Citrus Sinensis ID: 042233

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390--
MAGTLLIETMGGPKICGFTIRSLRKHATATWARFAFNLFVYLQAANVFGGLWYFMAIERQTECWTKACINYTGRSHCSFNCHDNLEDYTFLNEFCPMKTRNVTIHDFGIFHGALESGILEGKNFLQKILHCFIWGLQNLSNLSHNLQTSGNVEENIFVILVVSSGFLLFALLIGNMQRYLKLGKEMTLKPREIEEWQPFQKLSKNLQQKVKKYKSYIRRKTDYIDVQNLLNNLPNELRRELKRELCWNLLKKVQGFRKLNEVTLDALCDCVKPTFFTEHTHLIREGDPIDEMIFVVQGKLRTYTFKDIQSGSTSSDHKRYDGKNTRKEDLLQDGDFYGEELIDWALRDRFSFDIPKSNRTIQALTNVDAFMLMADDLKIVFNDMMNQLGLYD
ccHHHHHHHcccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHcccHHHEEEccccHHHHHHHHHHHHccccccccccccccccccEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccccEEEEccccccEEEEEEEcEEEEEEEcccccccccccccccccccccEEEEccccccccccHHHHHHccccccccccccccEEEcEEEEcccccHHcHHHHHHHHHHHHcccc
cHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHEEEcccccccccHHHcccccccccccccccEEEHccccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHHHHHccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccEEEEEEEccEEEEEccccccccEcccccEEcccccEEEEEEccccccHHHHHHHHHccccccccccccHEEEEEEEEEEHEccHHHHHHHHHHHHHHHHccc
MAGTLLIetmggpkicgfTIRSLRKHATATWARFAFNLFVYLQAANVFGGLWYFMAIERQTECWTKacinytgrshcsfnchdnledytflnefcpmktrnvtihdfGIFHGALESGILEGKNFLQKILHCFIWGLQnlsnlshnlqtsgnveeNIFVILVVSSGFLLFALLIGNMQRYLKLgkemtlkpreieewqPFQKLSKNLQQKVKKYKSYIRRKTDYIDVQNLLNNLPNELRRELKRELCWNLLKKVQGFRKLNEVTLDALcdcvkptfftehthliregdpidEMIFVVQGKLrtytfkdiqsgstssdhkrydgkntrkedllqdgdfygEELIDWALrdrfsfdipksnrtiQALTNVDAFMLMADDLKIVFNDMMNQLGLYD
MAGTLLietmggpkiCGFTIRSLRKHATATWARFAFNLFVYLQAANVFGGLWYFMAIERQTECWTKACINYTGRSHCSFNCHDNLEDYTFLNEFCPMKTRNVTIHDFGIFHGALESGILEGKNFLQKILHCFIWGLQNLSNLSHNLQTSGNVEENIFVILVVSSGFLLFALLIGNMQRYLKLGKEMTLKPREieewqpfqklsknlqQKVKKYKSyirrktdyidvqnllnnLPNELRRELKRELCWNLLKKVQGFRKLNEVTLDALCDCVKPTFFTEHthliregdpiDEMIFVVQGKLRTYtfkdiqsgstssdhkrydgkntrkedllqdgdFYGEELIDWALRDRFSFDIPKSNRTIQALTNVDAFMLMADDLKIVFNDMMNQLGLYD
MAGTLLIETMGGPKICGFTIRSLRKHATATWARFAFNLFVYLQAANVFGGLWYFMAIERQTECWTKACINYTGRSHCSFNCHDNLEDYTFLNEFCPMKTRNVTIHDFGIFHGALESGILEGKNFLQKILHCFIWGlqnlsnlshnlqTSGNVEENIFVILVVSSGFLLFALLIGNMQRYLKLGKEMTLKPREIEEWQPFQKLSKNLQQKVKKYKSYIRRKTDYIDVQnllnnlpnelrrelkrelCWNLLKKVQGFRKLNEVTLDALCDCVKPTFFTEHTHLIREGDPIDEMIFVVQGKLRTYTFKDIQSGSTSSDHKRYDGKNTRKEDLLQDGDFYGEELIDWALRDRFSFDIPKSNRTIQALTNVDAFMLMADDLKIVFNDMMNQLGLYD
****LLIETMGGPKICGFTIRSLRKHATATWARFAFNLFVYLQAANVFGGLWYFMAIERQTECWTKACINYTGRSHCSFNCHDNLEDYTFLNEFCPMKTRNVTIHDFGIFHGALESGILEGKNFLQKILHCFIWGLQNLSNLSHNLQTSGNVEENIFVILVVSSGFLLFALLIGNMQRYLKLGKEMTLKPREIEEWQPFQKLSKNLQQKVKKYKSYIRRKTDYIDVQNLLNNLPNELRRELKRELCWNLLKKVQGFRKLNEVTLDALCDCVKPTFFTEHTHLIREGDPIDEMIFVVQGKLRTYTFKDI**********************LQDGDFYGEELIDWALRDRFSFDIPKSNRTIQALTNVDAFMLMADDLKIVFNDMMNQL****
MAGTLLIETMGGPKICGFTIRSLRKHATATWARFAFNLFVYLQAANVFGGLWYFMAIERQTECWTKACINYTGRSHCSFNCHDNLEDYTFLNEFCPMKTRNVTIHDFGIFHGALESGILEGKNFLQKILHCFIWGLQNLSNLSHNLQTSGNVEENIFVILVVSSGFLLFALLIGNMQRYLKLGKEMTLKPREIEEWQPFQKLSKNLQQKVKKYKSYIRRKTDYIDVQNLLNNLPNELRRELKRELCWNLLKKVQGFRKLNEVTLDALCDCVKPTFFTEHTHLIREGDPIDEMIFVVQGKLRTYTFKDIQSGSTSSDHKRYDGKNTRKEDLLQDGDFYGEELIDWALRD*********NRTIQALTNVDAFMLMADDLKIVFNDMMNQL****
MAGTLLIETMGGPKICGFTIRSLRKHATATWARFAFNLFVYLQAANVFGGLWYFMAIERQTECWTKACINYTGRSHCSFNCHDNLEDYTFLNEFCPMKTRNVTIHDFGIFHGALESGILEGKNFLQKILHCFIWGLQNLSNLSHNLQTSGNVEENIFVILVVSSGFLLFALLIGNMQRYLKLGKEMTLKPREIEEWQPFQKLSKNLQQKVKKYKSYIRRKTDYIDVQNLLNNLPNELRRELKRELCWNLLKKVQGFRKLNEVTLDALCDCVKPTFFTEHTHLIREGDPIDEMIFVVQGKLRTYTFKDI*************GKNTRKEDLLQDGDFYGEELIDWALRDRFSFDIPKSNRTIQALTNVDAFMLMADDLKIVFNDMMNQLGLYD
MAGTLLIETMGGPKICGFTIRSLRKHATATWARFAFNLFVYLQAANVFGGLWYFMAIERQTECWTKACINYTGRSHCSFNCHDNLEDYTFLNEFCPMKTRNVTIHDFGIFHGALESGILEGKNFLQKILHCFIWGLQNLSNLSHNLQTSGNVEENIFVILVVSSGFLLFALLIGNMQRYLKLGKEMTLKPREIEEWQPFQKLSKNLQQKVKKYKSYIRRKTDYIDVQNLLNNLPNELRRELKRELCWNLLKKVQGFRKLNEVTLDALCDCVKPTFFTEHTHLIREGDPIDEMIFVVQGKLRTYTFKDIQSGSTSSDHKRYDGKNTRKEDLLQDGDFYGEELIDWALRDRFSFDIPKSNRTIQALTNVDAFMLMADDLKIVFNDMMNQLGL**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGTLLIETMGGPKICGFTIRSLRKHATATWARFAFNLFVYLQAANVFGGLWYFMAIERQTECWTKACINYTGRSHCSFNCHDNLEDYTFLNEFCPMKTRNVTIHDFGIFHGALESGILEGKNFLQKILHCFIWGLQNLSNLSHNLQTSGNVEENIFVILVVSSGFLLFALLIGNMQRYLKLGKEMTLKPREIEEWQPFQKLSKNLQQKVKKYKSYIRRKTDYIDVQNLLNNLPNELRRELKRELCWNLLKKVQGFRKLNEVTLDALCDCVKPTFFTEHTHLIREGDPIDEMIFVVQGKLRTYTFKDIQSGSTSSDHKRYDGKNTRKEDLLQDGDFYGEELIDWALRDRFSFDIPKSNRTIQALTNVDAFMLMADDLKIVFNDMMNQLGLYD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query392 2.2.26 [Sep-21-2011]
O65717 716 Cyclic nucleotide-gated i yes no 0.862 0.472 0.442 4e-84
Q9LNJ0 711 Probable cyclic nucleotid no no 0.862 0.475 0.425 4e-76
Q9LD40696 Putative cyclic nucleotid no no 0.857 0.482 0.421 1e-75
Q9M0A4733 Putative cyclic nucleotid no no 0.854 0.457 0.398 3e-74
O82226 747 Probable cyclic nucleotid no no 0.862 0.452 0.403 7e-74
Q9SKD7 706 Probable cyclic nucleotid no no 0.857 0.475 0.413 7e-74
Q8RWS9717 Probable cyclic nucleotid no no 0.869 0.475 0.391 7e-71
Q9S9N5 738 Putative cyclic nucleotid no no 0.867 0.460 0.378 2e-68
Q9FXH6 753 Putative cyclic nucleotid no no 0.867 0.451 0.372 1e-67
Q9SL29678 Putative cyclic nucleotid no no 0.849 0.491 0.381 2e-64
>sp|O65717|CNGC1_ARATH Cyclic nucleotide-gated ion channel 1 OS=Arabidopsis thaliana GN=CNGC1 PE=1 SV=1 Back     alignment and function desciption
 Score =  312 bits (799), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 158/357 (44%), Positives = 232/357 (64%), Gaps = 19/357 (5%)

