouse (Mus musculus) [ | 97.11 | |
| d1ueza_ | 101 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 97.1 | |
| d1x6da1 | 107 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 97.1 | |
| d1uewa_ | 114 | Membrane associated guanylate kinase inverted-2 (M | 97.1 | |
| d1p1da2 | 99 | Glutamate receptor interacting protein {Rat (Rattu | 97.09 | |
| d2fnea1 | 88 | Multiple PDZ domain protein {Human (Homo sapiens) | 97.08 | |
| d1y7na1 | 79 | Amyloid beta A4 precursor protein-binding family A | 97.07 | |
| d1ujua_ | 111 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 97.01 | |
| d1ueqa_ | 123 | Membrane associated guanylate kinase inverted-2 (M | 96.98 | |
| d1x45a1 | 85 | Amyloid beta A4 precursor protein-binding family A | 96.97 | |
| d1va8a1 | 100 | Maguk p55 subfamily member 5 {Mouse (Mus musculus) | 96.97 | |
| d1n7ea_ | 95 | Glutamate receptor-interacting protein 1, GRIP1 {R | 96.96 | |
| d2cssa1 | 108 | Regulating synaptic membrane exocytosis protein 1, | 96.95 | |
| d1ujda_ | 117 | Hypothetical protein KIAA0559 {Human (Homo sapiens | 96.95 | |
| d1um1a_ | 110 | Hypothetical protein KIAA1849 {Human (Homo sapiens | 96.93 | |
| d1v62a_ | 117 | Glutamate receptor interacting protein 2, GRIP2 (K | 96.93 | |
| d1v5qa_ | 122 | Glutamate receptor interacting protein {Mouse (Mus | 96.93 | |
| d1v5la_ | 103 | Alpha-actinin-2 associated LIM protein {Mouse (Mus | 96.88 | |
| d1wifa_ | 126 | hypothetical PDZ domain containing protein Uqcrc2 | 96.88 | |
| d1r6ja_ | 82 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 96.88 | |
| d1wf7a_ | 103 | Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 | 96.84 | |
| d1v6ba_ | 118 | Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | 96.79 | |
| d1i16a_ | 130 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 96.76 | |
| d1x5ra1 | 99 | Glutamate receptor interacting protein 2, GRIP2 (K | 96.68 | |
| d1ufxa_ | 103 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 96.64 | |
| d1wg6a_ | 127 | Partitioning-defective 3-like protein, PAR3-L (RIK | 96.44 | |
| d1wfva_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 96.28 | |
| d1ujva_ | 96 | Membrane associated guanylate kinase inverted-2 (M | 88.14 |
| >d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: PDZ domain-like superfamily: PDZ domain-like family: MTH1368 C-terminal domain-like domain: Uncharacterized protein MTH1368 species: Methanobacterium thermoautotrophicum [TaxId: 145262]
Probab=98.45 E-value=9e-08 Score=77.88 Aligned_cols=44 Identities=30% Similarity=0.396 Sum_probs=41.9
Q ss_pred CCceEEEEeCCCCCCCCCCCCCCeEEeeCCeecCChhhHHHHHH
Q 042181 12 CEGTMVLDVPSTSPLSGYLSPGDVIVSLDGIHIHNEQDWMEVAA 55 (417)
Q Consensus 12 g~Gv~V~~V~~~SPl~ggL~~GDvI~sINgc~V~~~~dW~~cL~ 55 (417)
.+|++|.+|.++|||+++|++||+|++|||.+|.+.+|+...+.
T Consensus 2 p~Gv~V~~V~~~sPA~~~L~~GD~I~~ing~~v~~~~~l~~~i~ 45 (103)
T d2hgaa1 2 PDGVQIDSVVPGSPASKVLTPGLVIESINGMPTSNLTTYSAALK 45 (103)
T ss_dssp CCCEEEEEECSSSGGGGTSCTTCEEEEETTEECSSHHHHHHHHT
T ss_pred CCcEEEEEECCCChHHhcCCCCCEEEEECCEEcCCHHHHHHHHh
Confidence 47999999999999999999999999999999999999999984
|
| >d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} | Back information, alignment and structure |
|---|
| >d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|