Query: 30  TWARFAFNLFVYLQAANVFGGLWYFMAIERQTECWTKACI--NYTGRSHCSFNCHDNLED 87
            WA  AFNLF+Y+ A++VFG  WY  +IER+T CW +AC   N    S   +   +    
Sbjct: 255 AWAGAAFNLFLYMLASHVFGAFWYLFSIERETVCWKQACERNNPPCISKLLYCDPETAGG 314

Query: 88  YTFLNEFCPMKTRNVTIHDFGIFHGALESGILEGKNFLQKILHCFIWGLQNLSNLSHNLQ 147
             FLNE CP++T N T+ DFGIF  AL+SG++E ++F QK  +CF WGLQNLS+L  NL+
Sbjct: 315 NAFLNESCPIQTPNTTLFDFGIFLDALQSGVVESQDFPQKFFYCFWWGLQNLSSLGQNLK 374

Query: 148 TSGNVEENIFVILVVSSGFLLFALLIGNMQRYLKLG----KEMTLKPREIEEWQPFQKLS 203
           TS  + E  F + +  +G +LF+ LIGNMQ YL+      +EM +K R+ E+W   + L 
Sbjct: 375 TSTYIWEICFAVFISIAGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLLP 434

Query: 204 KNLQQKVKKYKSYIRRKTDYIDVQNLLNNLPNELRRELKRELCWNLLKKVQGFRKLNEVT 263
           +NL++++++Y+ Y  ++T  +D +NLL+NLP +LRR++KR LC  LL +V  F K++E  
Sbjct: 435 ENLRKRIRRYEQYKWQETRGVDEENLLSNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQL 494

Query: 264 LDALCDCVKPTFFTEHTHLIREGDPIDEMIFVVQGKLRTYTFKDIQSGSTSSDHKRYDGK 323
           LDALCD ++P  +TE ++++REGDP+DEM+F+++GKL T T    ++G  +S++      
Sbjct: 495 LDALCDRLQPVLYTEESYIVREGDPVDEMLFIMRGKLLTITTNGGRTGFLNSEY------ 548

Query: 324 NTRKEDLLQDGDFYGEELIDWALRDRFSFDIPKSNRTIQALTNVDAFMLMADDLKIV 380
                  L  GDF GEEL+ WAL    S ++P S RT++AL  V+AF L ADDLK V
Sbjct: 549 -------LGAGDFCGEELLTWALDPHSSSNLPISTRTVRALMEVEAFALKADDLKFV 598
Acts as cyclic nucleotide-gated ion channel. Can be activated by cyclic AMP which leads to an opening of the cation channel. May be responsible for cAMP-induced calcium entry in cells and thus should be involved in the calcium signal transduction. Could transport K(+), Na(+) and Pb(2+).
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LNJ0|CNG10_ARATH Probable cyclic nucleotide-gated ion channel 10 OS=Arabidopsis thaliana GN=CNGC10 PE=2 SV=2 Back     alignment and function description
>sp|Q9LD40|CNG13_ARATH Putative cyclic nucleotide-gated ion channel 13 OS=Arabidopsis thaliana GN=CNGC13 PE=3 SV=2 Back     alignment and function description
>sp|Q9M0A4|CNGC9_ARATH Putative cyclic nucleotide-gated ion channel 9 OS=Arabidopsis thaliana GN=CNGC9 PE=1 SV=1 Back     alignment and function description
>sp|O82226|CNGC6_ARATH Probable cyclic nucleotide-gated ion channel 6 OS=Arabidopsis thaliana GN=CNGC6 PE=1 SV=2 Back     alignment and function description
>sp|Q9SKD7|CNGC3_ARATH Probable cyclic nucleotide-gated ion channel 3 OS=Arabidopsis thaliana GN=CNGC3 PE=2 SV=2 Back     alignment and function description
>sp|Q8RWS9|CNGC5_ARATH Probable cyclic nucleotide-gated ion channel 5 OS=Arabidopsis thaliana GN=CNGC5 PE=2 SV=1 Back     alignment and function description
>sp|Q9S9N5|CNGC7_ARATH Putative cyclic nucleotide-gated ion channel 7 OS=Arabidopsis thaliana GN=CNGC7 PE=2 SV=1 Back     alignment and function description
>sp|Q9FXH6|CNGC8_ARATH Putative cyclic nucleotide-gated ion channel 8 OS=Arabidopsis thaliana GN=CNGC8 PE=3 SV=2 Back     alignment and function description
>sp|Q9SL29|CNG15_ARATH Putative cyclic nucleotide-gated ion channel 15 OS=Arabidopsis thaliana GN=CNGC15 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query392
225462733 709 PREDICTED: cyclic nucleotide-gated ion c 0.885 0.489 0.442 1e-84
6969231 708 cyclic nucleotide-gated calmodulin-bindi 0.862 0.477 0.452 2e-84
224135235 708 predicted protein [Populus trichocarpa] 0.862 0.477 0.445 5e-83
15238657 716 cyclic nucleotide-gated ion channel 1 [A 0.862 0.472 0.442 2e-82
297796139 716 hypothetical protein ARALYDRAFT_918383 [ 0.862 0.472 0.445 3e-82
224118210 709 predicted protein [Populus trichocarpa] 0.862 0.476 0.430 3e-80
255545024 838 Cyclic nucleotide-gated ion channel, put 0.862 0.403 0.432 9e-80
356551532 718 PREDICTED: cyclic nucleotide-gated ion c 0.862 0.470 0.427 1e-79
449456377 713 PREDICTED: cyclic nucleotide-gated ion c 0.859 0.472 0.432 2e-78
449497318 714 PREDICTED: cyclic nucleotide-gated ion c 0.859 0.471 0.431 5e-77
>gi|225462733|ref|XP_002268992.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Vitis vinifera] gi|302143681|emb|CBI22542.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  319 bits (818), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 165/373 (44%), Positives = 236/373 (63%), Gaps = 26/373 (6%)

Query: 20  IRSLRKHATAT--------WARFAFNLFVYLQAANVFGGLWYFMAIERQTECWTKACINY 71
           +R L K  T T        WA  AFNLF+Y+ A++V G  WY  AI+R+T CWTKAC N 
Sbjct: 234 VRPLYKEVTRTSGILTETAWAGAAFNLFLYMLASHVLGAFWYLFAIDRETTCWTKACGND 293

Query: 72  TGRSHCSFNCHDNLEDYTFLNEFCPMKTRNVTIHDFGIFHGALESGILEGKNFLQKILHC 131
           T     S  C   + + T  N  CP+   N T+ DFGI   AL+SG++E  +F QK  +C
Sbjct: 294 TSCIDSSLYCKGTV-NTTLFNASCPVIEPNTTVFDFGILLDALQSGVVESTDFPQKFFYC 352

Query: 132 FIWGLQNLSNLSHNLQTSGNVEENIFVILVVSSGFLLFALLIGNMQRYLKLG----KEMT 187
           F WGLQNLS+L  NL+TS  V E  F + +  SG +LF+ LIGNMQ YL+      +EM 
Sbjct: 353 FWWGLQNLSSLGQNLKTSTYVWEICFAVFISISGLVLFSFLIGNMQTYLQSTTIRLEEMR 412

Query: 188 LKPREIEEWQPFQKLSKNLQQKVKKYKSYIRRKTDYIDVQNLLNNLPNELRRELKRELCW 247
           +K R+ E+W   + L ++L++++++Y+ Y  ++T  +D QNLL NLP +LRR++KR LC 
Sbjct: 413 VKRRDAEQWMSHRLLPESLRERIRRYEQYKWQETRGVDEQNLLINLPKDLRRDIKRHLCL 472

Query: 248 NLLKKVQGFRKLNEVTLDALCDCVKPTFFTEHTHLIREGDPIDEMIFVVQGKLRTYTFKD 307
            LL++V  F K++E  +DA+CD +KP  +TE ++++REGDP+DEM+FV++GKL T T   
Sbjct: 473 ALLRRVPMFEKMDEQLMDAMCDRLKPALYTEDSYIVREGDPVDEMLFVMRGKLSTMTTNG 532

Query: 308 IQSGSTSSDHKRYDGKNTRKEDLLQDGDFYGEELIDWALRDRFSFDIPKSNRTIQALTNV 367
            ++G  +SD+             L+ GDF GEEL+ WAL    + ++P S RT+ AL+ V
Sbjct: 533 GRTGFLNSDY-------------LKAGDFCGEELLTWALDPHSTSNLPISTRTVLALSEV 579

Query: 368 DAFMLMADDLKIV 380
           +AF LMADDLK V
Sbjct: 580 EAFALMADDLKFV 592

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|6969231|gb|AAF33670.1|AF079872_1 cyclic nucleotide-gated calmodulin-binding ion channel [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|224135235|ref|XP_002322017.1| predicted protein [Populus trichocarpa] gi|222869013|gb|EEF06144.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15238657|ref|NP_200125.1| cyclic nucleotide-gated ion channel 1 [Arabidopsis thaliana] gi|38502855|sp|O65717.1|CNGC1_ARATH RecName: Full=Cyclic nucleotide-gated ion channel 1; Short=AtCNGC1; AltName: Full=Cyclic nucleotide- and calmodulin-regulated ion channel 1 gi|13877753|gb|AAK43954.1|AF370139_1 putative cyclic nucleotide-regulated ion channel protein [Arabidopsis thaliana] gi|3096947|emb|CAA76178.1| putative cyclic nucleotide-regulated ion channel [Arabidopsis thaliana] gi|9757994|dbj|BAB08416.1| cyclic nucleotide-regulated ion channel [Arabidopsis thaliana] gi|24030485|gb|AAN41391.1| putative cyclic nucleotide-regulated ion channel protein [Arabidopsis thaliana] gi|332008928|gb|AED96311.1| cyclic nucleotide-gated ion channel 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297796139|ref|XP_002865954.1| hypothetical protein ARALYDRAFT_918383 [Arabidopsis lyrata subsp. lyrata] gi|297311789|gb|EFH42213.1| hypothetical protein ARALYDRAFT_918383 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224118210|ref|XP_002317760.1| predicted protein [Populus trichocarpa] gi|222858433|gb|EEE95980.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255545024|ref|XP_002513573.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] gi|223547481|gb|EEF48976.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356551532|ref|XP_003544128.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Glycine max] Back     alignment and taxonomy information
>gi|449456377|ref|XP_004145926.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449497318|ref|XP_004160370.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query392
TAIR|locus:2163776 716 CNGC1 "cyclic nucleotide gated 0.859 0.470 0.387 1.6e-63
TAIR|locus:2039084 706 CNGC3 "cyclic nucleotide gated 0.854 0.474 0.370 3.2e-58
TAIR|locus:2125206696 CNGC13 "cyclic nucleotide-gate 0.854 0.481 0.378 4e-58
TAIR|locus:2061401 747 CNGC6 "cyclic nucleotide-gated 0.869 0.456 0.357 1.4e-55
TAIR|locus:2118836733 CNGC9 "cyclic nucleotide gated 0.869 0.465 0.358 2.9e-55
TAIR|locus:2174448717 CNGC5 "cyclic nucleotide gated 0.867 0.474 0.352 1.1e-53
TAIR|locus:2200502 738 CNGC7 "cyclic nucleotide gated 0.867 0.460 0.337 1.7e-50
TAIR|locus:2013139 753 CNGC8 "cyclic nucleotide gated 0.864 0.450 0.336 2.5e-49
TAIR|locus:2062814678 CNGC15 "cyclic nucleotide-gate 0.846 0.489 0.336 6.7e-49
TAIR|locus:2046703 726 CNGC14 "cyclic nucleotide-gate 0.864 0.466 0.333 1.6e-48
TAIR|locus:2163776 CNGC1 "cyclic nucleotide gated channel 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 648 (233.2 bits), Expect = 1.6e-63, P = 1.6e-63
 Identities = 138/356 (38%), Positives = 206/356 (57%)

Query:    31 WARFAFNLFVYLQAANVFGGLWYFMAIERQTECWTKACI--NYTGRSHCSFNCHDNLEDY 88
             WA  AFNLF+Y+ A++VFG  WY  +IER+T CW +AC   N    S   +   +     
Sbjct:   256 WAGAAFNLFLYMLASHVFGAFWYLFSIERETVCWKQACERNNPPCISKLLYCDPETAGGN 315

Query:    89 TFLNEFCPMKTRNVTIHDFGIFHGALESGILEGKNFLQKILHCFIWGXXXXXXXXXXXXT 148
              FLNE CP++T N T+ DFGIF  AL+SG++E ++F QK  +CF WG            T
Sbjct:   316 AFLNESCPIQTPNTTLFDFGIFLDALQSGVVESQDFPQKFFYCFWWGLQNLSSLGQNLKT 375

Query:   149 SGNVEENIFVILVVSSGFLLFALLIGNMQRYLKLG----KEMTLKPREIEEWQPFQKLSK 204
             S  + E  F + +  +G +LF+ LIGNMQ YL+      +EM +K R+ E+W   + L +
Sbjct:   376 STYIWEICFAVFISIAGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLLPE 435

Query:   205 NLQQKVKKYKSYIRRKTDYIDVQXXXXXXXXXXXXXXXXXXCWNLLKKVQGFRKLNEVTL 264
             NL++++++Y+ Y  ++T  +D +                  C  LL +V  F K++E  L
Sbjct:   436 NLRKRIRRYEQYKWQETRGVDEENLLSNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLL 495

Query:   265 DALCDCVKPTFFTEHTHLIREGDPIDEMIFVVQGKLRTYTFKDIQSGSTSSDHKRYDGKN 324
             DALCD ++P  +TE ++++REGDP+DEM+F+++GKL T T    ++G  +S++       
Sbjct:   496 DALCDRLQPVLYTEESYIVREGDPVDEMLFIMRGKLLTITTNGGRTGFLNSEY------- 548

Query:   325 TRKEDLLQDGDFYGEELIDWALRDRFSFDIPKSNRTIQALTNVDAFMLMADDLKIV 380
                   L  GDF GEEL+ WAL    S ++P S RT++AL  V+AF L ADDLK V
Sbjct:   549 ------LGAGDFCGEELLTWALDPHSSSNLPISTRTVRALMEVEAFALKADDLKFV 598
GO:0005216 "ion channel activity" evidence=IEA
GO:0005261 "cation channel activity" evidence=ISS
GO:0005516 "calmodulin binding" evidence=ISS;TAS;IPI
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006811 "ion transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0030551 "cyclic nucleotide binding" evidence=ISS
GO:0055085 "transmembrane transport" evidence=IEA
GO:0005242 "inward rectifier potassium channel activity" evidence=IGI
GO:0005221 "intracellular cyclic nucleotide activated cation channel activity" evidence=IGI
GO:0006813 "potassium ion transport" evidence=IGI
GO:0006816 "calcium ion transport" evidence=IGI
TAIR|locus:2039084 CNGC3 "cyclic nucleotide gated channel 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125206 CNGC13 "cyclic nucleotide-gated channel 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061401 CNGC6 "cyclic nucleotide-gated channel 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118836 CNGC9 "cyclic nucleotide gated channel 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174448 CNGC5 "cyclic nucleotide gated channel 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200502 CNGC7 "cyclic nucleotide gated channel 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013139 CNGC8 "cyclic nucleotide gated channel 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062814 CNGC15 "cyclic nucleotide-gated channel 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046703 CNGC14 "cyclic nucleotide-gated channel 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query392
cd00038115 cd00038, CAP_ED, effector domain of the CAP family 1e-11
smart00100120 smart00100, cNMP, Cyclic nucleotide-monophosphate 5e-09
pfam0002791 pfam00027, cNMP_binding, Cyclic nucleotide-binding 5e-06
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 2e-05
>gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information 
 Score = 61.2 bits (149), Expect = 1e-11
 Identities = 29/132 (21%), Positives = 52/132 (39%), Gaps = 27/132 (20%)

Query: 256 FRKLNEVTLDALCDCVKPTFFTEHTHLIREGDPIDEMIFVVQGKLRTYTFKDIQSGSTSS 315
           F  L++  L+ L D ++   F     +IR+GDP D +  V+ G +  Y   +        
Sbjct: 2   FSGLDDEELEELADALEERRFPAGEVIIRQGDPADSLYIVLSGSVEVYKLDE-------- 53

Query: 316 DHKRYDGKNTRKEDLLQDGDFYGEELIDWALRDRFSFDIPKSNRTIQALTNVDAFMLMAD 375
                DG+       L  GD +GE  +               + T++ALT+ +  +L   
Sbjct: 54  -----DGREQ-IVGFLGPGDLFGELAL---------LGNGPRSATVRALTDSELLVLPRS 98

Query: 376 DLKIVFNDMMNQ 387
           D    F  ++ +
Sbjct: 99  D----FRRLLQE 106

In all cases binding of the effector leads to conformational changes and the ability to activate transcription. Cyclic nucleotide-binding domain similar to CAP are also present in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) and vertebrate cyclic nucleotide-gated ion-channels. Cyclic nucleotide-monophosphate binding domain; proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues; the best studied is the prokaryotic catabolite gene activator, CAP, where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure; three conserved glycine residues are thought to be essential for maintenance of the structural integrity of the beta-barrel; CooA is a homodimeric transcription factor that belongs to CAP family; cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain; cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain; cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section; also found in vertebrate cyclic nucleotide-gated ion-channels. Length = 115
>gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>gnl|CDD|215664 pfam00027, cNMP_binding, Cyclic nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 392
KOG0498 727 consensus K+-channel ERG and related proteins, con 100.0
KOG0500 536 consensus Cyclic nucleotide-gated cation channel C 100.0
PLN03192 823 Voltage-dependent potassium channel; Provisional 100.0
KOG0501 971 consensus K+-channel KCNQ [Inorganic ion transport 100.0
KOG0499 815 consensus Cyclic nucleotide-gated cation channel C 100.0
cd00038115 CAP_ED effector domain of the CAP family of transc 99.53
PRK09392 236 ftrB transcriptional activator FtrB; Provisional 99.51
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 99.48
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 99.46
smart00100120 cNMP Cyclic nucleotide-monophosphate binding domai 99.43
KOG0614 732 consensus cGMP-dependent protein kinase [Signal tr 99.38
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 99.34
KOG1113 368 consensus cAMP-dependent protein kinase types I an 99.34
PRK11161 235 fumarate/nitrate reduction transcriptional regulat 99.31
COG0664214 Crp cAMP-binding proteins - catabolite gene activa 99.3
KOG0614 732 consensus cGMP-dependent protein kinase [Signal tr 99.3
PF0788579 Ion_trans_2: Ion channel; InterPro: IPR013099 This 99.29
PLN02868 413 acyl-CoA thioesterase family protein 99.27
COG2905 610 Predicted signal-transduction protein containing c 99.22
PRK09391230 fixK transcriptional regulator FixK; Provisional 99.1
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 99.07
KOG1113368 consensus cAMP-dependent protein kinase types I an 98.99
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 98.94
KOG3713477 consensus Voltage-gated K+ channel KCNB/KCNC [Inor 98.54
KOG1419 654 consensus Voltage-gated K+ channel KCNQ [Inorganic 98.5
PRK10537393 voltage-gated potassium channel; Provisional 98.45
PF00520200 Ion_trans: Ion transport protein calcium channel s 98.35
PF01007336 IRK: Inward rectifier potassium channel; InterPro: 98.31
KOG2968 1158 consensus Predicted esterase of the alpha-beta hyd 98.07
KOG3684489 consensus Ca2+-activated K+ channel proteins (inte 98.06
KOG1418433 consensus Tandem pore domain K+ channel [Inorganic 97.96
KOG1545507 consensus Voltage-gated shaker-like K+ channel KCN 97.75
KOG2968 1158 consensus Predicted esterase of the alpha-beta hyd 97.63
KOG1420 1103 consensus Ca2+-activated K+ channel Slowpoke, alph 97.49
KOG3827400 consensus Inward rectifier K+ channel [Inorganic i 97.01
PRK11832207 putative DNA-binding transcriptional regulator; Pr 97.0
KOG4390632 consensus Voltage-gated A-type K+ channel KCND [In 96.96
PF04831153 Popeye: Popeye protein conserved region; InterPro: 96.94
KOG4404350 consensus Tandem pore domain K+ channel TASK3/THIK 96.92
KOG4404350 consensus Tandem pore domain K+ channel TASK3/THIK 96.92
KOG3542 1283 consensus cAMP-regulated guanine nucleotide exchan 96.47
KOG1418433 consensus Tandem pore domain K+ channel [Inorganic 95.34
KOG3542 1283 consensus cAMP-regulated guanine nucleotide exchan 94.21
KOG3193 1087 consensus K+ channel subunit [Inorganic ion transp 87.69
PF08006181 DUF1700: Protein of unknown function (DUF1700); In 85.36
COG4709195 Predicted membrane protein [Function unknown] 85.36
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 81.3
>KOG0498 consensus K+-channel ERG and related proteins, contain PAS/PAC sensor domain [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=2.8e-63  Score=505.02  Aligned_cols=329  Identities=36%  Similarity=0.606  Sum_probs=286.7

Q ss_pred             eeeeccCCcc--hhhhhHHhhhh----hhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHHHHhccCCCCCCCcc
Q 042233            5 LLIETMGGPK--ICGFTIRSLRK----HATATWARFAFNLFVYLQAANVFGGLWYFMAIERQTECWTKACINYTGRSHCS   78 (392)
Q Consensus         5 ~~~~~~~~~~--~~~~~~~~~~~----~~~~~w~~~~~~l~~~~l~~H~~aC~w~~i~~~~~~~~~~~~~~~~~~~~~~~   78 (392)
                      .++++-.+|+  ++-...+++.|    ++.++|++++++++++++++||.||+||++|+++.+.||              
T Consensus       199 ~il~~~rL~Rl~Rv~~l~~r~~k~~~~v~~~awa~~a~ll~~~~l~sH~~gc~wYlia~~~~~~~~--------------  264 (727)
T KOG0498|consen  199 GILLLQRLPRLRRVIPLFARLEKDTGFVYETAWAGAALLLSVYLLASHWAGCIWYLIAIERPASCP--------------  264 (727)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccCc--------------
Confidence            3455666777  33333444443    448899999899999999999999999999988887776              


Q ss_pred             cccCCCCccc-chhccccCCCCCCCCcccccceeccccccccCCcchHHHHHHHHHHHHHhhcccccccccCCChhhHHH
Q 042233           79 FNCHDNLEDY-TFLNEFCPMKTRNVTIHDFGIFHGALESGILEGKNFLQKILHCFIWGLQNLSNLSHNLQTSGNVEENIF  157 (392)
Q Consensus        79 ~~~~~~~~~~-sWi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~Yi~s~Ywa~~t~ttvGyGdi~p~~~~E~~~  157 (392)
                              .. +|+...+...+..+..|+||+            .+++.+|++|+||+++||||+||||++|+|..|++|
T Consensus       265 --------~~~tw~~~l~~~~~~~~~~~~fg~------------~s~~~kY~~aLyw~l~tLstvG~g~~~s~~~~E~iF  324 (727)
T KOG0498|consen  265 --------RKATWLGSLGRLLSCYNLSFTFGI------------YSLALKYVYALYWGLSTLSTVGYGLVHANNMGEKIF  324 (727)
T ss_pred             --------cccccccccccccccCcccccccc------------hhHHHHHHHHHHHHhhHhhhccCCccCCCCcHHHHH
Confidence                    23 788764311112333466755            567779999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH----HHHhcchhHHHhhcccccCcHHHHHHHHHHHHHHHhhcCCCcHHHHHhhC
Q 042233          158 VILVVSSGFLLFALLIGNMQRYLKLG----KEMTLKPREIEEWQPFQKLSKNLQQKVKKYKSYIRRKTDYIDVQNLLNNL  233 (392)
Q Consensus       158 ~i~~~i~g~~~~a~iig~i~~il~~~----~~~~~~~~~l~~~m~~~~lp~~L~~ri~~y~~~~~~~~~~~~~~~il~~L  233 (392)
                      +|++|++|.++||++||||+++++..    ++|+.++.++++||++++||++||+||++|++|+|+..+++|++++|+.|
T Consensus       325 si~~mi~GllL~A~lIGNmt~~iqs~tsR~~~~r~k~rd~e~~m~~~~LP~~LRqRi~~y~q~kw~~t~Gvdee~lL~~L  404 (727)
T KOG0498|consen  325 SIFIMLFGLLLFAYLIGNMTALLQSLTSRTEEMRDKMRDAEQWMSRRQLPPDLRQRIRRYEQYKWLATRGVDEEELLQSL  404 (727)
T ss_pred             HHHHHHHhHHHHHHHHhhHHHhHHHHhHHHHHHHHHHHHHHHHHHhccCCHHHHHHHHHHHHHHHhhccCcCHHHHHHhC
Confidence            99999999999999999999999998    89999999999999999999999999999999999999999999999999


Q ss_pred             cHHHHHHHHHHHHHHHhhcccccccCcHHHHHHHhhhcceeeeCCCCEEEecCCCCCeEEEEEeeeEEEEEecCCccCcc
Q 042233          234 PNELRRELKRELCWNLLKKVQGFRKLNEVTLDALCDCVKPTFFTEHTHLIREGDPIDEMIFVVQGKLRTYTFKDIQSGST  313 (392)
Q Consensus       234 p~~Lr~ei~~~~~~~~l~~i~~F~~~s~~~l~~l~~~l~~~~~~~ge~I~~~gd~~~~lyfI~~G~V~v~~~~~~~~~~~  313 (392)
                      |+.||++|..+++.++++++|+|+++|++++.+|+.++++.+|+|||+|++|||+.++||||.+|.+++...+++.    
T Consensus       405 P~~LR~dI~~hL~~~lv~~vpLF~~md~~~L~al~~rlk~~~f~pge~iireGd~v~~myFI~rG~le~~~~~~g~----  480 (727)
T KOG0498|consen  405 PKDLRRDIKRHLCLDLVRKVPLFAGMDDGLLDALCSRLKPEYFTPGEYIIREGDPVTDMYFIVRGSLESITTDGGG----  480 (727)
T ss_pred             CHHHHHHHHHHHhHHHHhhCchhhcCCHHHHHHHHHHhhhhccCCCCeEEecCCccceeEEEEeeeEEEEEccCCc----
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999876542    


Q ss_pred             cCCcccccCccccccccccCCCeechhhhhhhhccCCCCCCCCcceeEEEcceEEEEEecHHHHHHHHHHcHHhhc
Q 042233          314 SSDHKRYDGKNTRKEDLLQDGDFYGEELIDWALRDRFSFDIPKSNRTIQALTNVDAFMLMADDLKIVFNDMMNQLG  389 (392)
Q Consensus       314 ~~~~~~~~~~~~~~i~~l~~G~~FGe~~ll~~l~~~~~~~~~~r~~tv~A~~~~~l~~L~~~~f~~ll~~~P~~~~  389 (392)
                                 +.++..|++||+|||.-+.++++      .| +++||+|++.|+++.|++++|.+++++||++-.
T Consensus       481 -----------~~~~~~L~~Gd~~GeEl~~~~~~------~p-~t~TVralt~~el~~L~~~dL~~V~~~f~~~~~  538 (727)
T KOG0498|consen  481 -----------FFVVAILGPGDFFGEELLTWCLD------LP-QTRTVRALTYCELFRLSADDLKEVLQQFRRLGS  538 (727)
T ss_pred             -----------eEEEEEecCCCccchHHHHHHhc------CC-CCceeehhhhhhHHhccHHHHHHHHHHhHHHHH
Confidence                       35677999999999555555542      22 378999999999999999999999999997643

>KOG0500 consensus Cyclic nucleotide-gated cation channel CNGA1-3 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0499 consensus Cyclic nucleotide-gated cation channel CNCG4 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>smart00100 cNMP Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>KOG1113 consensus cAMP-dependent protein kinase types I and II, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>KOG1113 consensus cAMP-dependent protein kinase types I and II, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>KOG3713 consensus Voltage-gated K+ channel KCNB/KCNC [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1419 consensus Voltage-gated K+ channel KCNQ [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins Back     alignment and domain information
>PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>KOG2968 consensus Predicted esterase of the alpha-beta hydrolase superfamily (Neuropathy target esterase), contains cAMP-binding domains [General function prediction only] Back     alignment and domain information
>KOG3684 consensus Ca2+-activated K+ channel proteins (intermediate/small conductance classes) [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1418 consensus Tandem pore domain K+ channel [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1545 consensus Voltage-gated shaker-like K+ channel KCNA [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2968 consensus Predicted esterase of the alpha-beta hydrolase superfamily (Neuropathy target esterase), contains cAMP-binding domains [General function prediction only] Back     alignment and domain information
>KOG1420 consensus Ca2+-activated K+ channel Slowpoke, alpha subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG3827 consensus Inward rectifier K+ channel [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11832 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>KOG4390 consensus Voltage-gated A-type K+ channel KCND [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle Back     alignment and domain information
>KOG4404 consensus Tandem pore domain K+ channel TASK3/THIK-1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4404 consensus Tandem pore domain K+ channel TASK3/THIK-1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1418 consensus Tandem pore domain K+ channel [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG3193 consensus K+ channel subunit [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF08006 DUF1700: Protein of unknown function (DUF1700); InterPro: IPR012963 This family contains many hypothetical bacterial proteins and two putative membrane proteins (Q6GFD0 from SWISSPROT and Q6G806 from SWISSPROT) Back     alignment and domain information
>COG4709 Predicted membrane protein [Function unknown] Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query392
1wgp_A137 Solution Structure Of The Cnmp-Binding Domain From 7e-25
>pdb|1WGP|A Chain A, Solution Structure Of The Cnmp-Binding Domain From Arabidopsis Thaliana Cyclic Nucleotide-Regulated Ion Channel Length = 137 Back     alignment and structure 
Iteration: 1

 Score =  111 bits (278), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 86/131 (65%), Gaps = 13/131 (9%)
Query: 250 LKKVQGFRKLNEVTLDALCDCVKPTFFTEHTHLIREGDPIDEMIFVVQGKLRTYTFKDIQ 309
           +++V  F  ++E  LDA+C+ +KP  FTE ++L+REGDP++EM+F+++G+L + T     
Sbjct: 8   VRRVPLFENMDERLLDAICERLKPCLFTEKSYLVREGDPVNEMLFIIRGRLESVT----T 63
Query: 310 SGSTSSDHKRYDGKNTRKEDLLQDGDFYGEELIDWALRDRFSFDIPKSNRTIQALTNVDA 369
            G  S  + R          LL++GDF G+EL+ WAL  +   ++P S RT++ALT V+A
Sbjct: 64  DGGRSGFYNR---------SLLKEGDFCGDELLTWALDPKSGSNLPSSTRTVKALTEVEA 114
Query: 370 FMLMADDLKIV 380
           F L+AD+LK V
Sbjct: 115 FALIADELKFV 125

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query392
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 8e-38
3ukn_A212 Novel protein similar to vertebrate potassium VOL 8e-37
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 1e-36
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 5e-31
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 4e-30
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 7e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-10
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 2e-09
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 3e-07
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 7e-09
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 1e-08
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 2e-08
2qcs_B 291 CAMP-dependent protein kinase type I-alpha regula 1e-06
4din_B381 CAMP-dependent protein kinase type I-beta regulat 3e-08
4din_B 381 CAMP-dependent protein kinase type I-beta regulat 5e-06
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 7e-08
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 8e-08
3shr_A 299 CGMP-dependent protein kinase 1; cyclic nucleotide 8e-08
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 1e-07
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 2e-07
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 3e-07
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 3e-07
3of1_A 246 CAMP-dependent protein kinase regulatory subunit; 5e-07
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 4e-07
2pqq_A149 Putative transcriptional regulator; APC7345, strep 4e-07
3fx3_A 237 Cyclic nucleotide-binding protein; helix_TURN_heli 5e-07
2fmy_A 220 COOA, carbon monoxide oxidation system transcripti 7e-07
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 9e-07
3e6c_C 250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 1e-06
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 1e-06
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 1e-06
3e97_A 231 Transcriptional regulator, CRP/FNR family; YP_6044 1e-06
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 2e-06
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 3e-06
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 3e-06
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 4e-06
1ft9_A 222 Carbon monoxide oxidation system transcription reg 4e-06
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 4e-06
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 1e-05
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 1e-05
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 4e-05
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 6e-05
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 6e-05
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 8e-05
2gau_A 232 Transcriptional regulator, CRP/FNR family; structu 2e-04
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Length = 198 Back     alignment and structure
 Score =  134 bits (339), Expect = 8e-38
 Identities = 36/200 (18%), Positives = 77/200 (38%), Gaps = 28/200 (14%)

Query: 184 KEMTLKPREIEEWQPFQKLSKNLQQKVKKYKSYIRRKTDYIDVQNLLNNLPNELRRELKR 243
           ++   K +++EE+  ++KL  +L+ K+  Y  Y R +    D +++   +   +R+++  
Sbjct: 8   RQYREKLKQVEEYMQYRKLPSHLRNKILDYYEY-RYRGKMFDERHIFREVSESIRQDVAN 66

Query: 244 ELCWNLLKKVQGFRKLNEVTLDALCDCVKPTFFTEHTHLIREGDPIDEMIFVVQGKLRTY 303
             C +L+  V  F   +   +  +   ++   F    ++I+EG   D M F+ QG +   
Sbjct: 67  YNCRDLVASVPFFVGADSNFVTRVVTLLEFEVFQPADYVIQEGTFGDRMFFIQQGIVDII 126

Query: 304 TFKDIQSGSTSSDHKRYDGKNTRKEDLLQDGDFYGEELIDWALRDRFSFDIPKSNRTIQA 363
                            DG        L DG ++GE  +             +   +++ 
Sbjct: 127 MS---------------DGVIAT---SLSDGSYFGEICLLTR---------ERRVASVKC 159

Query: 364 LTNVDAFMLMADDLKIVFND 383
            T    F L       V ++
Sbjct: 160 ETYCTLFSLSVQHFNQVLDE 179
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Length = 212 Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Length = 202 Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Length = 137 Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Length = 160 Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Length = 138 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Length = 142 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Length = 161 Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Length = 139 Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Length = 154 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Length = 149 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Length = 237 Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Length = 220 Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Length = 227 Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Length = 250 Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Length = 154 Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Length = 194 Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Length = 231 Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Length = 213 Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Length = 216 Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Length = 227 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Length = 222 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Length = 260 Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Length = 333 Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Length = 220 Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Length = 230 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Length = 210 Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Length = 207 Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query392
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 100.0
3ukn_A212 Novel protein similar to vertebrate potassium VOL 100.0
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 100.0
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 99.97
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 99.85
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 99.78
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 99.75
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 99.74
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 99.74
2pqq_A149 Putative transcriptional regulator; APC7345, strep 99.72
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 99.72
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 99.71
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 99.7
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 99.69
3shr_A 299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.68
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 99.68
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 99.67
3fx3_A 237 Cyclic nucleotide-binding protein; helix_TURN_heli 99.66
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 99.66
3e97_A 231 Transcriptional regulator, CRP/FNR family; YP_6044 99.66
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 99.66
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 99.64
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 99.64
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 99.64
4h33_A137 LMO2059 protein; bilayers, KVLM, lipidic cubic pha 99.63
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.63
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 99.63
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 99.63
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 99.62
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 99.62
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.61
2gau_A 232 Transcriptional regulator, CRP/FNR family; structu 99.61
3of1_A 246 CAMP-dependent protein kinase regulatory subunit; 99.6
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 99.59
2qcs_B 291 CAMP-dependent protein kinase type I-alpha regula 99.58
4din_B381 CAMP-dependent protein kinase type I-beta regulat 99.57
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 99.57
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.56
3eff_K139 Voltage-gated potassium channel; FULL length KCSA, 99.56
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 99.54
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 99.53
4din_B 381 CAMP-dependent protein kinase type I-beta regulat 99.53
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.51
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 99.5
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.5
2fmy_A 220 COOA, carbon monoxide oxidation system transcripti 99.49
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 99.49
1ft9_A 222 Carbon monoxide oxidation system transcription reg 99.48
1orq_C223 Potassium channel; voltage-dependent, KVAP, FAB co 99.47
2a9h_A155 Voltage-gated potassium channel; potassium channel 99.44
3e6c_C 250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 99.43
2ih3_C122 Voltage-gated potassium channel; ION channel D-ami 99.42
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 99.4
2k1e_A103 Water soluble analogue of potassium channel, KCSA; 99.39
3ouf_A97 Potassium channel protein; ION channel, membrane, 99.38
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 99.37
2q67_A114 Potassium channel protein; inverted teepee, helix 99.36
2bgc_A 238 PRFA; bacterial infection, human pathogen, transcr 99.35
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.35
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 99.33
1xl4_A301 Inward rectifier potassium channel; integral membr 99.24
2r9r_B514 Paddle chimera voltage gated potassium channel KV; 99.22
1p7b_A333 Integral membrane channel and cytosolic domains; t 99.16
3b02_A195 Transcriptional regulator, CRP family; structural 99.13
3pjs_K166 KCSA, voltage-gated potassium channel; ION channel 99.1
3um7_A309 Potassium channel subfamily K member 4; potassium 99.04
2qks_A321 KIR3.1-prokaryotic KIR channel chimera; G-protein 99.0
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 98.99
3sya_A340 G protein-activated inward rectifier potassium CH; 98.95
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 98.93
3spc_A343 Inward-rectifier K+ channel KIR2.2; PIP, membrane 98.81
3ukm_A280 Potassium channel subfamily K member 1; membrane p 98.8
3um7_A309 Potassium channel subfamily K member 4; potassium 98.78
3ukm_A280 Potassium channel subfamily K member 1; membrane p 98.71
1lnq_A336 MTHK channels, potassium channel related protein; 98.48
3rvy_A285 ION transport protein; tetrameric ION channel, vol 97.6
4dxw_A229 Navrh, ION transport protein; tetrameric, voltage- 84.51
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
Probab=100.00  E-value=4.5e-32  Score=241.63  Aligned_cols=178  Identities=19%  Similarity=0.326  Sum_probs=165.3

Q ss_pred             HHHhcchhHHHhhcccccCcHHHHHHHHHHHHHHHhhcCCCcHHHHHhhCcHHHHHHHHHHHHHHHhhcccccccCcHHH
Q 042233          184 KEMTLKPREIEEWQPFQKLSKNLQQKVKKYKSYIRRKTDYIDVQNLLNNLPNELRRELKRELCWNLLKKVQGFRKLNEVT  263 (392)
Q Consensus       184 ~~~~~~~~~l~~~m~~~~lp~~L~~ri~~y~~~~~~~~~~~~~~~il~~Lp~~Lr~ei~~~~~~~~l~~i~~F~~~s~~~  263 (392)
                      .+|+++++.+++||+++++|++||.||++||+|.|+. ++.+++++++.||++||.++..+++.++++++|+|+++|+++
T Consensus         8 ~~~~~~~~~i~~~m~~~~i~~~l~~rv~~y~~~~~~~-~~~~e~~il~~l~~~Lr~~i~~~~~~~~l~~~~~f~~l~~~~   86 (198)
T 2ptm_A            8 RQYREKLKQVEEYMQYRKLPSHLRNKILDYYEYRYRG-KMFDERHIFREVSESIRQDVANYNCRDLVASVPFFVGADSNF   86 (198)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHTT-CCCCSHHHHHHSCHHHHHHHHHHHTHHHHHHCGGGTTCCHHH
T ss_pred             HHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHcc-cCCCHHHHHHHcCHHHHHHHHHHHHHHHHhcCcchhcCCHHH
Confidence            7899999999999999999999999999999999974 678899999999999999999999999999999999999999


Q ss_pred             HHHHhhhcceeeeCCCCEEEecCCCCCeEEEEEeeeEEEEEecCCccCcccCCcccccCccccccccccCCCeechhhhh
Q 042233          264 LDALCDCVKPTFFTEHTHLIREGDPIDEMIFVVQGKLRTYTFKDIQSGSTSSDHKRYDGKNTRKEDLLQDGDFYGEELID  343 (392)
Q Consensus       264 l~~l~~~l~~~~~~~ge~I~~~gd~~~~lyfI~~G~V~v~~~~~~~~~~~~~~~~~~~~~~~~~i~~l~~G~~FGe~~ll  343 (392)
                      +..++..++++.|.|||+|+++||+++.+|||.+|.|+++..++                  .++..+++|++||+.+++
T Consensus        87 l~~l~~~~~~~~~~~ge~I~~~G~~~~~ly~I~~G~v~~~~~~g------------------~~~~~l~~G~~fGe~~~~  148 (198)
T 2ptm_A           87 VTRVVTLLEFEVFQPADYVIQEGTFGDRMFFIQQGIVDIIMSDG------------------VIATSLSDGSYFGEICLL  148 (198)
T ss_dssp             HHHHHHHCEEEEECTTCEEECTTSCCSEEEEEEECCEEEECTTS------------------CEEEEECTTCEESCHHHH
T ss_pred             HHHHHHhccceeeCCCCEEEECCCcCcEEEEEEeCEEEEEecCC------------------eEEEEecCCCEechHHHc
Confidence            99999999999999999999999999999999999999987332                  256689999999999885


Q ss_pred             hhhccCCCCCCCCcceeEEEcceEEEEEecHHHHHHHHHHcHHhhc
Q 042233          344 WALRDRFSFDIPKSNRTIQALTNVDAFMLMADDLKIVFNDMMNQLG  389 (392)
Q Consensus       344 ~~l~~~~~~~~~~r~~tv~A~~~~~l~~L~~~~f~~ll~~~P~~~~  389 (392)
                      .         ..+++++++|.++|+++.|++++|.++++++|++..
T Consensus       149 ~---------~~~~~~~~~a~~~~~l~~i~~~~f~~ll~~~p~~~~  185 (198)
T 2ptm_A          149 T---------RERRVASVKCETYCTLFSLSVQHFNQVLDEFPAMRK  185 (198)
T ss_dssp             H---------SSCCSSEEEESSCEEEEEEEHHHHHHHHHHCHHHHH
T ss_pred             C---------CCccceEEEEeeEEEEEEEeHHHHHHHHHHChHHHH
Confidence            4         234778999999999999999999999999999864
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Back     alignment and structure
>2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Back     alignment and structure
>2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A Back     alignment and structure
>1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Back     alignment and structure
>1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Back     alignment and structure
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Back     alignment and structure
>2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* Back     alignment and structure
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Back     alignment and structure
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Back     alignment and structure
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* Back     alignment and structure
>4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 392
d1wgpa_137 b.82.3.2 (A:) Probable cyclic nucleotide-gated ion 7e-13
d1q3ea_193 b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus mu 2e-08
d1o7fa2155 b.82.3.2 (A:13-167) Regulatory domain of Epac2, do 1e-06
d1vp6a_133 b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizo 2e-05
d1cx4a1136 b.82.3.2 (A:130-265) Regulatory subunit of Protein 1e-04
d1ne6a1136 b.82.3.2 (A:109-244) Regulatory subunit of Protein 3e-04
d1o7fa3124 b.82.3.2 (A:322-445) Regulatory domain of Epac2, d 4e-04
d1ne6a2132 b.82.3.2 (A:245-376) Regulatory subunit of Protein 0.001
d2gaua2142 b.82.3.2 (A:10-151) Transcriptional regulator PG03 0.002
d1lnqa280 f.14.1.1 (A:19-98) Potassium channel-related prote 0.002
d1cx4a2147 b.82.3.2 (A:266-412) Regulatory subunit of Protein 0.003
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 137 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Probable cyclic nucleotide-gated ion channel 6
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 63.4 bits (153), Expect = 7e-13
 Identities = 51/134 (38%), Positives = 83/134 (61%), Gaps = 13/134 (9%)

Query: 249 LLKKVQGFRKLNEVTLDALCDCVKPTFFTEHTHLIREGDPIDEMIFVVQGKLRTYTFKDI 308
            +++V  F  ++E  LDA+C+ +KP  FTE ++L+REGDP++EM+F+++G+L + T    
Sbjct: 7   GVRRVPLFENMDERLLDAICERLKPCLFTEKSYLVREGDPVNEMLFIIRGRLESVTTDG- 65

Query: 309 QSGSTSSDHKRYDGKNTRKEDLLQDGDFYGEELIDWALRDRFSFDIPKSNRTIQALTNVD 368
                                LL++GDF G+EL+ WAL  +   ++P S RT++ALT V+
Sbjct: 66  ------------GRSGFYNRSLLKEGDFCGDELLTWALDPKSGSNLPSSTRTVKALTEVE 113

Query: 369 AFMLMADDLKIVFN 382
           AF L+AD+LK V +
Sbjct: 114 AFALIADELKFVAS 127
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Length = 193 Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 155 Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Length = 133 Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 136 Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 124 Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 132 Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Length = 142 Back     information, alignment and structure
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 147 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query392
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 100.0
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 99.88
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 99.81
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 99.8
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.8
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 99.79
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 99.79
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.77
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 99.77
d1zyba2147 Probable transcription regulator BT4300, N-termina 99.73
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 99.66
d1i5za2132 Catabolite gene activator protein, N-terminal doma 99.62
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 99.6
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 99.56
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 99.56
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 99.55
d1r3jc_103 Potassium channel protein {Streptomyces coelicolor 99.53
d1xl4a2116 Inward rectifier potassium channel kirbac3.1 {Magn 99.47
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 99.45
d1p7ba2116 Inward rectifier potassium channel Kirbac1.1 {Burk 99.39
d1lnqa280 Potassium channel-related protein MthK {Archaeon M 99.09
d2h8pc157 Potassium channel protein {Streptomyces coelicolor 97.42
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 89.53
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: HCN pacemaker channel
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=7.7e-33  Score=243.90  Aligned_cols=178  Identities=22%  Similarity=0.332  Sum_probs=164.1

Q ss_pred             HHHhcchhHHHhhcccccCcHHHHHHHHHHHHHHHhhcCCCcHHHHHhhCcHHHHHHHHHHHHHHHhhcccccccCcHHH
Q 042233          184 KEMTLKPREIEEWQPFQKLSKNLQQKVKKYKSYIRRKTDYIDVQNLLNNLPNELRRELKRELCWNLLKKVQGFRKLNEVT  263 (392)
Q Consensus       184 ~~~~~~~~~l~~~m~~~~lp~~L~~ri~~y~~~~~~~~~~~~~~~il~~Lp~~Lr~ei~~~~~~~~l~~i~~F~~~s~~~  263 (392)
                      ++|+++|+.+++||+.+++|++|+.||++||+|.|+. +..+++++++.||++||.++..+++.++|+++|+|+++++.+
T Consensus         5 ~~f~~~~~~i~~~m~~~~i~~~l~~rv~~y~~~~~~~-~~~~~~~i~~~lp~~l~~~i~~~~~~~~l~~~~~F~~~~~~~   83 (193)
T d1q3ea_           5 RQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQG-KMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNF   83 (193)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHTT-CCCCHHHHHHHSCHHHHHHHHHHHTHHHHHHCHHHHTSCHHH
T ss_pred             HHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHhhc-ccccHHHHHHHCCcchhHHHHHHHHHHHHhcchHHHhhhHHH
Confidence            6799999999999999999999999999999999975 677889999999999999999999999999999999999999


Q ss_pred             HHHHhhhcceeeeCCCCEEEecCCCCCeEEEEEeeeEEEEEecCCccCcccCCcccccCccccccccccCCCeechhhhh
Q 042233          264 LDALCDCVKPTFFTEHTHLIREGDPIDEMIFVVQGKLRTYTFKDIQSGSTSSDHKRYDGKNTRKEDLLQDGDFYGEELID  343 (392)
Q Consensus       264 l~~l~~~l~~~~~~~ge~I~~~gd~~~~lyfI~~G~V~v~~~~~~~~~~~~~~~~~~~~~~~~~i~~l~~G~~FGe~~ll  343 (392)
                      +..|+..++++.|.|||+|+++||.++.+|||.+|.|++...++                   .+..+++|++||+.+++
T Consensus        84 l~~l~~~~~~~~~~~g~~I~~~g~~~~~ly~i~~G~v~v~~~~~-------------------~~~~l~~G~~fGe~~~~  144 (193)
T d1q3ea_          84 VTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGN-------------------KEMKLSDGSYFGEICLL  144 (193)
T ss_dssp             HHHHHTTCEEEEECTTCEEECTTSBCCEEEEEEECCEEEEC-CC-------------------CEEEECTTCEECHHHHH
T ss_pred             HHHHHHHHHHHhhccCceecccCCCCcceeEeeeeeEEeecCCc-------------------ceeeeccceeeeeeecc
Confidence            99999999999999999999999999999999999999986432                   23479999999999986


Q ss_pred             hhhccCCCCCCCCcceeEEEcceEEEEEecHHHHHHHHHHcHHhhcc
Q 042233          344 WALRDRFSFDIPKSNRTIQALTNVDAFMLMADDLKIVFNDMMNQLGL  390 (392)
Q Consensus       344 ~~l~~~~~~~~~~r~~tv~A~~~~~l~~L~~~~f~~ll~~~P~~~~~  390 (392)
                      .         ..+++++++|.++|+++.|++++|.+++++||++.+.
T Consensus       145 ~---------~~~~~~~~~a~~~~~l~~l~~~~f~~ll~~~p~~~~~  182 (193)
T d1q3ea_         145 T---------RGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRA  182 (193)
T ss_dssp             H---------CSBCSSEEEESSCEEEEEEEHHHHHHHHHHSGGGHHH
T ss_pred             C---------CCcccccceecCceEEEEEeHHHHHHHHHHCHHHHHH
Confidence            4         2347799999999999999999999999999998764
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure