Citrus Sinensis ID: 042246
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 639 | ||||||
| 255581825 | 647 | ubiquitin conjugating enzyme, putative [ | 0.892 | 0.880 | 0.495 | 1e-161 | |
| 224117172 | 480 | predicted protein [Populus trichocarpa] | 0.732 | 0.975 | 0.510 | 1e-134 | |
| 356542276 | 695 | PREDICTED: probable ubiquitin-conjugatin | 0.957 | 0.880 | 0.441 | 1e-133 | |
| 359493661 | 750 | PREDICTED: probable ubiquitin-conjugatin | 0.956 | 0.814 | 0.440 | 1e-133 | |
| 449447213 | 646 | PREDICTED: probable ubiquitin-conjugatin | 0.921 | 0.911 | 0.443 | 1e-131 | |
| 356546874 | 733 | PREDICTED: uncharacterized protein LOC10 | 0.924 | 0.806 | 0.431 | 1e-130 | |
| 357516443 | 771 | hypothetical protein MTR_8g060700 [Medic | 0.805 | 0.667 | 0.456 | 1e-121 | |
| 449498727 | 615 | PREDICTED: probable ubiquitin-conjugatin | 0.478 | 0.497 | 0.644 | 1e-116 | |
| 357442923 | 720 | Ubiquitin-conjugating enzyme E2 O [Medic | 0.469 | 0.416 | 0.648 | 1e-114 | |
| 356514737 | 1103 | PREDICTED: uncharacterized protein LOC10 | 0.472 | 0.273 | 0.618 | 1e-114 |
| >gi|255581825|ref|XP_002531713.1| ubiquitin conjugating enzyme, putative [Ricinus communis] gi|223528656|gb|EEF30672.1| ubiquitin conjugating enzyme, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 573 bits (1478), Expect = e-161, Method: Compositional matrix adjust.
Identities = 321/648 (49%), Positives = 408/648 (62%), Gaps = 78/648 (12%)
Query: 22 KQVIDLEKDEDSSDVILLDEIVKAGRKGKAIKND-------SDGSVSYQPKEDSKSSVPG 74
++VID++ DEDSSD +++D + KGKAI+ D V Y P SK S PG
Sbjct: 27 REVIDVDNDEDSSDCMIIDATMDTKNKGKAIEESVDDYLLAKDAMVDYLPYP-SKGSGPG 85
Query: 75 SHSII-----NLDFYDDKHVNI--DDFIDVEDYTFVQAYFDNANIPAGVEAPVPWLADPS 127
S + N D D++ ++I DDF+D ++Y ++QA+FDN +IP GVE P+P L D
Sbjct: 86 SQKTVIVDGSNSDMLDNECIDITSDDFMDFDEYAYLQAHFDNVDIPPGVEVPIPCLLDSL 145
Query: 128 LRKEKTANGS---------NLVHVNPASKSSSSLQKK---------------VDVPSSWL 163
+ +KT N S NL ++ S SS++ KK VDV S W
Sbjct: 146 HKTKKTVNESDSLDTTNQKNLNNLVAWSSKSSAVGKKLGFKVTQDSVSHASGVDVSSHWS 205
Query: 164 HLQSAHSKNTAASQDVGSSAQNGPFHVKSSNPLWIHEKSKSNGKLSASGISTNTNYVNQF 223
+ A + ++ +AQ K +S G N + +
Sbjct: 206 FVSHASGADLSSHWSFSQTAQ-----------------IKKKPTVSQLGYIMNPTAIQKI 248
Query: 224 DPMVH---PPGVGPSLWTHGTLAPVQN----QVGSSNLFYSGMPALKDTVNYPPAVGSFM 276
VH P P H P + Q G +N F+ P+ +N+P +VG
Sbjct: 249 KIPVHSSSPIIFSPVNQLHKAAIPFPDEPSYQGGPTNPFFPSFPSHVGGLNHPASVG--- 305
Query: 277 PAWHGSLQAELNSTFANYTTHPSFYDP-FDTVHMSPEEPADTPSGQDFSDNKESLDEDDI 335
P + L +E S+F ++T+H FY+P + ++S E A T + ++EDDI
Sbjct: 306 PPFSWPL-SEFKSSFVDHTSHSEFYNPLYGGQNLSEEGVART---------LKHVNEDDI 355
Query: 336 LRKFDLFKKFDAVEDHLDHHYASK-ASLKQPTNKWAKRIQEEWKILENDLPDTIFVRVYE 394
L K+ FK+FD VEDH DHHYASK +S+KQP WAK+IQEEW+ILENDLPD IFVR+YE
Sbjct: 356 LSKYQNFKRFDTVEDHSDHHYASKGSSVKQPPKNWAKKIQEEWRILENDLPDGIFVRIYE 415
Query: 395 SRMDLLRAVIVGAEGTPYHDGLFFFDVFFPSSYPNVPPNVYYHSGGLRLNPNLYNCGKVC 454
SRMDLLRAVI+GAEGTPYHDGLFFFDVFFPS YPN+PPNVYYHSGGLRLNPNLYNCGKVC
Sbjct: 416 SRMDLLRAVIIGAEGTPYHDGLFFFDVFFPSGYPNIPPNVYYHSGGLRLNPNLYNCGKVC 475
Query: 455 LSLLNTWTGNKNEKWMPNMSTMLQVLVSIQALILNQKPYFNEPGYASWNNTAHGEVESHK 514
LSLL TW GNKNEKW+P +ST+LQVLVSIQALILNQKPYFNEPGYA N +AHGE++S +
Sbjct: 476 LSLLGTWHGNKNEKWLPGVSTVLQVLVSIQALILNQKPYFNEPGYAHMNGSAHGEIQSQQ 535
Query: 515 YNESTFILSLKTMLYTLRRPPKHFKDFVIGHFYKHAHDILAACKTYMSGAEVGSLVKGGV 574
YNE TFILSLKTM+YT+RRPPKHF+DFV+GHF+KHAHDIL ACK YM GA+VG LVKGGV
Sbjct: 536 YNERTFILSLKTMVYTMRRPPKHFEDFVLGHFHKHAHDILVACKAYMDGAQVGCLVKGGV 595
Query: 575 QNIHKGLDGCTPHFRTSVAGQVDLLVKEFIRIGVKDCEKFLTQPKGGV 622
Q++ +G C+ F+ S+ G VDLL+KEF IGVKD EK+ KG +
Sbjct: 596 QDVDEGDKSCSKSFKDSLPGCVDLLLKEFSLIGVKDTEKYQILVKGDI 643
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224117172|ref|XP_002317497.1| predicted protein [Populus trichocarpa] gi|222860562|gb|EEE98109.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356542276|ref|XP_003539595.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 25-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359493661|ref|XP_002282404.2| PREDICTED: probable ubiquitin-conjugating enzyme E2 24-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449447213|ref|XP_004141363.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 25-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356546874|ref|XP_003541847.1| PREDICTED: uncharacterized protein LOC100810772 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357516443|ref|XP_003628510.1| hypothetical protein MTR_8g060700 [Medicago truncatula] gi|355522532|gb|AET02986.1| hypothetical protein MTR_8g060700 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449498727|ref|XP_004160617.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 25-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357442923|ref|XP_003591739.1| Ubiquitin-conjugating enzyme E2 O [Medicago truncatula] gi|355480787|gb|AES61990.1| Ubiquitin-conjugating enzyme E2 O [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356514737|ref|XP_003526060.1| PREDICTED: uncharacterized protein LOC100791144 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 639 | ||||||
| TAIR|locus:2090096 | 609 | UBC25 "ubiquitin-conjugating e | 0.463 | 0.486 | 0.621 | 9.3e-113 | |
| TAIR|locus:2039380 | 1102 | UBC23 "AT2G16920" [Arabidopsis | 0.425 | 0.246 | 0.532 | 3.2e-78 | |
| TAIR|locus:2057589 | 907 | PHO2 "AT2G33770" [Arabidopsis | 0.413 | 0.291 | 0.505 | 4.3e-70 | |
| DICTYBASE|DDB_G0290629 | 970 | DDB_G0290629 "Ubiquitin-conjug | 0.333 | 0.219 | 0.414 | 6.6e-40 | |
| UNIPROTKB|Q9NR09 | 4857 | BIRC6 "Baculoviral IAP repeat- | 0.352 | 0.046 | 0.408 | 7.9e-38 | |
| ZFIN|ZDB-GENE-091202-7 | 4870 | birc6 "baculoviral IAP repeat- | 0.350 | 0.045 | 0.418 | 8.5e-38 | |
| UNIPROTKB|F1S402 | 3423 | BIRC6 "Uncharacterized protein | 0.352 | 0.065 | 0.408 | 1.3e-37 | |
| FB|FBgn0027512 | 1398 | CG10254 [Drosophila melanogast | 0.319 | 0.145 | 0.433 | 8e-37 | |
| UNIPROTKB|E1BE13 | 4863 | BIRC6 "Uncharacterized protein | 0.352 | 0.046 | 0.408 | 1.4e-36 | |
| RGD|1307247 | 3786 | Birc6 "baculoviral IAP repeat- | 0.352 | 0.059 | 0.4 | 2.9e-36 |
| TAIR|locus:2090096 UBC25 "ubiquitin-conjugating enzyme 25" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 981 (350.4 bits), Expect = 9.3e-113, Sum P(3) = 9.3e-113
Identities = 189/304 (62%), Positives = 228/304 (75%)
Query: 312 EEPADTPSGQDFSDNKESLDEDDILRKFDLFKKFDAVEDHLDHHYASKASL-KQPTNKWA 370
EEP P D++ + +D L + FK+FD VED DHHYASK + KQ + WA
Sbjct: 279 EEPPILPP----DDSRVKRNMEDYLGLYLFFKRFDIVEDFSDHHYASKGTTSKQHSKDWA 334
Query: 371 KRIQEEWKILENDLPDTIFVRVYESRMDLLRAVIVGAEGTPYHDGLFFFDVFFPSSYPNV 430
KRIQ+EW+ILE DLP+ IFVR YESRMDLLRAVI+GA+GTPYHDGLFFFD+FFP +YP+
Sbjct: 335 KRIQDEWRILEKDLPEMIFVRAYESRMDLLRAVIIGAQGTPYHDGLFFFDIFFPDTYPST 394
Query: 431 PPNVYYHSGGLRLNPNLYNCGKVCLSLLNTWTGNKNEKWMPNMSTMLQVLVSIQALILNQ 490
PP V+YHSGGLR+NPNLYNCGKVCLSLL TW+GN+ EKW+PN STMLQVLVSIQ LILNQ
Sbjct: 395 PPIVHYHSGGLRINPNLYNCGKVCLSLLGTWSGNQREKWIPNTSTMLQVLVSIQGLILNQ 454
Query: 491 KPYFNEPGYASWNNTAHGEVESHKYNESTFILSLKTMLYTLRRPPKHFKDFVIGHFYKHA 550
KPYFNEPGY +AHGE S Y+E+TFILSLKTM+YT+RRPPK+F+DF GHF+ A
Sbjct: 455 KPYFNEPGYERSAGSAHGESTSKAYSENTFILSLKTMVYTMRRPPKYFEDFAYGHFFSCA 514
Query: 551 HDILAACKTYMSGAEVGSLVKGGVQNIHKGLDGCTP-HFRTSVAGQVD-LLVKEFIRIGV 608
HD+L AC Y +GA G LVKG ++ + G + FRT VA V+ +L+KEFI +GV
Sbjct: 515 HDVLKACNAYRNGATPGYLVKGA-PDVEENSAGMSSLKFRTDVATFVETVLLKEFILLGV 573
Query: 609 KDCE 612
E
Sbjct: 574 LGLE 577
|
|
| TAIR|locus:2039380 UBC23 "AT2G16920" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2057589 PHO2 "AT2G33770" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0290629 DDB_G0290629 "Ubiquitin-conjugating enzyme E2 O" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NR09 BIRC6 "Baculoviral IAP repeat-containing protein 6" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-091202-7 birc6 "baculoviral IAP repeat-containing 6" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S402 BIRC6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0027512 CG10254 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BE13 BIRC6 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1307247 Birc6 "baculoviral IAP repeat-containing 6" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 639 | |||
| cd00195 | 141 | cd00195, UBCc, Ubiquitin-conjugating enzyme E2, ca | 1e-33 | |
| pfam00179 | 139 | pfam00179, UQ_con, Ubiquitin-conjugating enzyme | 4e-27 | |
| smart00212 | 145 | smart00212, UBCc, Ubiquitin-conjugating enzyme E2, | 6e-24 | |
| COG5078 | 153 | COG5078, COG5078, Ubiquitin-protein ligase [Posttr | 2e-17 | |
| PTZ00390 | 152 | PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; | 4e-12 | |
| PLN00172 | 147 | PLN00172, PLN00172, ubiquitin conjugating enzyme; | 3e-10 |
| >gnl|CDD|238117 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain | Back alignment and domain information |
|---|
Score = 125 bits (315), Expect = 1e-33
Identities = 44/127 (34%), Positives = 63/127 (49%), Gaps = 11/127 (8%)
Query: 371 KRIQEEWKILENDLPDTIFVRVYESRMDLLRAVIVGAEGTPYHDGLFFFDVFFPSSYPNV 430
KR+Q+E K L+ D P I E + I G TPY G+F D+ FP YP
Sbjct: 2 KRLQKELKDLKKDPPSGISAEPVEENLLEWHGTIRGPPDTPYEGGIFKLDIEFPEDYPFK 61
Query: 431 PPNVYYHSGGLRLNPNLYNCGKVCLSLLNTWTGNKNEKWMPNMSTMLQVLVSIQALILNQ 490
PP V + + +PN+ GK+CLS+L T W P T+ VL+S+Q+L+
Sbjct: 62 PPKVRFVT--KIYHPNVDENGKICLSILKTHG------WSPAY-TLRTVLLSLQSLLNE- 111
Query: 491 KPYFNEP 497
P ++P
Sbjct: 112 -PNPSDP 117
|
This is part of the ubiquitin-mediated protein degradation pathway in which a thiol-ester linkage forms between a conserved cysteine and the C-terminus of ubiquitin and complexes with ubiquitin protein ligase enzymes, E3. This pathway regulates many fundamental cellular processes. There are also other E2s which form thiol-ester linkages without the use of E3s as well as several UBC homologs (TSG101, Mms2, Croc-1 and similar proteins) which lack the active site cysteine essential for ubiquitination and appear to function in DNA repair pathways which were omitted from the scope of this CD. Length = 141 |
| >gnl|CDD|215772 pfam00179, UQ_con, Ubiquitin-conjugating enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|214562 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, catalytic domain homologues | Back alignment and domain information |
|---|
| >gnl|CDD|227410 COG5078, COG5078, Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|240397 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177768 PLN00172, PLN00172, ubiquitin conjugating enzyme; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 639 | |||
| KOG0895 | 1101 | consensus Ubiquitin-conjugating enzyme [Posttransl | 100.0 | |
| KOG0895 | 1101 | consensus Ubiquitin-conjugating enzyme [Posttransl | 100.0 | |
| KOG0417 | 148 | consensus Ubiquitin-protein ligase [Posttranslatio | 100.0 | |
| COG5078 | 153 | Ubiquitin-protein ligase [Posttranslational modifi | 100.0 | |
| PTZ00390 | 152 | ubiquitin-conjugating enzyme; Provisional | 100.0 | |
| PLN00172 | 147 | ubiquitin conjugating enzyme; Provisional | 100.0 | |
| KOG0419 | 152 | consensus Ubiquitin-protein ligase [Posttranslatio | 100.0 | |
| KOG0418 | 200 | consensus Ubiquitin-protein ligase [Posttranslatio | 100.0 | |
| PF00179 | 140 | UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP | 99.97 | |
| KOG0425 | 171 | consensus Ubiquitin-protein ligase [Posttranslatio | 99.97 | |
| cd00195 | 141 | UBCc Ubiquitin-conjugating enzyme E2, catalytic (U | 99.97 | |
| KOG0426 | 165 | consensus Ubiquitin-protein ligase [Posttranslatio | 99.96 | |
| smart00212 | 145 | UBCc Ubiquitin-conjugating enzyme E2, catalytic do | 99.96 | |
| KOG0424 | 158 | consensus Ubiquitin-protein ligase [Posttranslatio | 99.96 | |
| KOG0421 | 175 | consensus Ubiquitin-protein ligase [Posttranslatio | 99.95 | |
| KOG0894 | 244 | consensus Ubiquitin-protein ligase [Posttranslatio | 99.94 | |
| KOG0422 | 153 | consensus Ubiquitin-protein ligase [Posttranslatio | 99.93 | |
| KOG0416 | 189 | consensus Ubiquitin-protein ligase [Posttranslatio | 99.91 | |
| KOG0423 | 223 | consensus Ubiquitin-protein ligase [Posttranslatio | 99.9 | |
| KOG0427 | 161 | consensus Ubiquitin conjugating enzyme [Posttransl | 99.89 | |
| KOG0420 | 184 | consensus Ubiquitin-protein ligase [Posttranslatio | 99.89 | |
| KOG0428 | 314 | consensus Non-canonical ubiquitin conjugating enzy | 99.8 | |
| KOG0429 | 258 | consensus Ubiquitin-conjugating enzyme-related pro | 99.47 | |
| KOG0896 | 138 | consensus Ubiquitin-conjugating enzyme E2 [Posttra | 98.62 | |
| KOG0897 | 122 | consensus Predicted ubiquitin-conjugating enzyme [ | 98.0 | |
| PF14461 | 133 | Prok-E2_B: Prokaryotic E2 family B | 97.72 | |
| PF05743 | 121 | UEV: UEV domain; InterPro: IPR008883 The N-termina | 97.47 | |
| PF08694 | 161 | UFC1: Ubiquitin-fold modifier-conjugating enzyme 1 | 96.89 | |
| KOG2391 | 365 | consensus Vacuolar sorting protein/ubiquitin recep | 96.29 | |
| PF14462 | 122 | Prok-E2_E: Prokaryotic E2 family E | 94.91 | |
| KOG3357 | 167 | consensus Uncharacterized conserved protein [Funct | 94.43 | |
| PF05773 | 113 | RWD: RWD domain; InterPro: IPR006575 The RWD eukar | 91.58 | |
| smart00591 | 107 | RWD domain in RING finger and WD repeat containing | 89.05 |
| >KOG0895 consensus Ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3e-55 Score=498.14 Aligned_cols=270 Identities=50% Similarity=0.846 Sum_probs=255.3
Q ss_pred cccccccCCcccccccccccCCCCHHHHHHHHHHHHHHHhCCCCCeeEEecCCCCceEEEEEEcCCCCCCCCceEEEEEE
Q 042246 343 KKFDAVEDHLDHHYASKASLKQPTNKWAKRIQEEWKILENDLPDTIFVRVYESRMDLLRAVIVGAEGTPYHDGLFFFDVF 422 (639)
Q Consensus 343 k~fd~ve~~sdHhy~~~ss~~~~s~~a~KRL~KELk~Lqk~~P~gI~Vrp~ednL~~W~avI~GP~gTPYeGGlF~fdI~ 422 (639)
++||++.+..||||...-..+.....+++..+.||+.|..++|.||+||.+|++|++++++|+||.||||++|+|+|+|.
T Consensus 826 ~~F~v~~~~~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vr~~e~r~d~~~~~~~g~~~tpy~~~~f~fd~~ 905 (1101)
T KOG0895|consen 826 LRFDVNYDYMDHHKNANDGNKAAEAQWAKKVQTEWKILPLSLPSGIFVRAYEDRMDLLRAVIVGAAGTPYQDGLFFFDFQ 905 (1101)
T ss_pred ccccccCchHHHhhhhcccccHHHHHHHHHHHHHHHhhhccCCCceEEEechHHHHHHHHHhhCCCCCccccceEEEEee
Confidence 68999999999999987322233348999999999999999999999999999999999999999999999999999999
Q ss_pred cCCCCCCCCCeeeeccCCcccCCCccCCCceeecCccccCCCCCCCCCcCcccHHHHHHHHHHHHhcCCCCCCCCCcccc
Q 042246 423 FPSSYPNVPPNVYYHSGGLRLNPNLYNCGKVCLSLLNTWTGNKNEKWMPNMSTMLQVLVSIQALILNQKPYFNEPGYASW 502 (639)
Q Consensus 423 FP~dYP~~PPkV~F~T~~~IfHPNVy~~GkVCLSLL~Tw~G~~~E~WSPa~sTIlqVLlSIQsLLl~pnPyfnEPg~e~l 502 (639)
||++||..||.|++++.+.|+|||+|++|+|||+||+||.|+++|.|+|. ++|+|||+|||+|+++.+||||||||+.+
T Consensus 906 ~~~~yp~~pp~~~~~s~~~r~npnly~~g~vc~s~l~tw~g~~~e~w~~~-s~~lq~l~s~q~l~l~~~py~ne~gy~~~ 984 (1101)
T KOG0895|consen 906 FPQDYPSSPPLVHYHSGGVRLNPNLYEDGKVCLSLLNTWHGRGNEVWNPS-SSILQVLVSIQGLVLNEEPYFNEAGYEKQ 984 (1101)
T ss_pred cCCCCCCCCCceEeecCceeeCcccccccceehhhhccccCCCccccCcc-hhHHHHHHHhhhhhcccccccCccccccc
Confidence 99999999999999999999999999999999999999999999999995 79999999999999999999999999999
Q ss_pred cCCcchhhhhhhccHHHHHHHHHHHHHHhcCCChhhHHHHHHHHhhcHHHHHHHHHHhhccCCccccccCCcccccCCCC
Q 042246 503 NNTAHGEVESHKYNESTFILSLKTMLYTLRRPPKHFKDFVIGHFYKHAHDILAACKTYMSGAEVGSLVKGGVQNIHKGLD 582 (639)
Q Consensus 503 ~~ta~ge~~s~~Yne~~f~~s~ktm~~~L~kpPk~Fe~~V~~HF~~~a~~Il~~~k~~~~ga~vg~~~~g~~~~~~~~~~ 582 (639)
+|+++|+.+++.||+++|+++|++|+++|++||+.|+++|++||++|+.+|+++|++|++|.+.|+..++.+++......
T Consensus 985 ~g~~~g~~~s~~y~~~~~~~~~~~~~~~~~~p~~~~~e~i~~Hf~~~~~ei~~~c~a~~~~~~~~s~~k~~v~d~~~a~k 1064 (1101)
T KOG0895|consen 985 RGTAEGEKNSRVYNENAFLLTCKSMVYQLRKPPKCFEEVIHKHFYLRGVEIMAACEAWIAGILQGSSDKRVVSDHAAALK 1064 (1101)
T ss_pred ccccccccccccccchhHHHHHHHHHHHhhCCcHHHHHHHHHHHHHHHHHHHHHHHHHHhhchhcccccchhhhhHHHHh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999888777777
Q ss_pred CCChHHHHHHHHhHHHHHHHHHhcCccccccc
Q 042246 583 GCTPHFRTSVAGQVDLLVKEFIRIGVKDCEKF 614 (639)
Q Consensus 583 ~~s~~Fk~~l~~~~~~Lv~~F~~~G~~d~~~~ 614 (639)
+.+++||..|..+...+..+|...|+ +|..+
T Consensus 1065 s~s~~~k~~l~~~~~~~~~~~~~~~a-~~~~~ 1095 (1101)
T KOG0895|consen 1065 SHSAQFKEELLKLPCPEGLAPDTVGA-PEVCE 1095 (1101)
T ss_pred ccchhhhhhhhhCCcccccchhhcCc-hhhhh
Confidence 88999999999999999999999999 44443
|
|
| >KOG0895 consensus Ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0417 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00390 ubiquitin-conjugating enzyme; Provisional | Back alignment and domain information |
|---|
| >PLN00172 ubiquitin conjugating enzyme; Provisional | Back alignment and domain information |
|---|
| >KOG0419 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0418 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] | Back alignment and domain information |
|---|
| >KOG0425 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain | Back alignment and domain information |
|---|
| >KOG0426 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues | Back alignment and domain information |
|---|
| >KOG0424 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0421 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0894 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0422 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0416 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0423 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0427 consensus Ubiquitin conjugating enzyme [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0420 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0428 consensus Non-canonical ubiquitin conjugating enzyme 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0429 consensus Ubiquitin-conjugating enzyme-related protein Ft1, involved in programmed cell death [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0896 consensus Ubiquitin-conjugating enzyme E2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0897 consensus Predicted ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14461 Prok-E2_B: Prokaryotic E2 family B | Back alignment and domain information |
|---|
| >PF05743 UEV: UEV domain; InterPro: IPR008883 The N-terminal ubiquitin E2 variant (UEV) domain is ~145 amino acid residues in length and shows significant sequence similarity to E2 ubiquitin ligases but is unable to catalyze ubiquitin transfer as it lacks the active site cysteine that forms the transient thioester bond with the C terminus of ubiquitin (Ub) | Back alignment and domain information |
|---|
| >PF08694 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1; InterPro: IPR014806 Ubiquitin-like (UBL) post-translational modifiers are covalently linked to most, if not all, target protein(s) through an enzymatic cascade analogous to ubiquitylation, consisting of E1 (activating), E2 (conjugating), and E3 (ligating) enzymes | Back alignment and domain information |
|---|
| >KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF14462 Prok-E2_E: Prokaryotic E2 family E | Back alignment and domain information |
|---|
| >KOG3357 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05773 RWD: RWD domain; InterPro: IPR006575 The RWD eukaryotic domain is found in RING finger (IPR001841 from INTERPRO) and WD repeat (IPR001680 from INTERPRO) containing proteins and DEXDc-like helicase (IPR001410 from INTERPRO) subfamily related to the ubiquitin-conjugating enzymes domain (IPR000608 from INTERPRO) | Back alignment and domain information |
|---|
| >smart00591 RWD domain in RING finger and WD repeat containing proteins and DEXDc-like helicases subfamily related to the UBCc domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 639 | ||||
| 3ceg_A | 323 | Crystal Structure Of The Ubc Domain Of Baculoviral | 1e-40 | ||
| 3ong_B | 159 | Crystal Structure Of Uba2ufd-ubc9: Insights Into E1 | 7e-11 | ||
| 2gjd_A | 157 | Distinct Functional Domains Of Ubc9 Dictate Cell Su | 9e-11 | ||
| 1jas_A | 152 | Hsubc2b Length = 152 | 2e-10 | ||
| 2ayv_A | 166 | Crystal Structure Of A Putative Ubiquitin-Conjugati | 4e-10 | ||
| 1ayz_A | 169 | Crystal Structure Of The Saccharomyces Cerevisiae U | 5e-10 | ||
| 2oxq_A | 152 | Structure Of The Ubch5 :chip U-Box Complex Length = | 1e-09 | ||
| 2aak_A | 152 | Ubiquitin Conjugating Enzyme From Arabidopsis Thali | 1e-09 | ||
| 2r0j_A | 149 | Crystal Structure Of The Putative Ubiquitin Conjuga | 2e-09 | ||
| 3e95_A | 151 | Crystal Structure Of The Plasmodium Falciparum Ubiq | 2e-09 | ||
| 1z3d_A | 157 | Protein Crystal Growth Improvement Leading To The 2 | 2e-09 | ||
| 1q34_A | 163 | Crystal Structures Of Two Ubc (E2) Enzymes Of The U | 2e-09 | ||
| 1qcq_A | 148 | Ubiquitin Conjugating Enzyme Length = 148 | 3e-09 | ||
| 1yh2_A | 169 | Ubiquitin-Conjugating Enzyme Hspc150 Length = 169 | 3e-09 | ||
| 4gpr_A | 151 | Crystal Structure Of Ehubc5, A Ubiquitin Conjugatin | 4e-09 | ||
| 1z2u_A | 150 | The 1.1a Crystallographic Structure Of Ubiquitin- C | 6e-09 | ||
| 1jat_A | 155 | Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Leng | 6e-09 | ||
| 1x23_A | 155 | Crystal Structure Of Ubch5c Length = 155 | 8e-09 | ||
| 3tgd_A | 152 | Crystal Structure Of The Human Ubiquitin-Conjugatin | 8e-09 | ||
| 3rpg_A | 149 | Bmi1RING1B-Ubch5c Complex Structure Length = 149 | 9e-09 | ||
| 2esk_A | 149 | Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wil | 9e-09 | ||
| 3eb6_B | 149 | Structure Of The Ciap2 Ring Domain Bound To Ubch5b | 9e-09 | ||
| 2c4o_B | 165 | Crystal Structure Of Human Ubiquitin-Conjugating En | 9e-09 | ||
| 2fuh_A | 146 | Solution Structure Of The Ubch5cUB NON-Covalent Com | 1e-08 | ||
| 4ii2_C | 163 | Crystal Structure Of Ubiquitin Activating Enzyme 1 | 1e-08 | ||
| 2esq_A | 149 | Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta | 1e-08 | ||
| 1ur6_A | 147 | Nmr Based Structural Model Of The Ubch5b-Cnot4 Comp | 1e-08 | ||
| 3l1z_A | 157 | Crystal Structure Of The U-Box Domain Of Human E4b | 1e-08 | ||
| 3l1y_A | 157 | Crystal Structure Of Human Ubc4 E2 Conjugating Enzy | 1e-08 | ||
| 2esp_A | 149 | Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta | 2e-08 | ||
| 2yho_B | 149 | The Idol-Ube2d Complex Mediates Sterol-Dependent De | 2e-08 | ||
| 3oj4_A | 153 | Crystal Structure Of The A20 Znf4, Ubiquitin And Ub | 2e-08 | ||
| 1tte_A | 215 | The Structure Of A Class Ii Ubiquitin-Conjugating E | 2e-08 | ||
| 2c4p_A | 165 | Crystal Structure Of Human Ubiquitin-Conjugating En | 3e-08 | ||
| 2eso_A | 149 | Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta | 3e-08 | ||
| 1fxt_A | 149 | Structure Of A Conjugating Enzyme-Ubiquitin Thioles | 4e-08 | ||
| 1jbb_A | 153 | Ubiquitin Conjugating Enzyme, Ubc13 Length = 153 | 4e-08 | ||
| 2grn_A | 161 | Crystal Structure Of Human Rangap1-Ubc9 Length = 16 | 5e-08 | ||
| 2o25_C | 160 | Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed Wi | 5e-08 | ||
| 2pwq_A | 216 | Crystal Structure Of A Putative Ubiquitin Conjugati | 5e-08 | ||
| 1kps_A | 159 | Structural Basis For E2-Mediated Sumo Conjugation R | 6e-08 | ||
| 3a4s_A | 163 | The Crystal Structure Of The Sld2:ubc9 Complex Leng | 6e-08 | ||
| 1z5s_A | 158 | Crystal Structure Of A Complex Between Ubc9, Sumo-1 | 6e-08 | ||
| 1u9a_A | 160 | Human Ubiquitin-Conjugating Enzyme Ubc9 Length = 16 | 7e-08 | ||
| 2grr_A | 161 | Crystal Structure Of Human Rangap1-Ubc9-D127s Lengt | 8e-08 | ||
| 2grq_A | 161 | Crystal Structure Of Human Rangap1-Ubc9-D127a Lengt | 8e-08 | ||
| 3bzh_A | 194 | Crystal Structure Of Human Ubiquitin-Conjugating En | 1e-07 | ||
| 3a33_A | 150 | Ubch5b~ubiquitin Conjugate Length = 150 | 1e-07 | ||
| 2gmi_A | 152 | Mms2UBC13~UBIQUITIN Length = 152 | 1e-07 | ||
| 1y6l_A | 149 | Human Ubiquitin Conjugating Enzyme E2e2 Length = 14 | 2e-07 | ||
| 3ugb_A | 147 | Ubch5c~ubiquitin Conjugate Length = 147 | 2e-07 | ||
| 2gro_A | 161 | Crystal Structure Of Human Rangap1-Ubc9-N85q Length | 2e-07 | ||
| 2c4o_A | 165 | Crystal Structure Of Human Ubiquitin-Conjugating En | 2e-07 | ||
| 4ddg_A | 399 | Crystal Structure Of Human Otub1UBCH5B~UBUB Length | 2e-07 | ||
| 3rcz_B | 163 | Rad60 Sld2 Ubc9 Complex Length = 163 | 3e-07 | ||
| 2ucz_A | 165 | Ubiquitin Conjugating Enzyme (Ubc7) From Saccharomy | 3e-07 | ||
| 3jvz_A | 146 | E2~ubiquitin-Hect Length = 146 | 4e-07 | ||
| 2grp_A | 161 | Crystal Structure Of Human Rangap1-Ubc9-Y87a Length | 4e-07 | ||
| 2c2v_B | 154 | Crystal Structure Of The Chip-Ubc13-Uev1a Complex L | 4e-07 | ||
| 1j7d_B | 152 | Crystal Structure Of Hmms2-Hubc13 Length = 152 | 4e-07 | ||
| 4ap4_B | 153 | Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Le | 5e-07 | ||
| 4epo_B | 155 | Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE | 5e-07 | ||
| 3von_C | 148 | Crystalstructure Of The Ubiquitin Protease Length = | 5e-07 | ||
| 3hct_B | 155 | Crystal Structure Of Traf6 In Complex With Ubc13 In | 5e-07 | ||
| 4fh1_A | 153 | S. Cerevisiae Ubc13-N79a Length = 153 | 8e-07 | ||
| 2uyz_A | 158 | Non-Covalent Complex Between Ubc9 And Sumo1 Length | 1e-06 | ||
| 4auq_A | 147 | Structure Of Birc7-Ubch5b-Ub Complex. Length = 147 | 1e-06 | ||
| 3uio_A | 158 | Complex Between Human Rangap1-Sumo2, Ubc9 And The I | 1e-06 | ||
| 1zdn_A | 158 | Ubiquitin-Conjugating Enzyme E2s Length = 158 | 2e-06 | ||
| 3fsh_A | 168 | Crystal Structure Of The Ubiquitin Conjugating Enzy | 4e-05 | ||
| 2cyx_A | 170 | Structure Of Human Ubiquitin-Conjugating Enzyme E2 | 4e-05 | ||
| 2kly_A | 167 | Solution Structure Of Human Ubiquitin Conjugating E | 4e-05 | ||
| 3h8k_A | 164 | Crystal Structure Of Ube2g2 Complxed With The G2br | 5e-05 | ||
| 2f4z_A | 193 | Toxoplasma Gondii Ubiquitin Conjugating Enzyme Tgtw | 5e-05 | ||
| 2a7l_A | 136 | Structure Of The Human Hypothetical Ubiquitin-Conju | 8e-05 | ||
| 1pzv_A | 164 | Crystal Structures Of Two Ubc (E2) Enzymes Of The U | 1e-04 | ||
| 2f4w_A | 187 | Human Ubiquitin-Conjugating Enzyme E2 J2 Length = 1 | 3e-04 | ||
| 1c4z_D | 154 | Structure Of E6ap: Insights Into Ubiquitination Pat | 3e-04 | ||
| 3sqv_C | 156 | Crystal Structure Of E. Coli O157:h7 E3 Ubiquitin L | 3e-04 | ||
| 2fo3_A | 125 | Plasmodium Vivax Ubiquitin Conjugating Enzyme E2 Le | 4e-04 | ||
| 2h2y_A | 136 | Crystal Structure Of Ubiquitin Conjugating Enzyme E | 5e-04 |
| >pdb|3CEG|A Chain A, Crystal Structure Of The Ubc Domain Of Baculoviral Iap Repeat- Containing Protein 6 Length = 323 | Back alignment and structure |
|
| >pdb|3ONG|B Chain B, Crystal Structure Of Uba2ufd-ubc9: Insights Into E1-e2 Interactions In Sumo Pathways Length = 159 | Back alignment and structure |
| >pdb|2GJD|A Chain A, Distinct Functional Domains Of Ubc9 Dictate Cell Survival And Resistance To Genotoxic Stress Length = 157 | Back alignment and structure |
| >pdb|1JAS|A Chain A, Hsubc2b Length = 152 | Back alignment and structure |
| >pdb|2AYV|A Chain A, Crystal Structure Of A Putative Ubiquitin-Conjugating Enzyme E2 From Toxoplasma Gondii Length = 166 | Back alignment and structure |
| >pdb|1AYZ|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Ubiquitin- Conjugating Enzyme Rad6 (Ubc2) At 2.6a Resolution Length = 169 | Back alignment and structure |
| >pdb|2OXQ|A Chain A, Structure Of The Ubch5 :chip U-Box Complex Length = 152 | Back alignment and structure |
| >pdb|2AAK|A Chain A, Ubiquitin Conjugating Enzyme From Arabidopsis Thaliana Length = 152 | Back alignment and structure |
| >pdb|2R0J|A Chain A, Crystal Structure Of The Putative Ubiquitin Conjugating Enzyme, Pfe1350c, From Plasmodium Falciparum Length = 149 | Back alignment and structure |
| >pdb|3E95|A Chain A, Crystal Structure Of The Plasmodium Falciparum Ubiquitin Conjugating Enzyme Complex, Pfubc13-Pfuev1a Length = 151 | Back alignment and structure |
| >pdb|1Z3D|A Chain A, Protein Crystal Growth Improvement Leading To The 2.5a Crystallographic Structure Of Ubiquitin-Conjugating Enzyme (Ubc-1) From Caenorhabditis Elegans Length = 157 | Back alignment and structure |
| >pdb|1Q34|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 163 | Back alignment and structure |
| >pdb|1QCQ|A Chain A, Ubiquitin Conjugating Enzyme Length = 148 | Back alignment and structure |
| >pdb|1YH2|A Chain A, Ubiquitin-Conjugating Enzyme Hspc150 Length = 169 | Back alignment and structure |
| >pdb|4GPR|A Chain A, Crystal Structure Of Ehubc5, A Ubiquitin Conjugating Enzyme From Entamoeba Histolytica Length = 151 | Back alignment and structure |
| >pdb|1Z2U|A Chain A, The 1.1a Crystallographic Structure Of Ubiquitin- Conjugating Enzyme (Ubc-2) From Caenorhabditis Elegans: Functional And Evolutionary Significance Length = 150 | Back alignment and structure |
| >pdb|1JAT|A Chain A, Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Length = 155 | Back alignment and structure |
| >pdb|1X23|A Chain A, Crystal Structure Of Ubch5c Length = 155 | Back alignment and structure |
| >pdb|3TGD|A Chain A, Crystal Structure Of The Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Length = 152 | Back alignment and structure |
| >pdb|3RPG|A Chain A, Bmi1RING1B-Ubch5c Complex Structure Length = 149 | Back alignment and structure |
| >pdb|2ESK|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wild-Type Length = 149 | Back alignment and structure |
| >pdb|3EB6|B Chain B, Structure Of The Ciap2 Ring Domain Bound To Ubch5b Length = 149 | Back alignment and structure |
| >pdb|2C4O|B Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 | Back alignment and structure |
| >pdb|2FUH|A Chain A, Solution Structure Of The Ubch5cUB NON-Covalent Complex Length = 146 | Back alignment and structure |
| >pdb|4II2|C Chain C, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 163 | Back alignment and structure |
| >pdb|2ESQ|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ser94gly Length = 149 | Back alignment and structure |
| >pdb|1UR6|A Chain A, Nmr Based Structural Model Of The Ubch5b-Cnot4 Complex Length = 147 | Back alignment and structure |
| >pdb|3L1Z|A Chain A, Crystal Structure Of The U-Box Domain Of Human E4b Ubiquitin Ligase In Complex With Ubch5c E2 Ubiquitin Conjugating Enzyme Length = 157 | Back alignment and structure |
| >pdb|3L1Y|A Chain A, Crystal Structure Of Human Ubc4 E2 Conjugating Enzyme Length = 157 | Back alignment and structure |
| >pdb|2ESP|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile88ala Length = 149 | Back alignment and structure |
| >pdb|2YHO|B Chain B, The Idol-Ube2d Complex Mediates Sterol-Dependent Degradation Of The Ldl Receptor Length = 149 | Back alignment and structure |
| >pdb|3OJ4|A Chain A, Crystal Structure Of The A20 Znf4, Ubiquitin And Ubch5a Complex Length = 153 | Back alignment and structure |
| >pdb|1TTE|A Chain A, The Structure Of A Class Ii Ubiquitin-Conjugating Enzyme, Ubc1 Length = 215 | Back alignment and structure |
| >pdb|2C4P|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5a Length = 165 | Back alignment and structure |
| >pdb|2ESO|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile37ala Length = 149 | Back alignment and structure |
| >pdb|1FXT|A Chain A, Structure Of A Conjugating Enzyme-Ubiquitin Thiolester Complex Length = 149 | Back alignment and structure |
| >pdb|1JBB|A Chain A, Ubiquitin Conjugating Enzyme, Ubc13 Length = 153 | Back alignment and structure |
| >pdb|2GRN|A Chain A, Crystal Structure Of Human Rangap1-Ubc9 Length = 161 | Back alignment and structure |
| >pdb|2O25|C Chain C, Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed With Sumo-1- Conjugating Enzyme Ubc9 Length = 160 | Back alignment and structure |
| >pdb|2PWQ|A Chain A, Crystal Structure Of A Putative Ubiquitin Conjugating Enzyme From Plasmodium Yoelii Length = 216 | Back alignment and structure |
| >pdb|1KPS|A Chain A, Structural Basis For E2-Mediated Sumo Conjugation Revealed By A Complex Between Ubiquitin Conjugating Enzyme Ubc9 And Rangap1 Length = 159 | Back alignment and structure |
| >pdb|3A4S|A Chain A, The Crystal Structure Of The Sld2:ubc9 Complex Length = 163 | Back alignment and structure |
| >pdb|1Z5S|A Chain A, Crystal Structure Of A Complex Between Ubc9, Sumo-1, Rangap1 And Nup358RANBP2 Length = 158 | Back alignment and structure |
| >pdb|1U9A|A Chain A, Human Ubiquitin-Conjugating Enzyme Ubc9 Length = 160 | Back alignment and structure |
| >pdb|2GRR|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-D127s Length = 161 | Back alignment and structure |
| >pdb|2GRQ|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-D127a Length = 161 | Back alignment and structure |
| >pdb|3BZH|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme E2 E1 Length = 194 | Back alignment and structure |
| >pdb|3A33|A Chain A, Ubch5b~ubiquitin Conjugate Length = 150 | Back alignment and structure |
| >pdb|2GMI|A Chain A, Mms2UBC13~UBIQUITIN Length = 152 | Back alignment and structure |
| >pdb|1Y6L|A Chain A, Human Ubiquitin Conjugating Enzyme E2e2 Length = 149 | Back alignment and structure |
| >pdb|3UGB|A Chain A, Ubch5c~ubiquitin Conjugate Length = 147 | Back alignment and structure |
| >pdb|2GRO|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-N85q Length = 161 | Back alignment and structure |
| >pdb|2C4O|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 | Back alignment and structure |
| >pdb|4DDG|A Chain A, Crystal Structure Of Human Otub1UBCH5B~UBUB Length = 399 | Back alignment and structure |
| >pdb|3RCZ|B Chain B, Rad60 Sld2 Ubc9 Complex Length = 163 | Back alignment and structure |
| >pdb|2UCZ|A Chain A, Ubiquitin Conjugating Enzyme (Ubc7) From Saccharomyces Cerevisiae Length = 165 | Back alignment and structure |
| >pdb|3JVZ|A Chain A, E2~ubiquitin-Hect Length = 146 | Back alignment and structure |
| >pdb|2GRP|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-Y87a Length = 161 | Back alignment and structure |
| >pdb|2C2V|B Chain B, Crystal Structure Of The Chip-Ubc13-Uev1a Complex Length = 154 | Back alignment and structure |
| >pdb|1J7D|B Chain B, Crystal Structure Of Hmms2-Hubc13 Length = 152 | Back alignment and structure |
| >pdb|4AP4|B Chain B, Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Length = 153 | Back alignment and structure |
| >pdb|4EPO|B Chain B, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 155 | Back alignment and structure |
| >pdb|3VON|C Chain C, Crystalstructure Of The Ubiquitin Protease Length = 148 | Back alignment and structure |
| >pdb|3HCT|B Chain B, Crystal Structure Of Traf6 In Complex With Ubc13 In The P1 Space Group Length = 155 | Back alignment and structure |
| >pdb|4FH1|A Chain A, S. Cerevisiae Ubc13-N79a Length = 153 | Back alignment and structure |
| >pdb|2UYZ|A Chain A, Non-Covalent Complex Between Ubc9 And Sumo1 Length = 158 | Back alignment and structure |
| >pdb|4AUQ|A Chain A, Structure Of Birc7-Ubch5b-Ub Complex. Length = 147 | Back alignment and structure |
| >pdb|3UIO|A Chain A, Complex Between Human Rangap1-Sumo2, Ubc9 And The Ir1 Domain From Ranbp2 Containing Ir2 Motif Ii Length = 158 | Back alignment and structure |
| >pdb|1ZDN|A Chain A, Ubiquitin-Conjugating Enzyme E2s Length = 158 | Back alignment and structure |
| >pdb|3FSH|A Chain A, Crystal Structure Of The Ubiquitin Conjugating Enzyme Ube2g2 Bound To The G2br Domain Of Ubiquitin Ligase Gp78 Length = 168 | Back alignment and structure |
| >pdb|2CYX|A Chain A, Structure Of Human Ubiquitin-Conjugating Enzyme E2 G2 (Ube2g2UBC7) Length = 170 | Back alignment and structure |
| >pdb|2KLY|A Chain A, Solution Structure Of Human Ubiquitin Conjugating Enzyme Ube2g2 Length = 167 | Back alignment and structure |
| >pdb|3H8K|A Chain A, Crystal Structure Of Ube2g2 Complxed With The G2br Domain Of Gp78 At 1.8-A Resolution Length = 164 | Back alignment and structure |
| >pdb|2F4Z|A Chain A, Toxoplasma Gondii Ubiquitin Conjugating Enzyme Tgtwinscan_2721- E2 Domain Length = 193 | Back alignment and structure |
| >pdb|2A7L|A Chain A, Structure Of The Human Hypothetical Ubiquitin-Conjugating Enzyme, Loc55284 Length = 136 | Back alignment and structure |
| >pdb|1PZV|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 164 | Back alignment and structure |
| >pdb|2F4W|A Chain A, Human Ubiquitin-Conjugating Enzyme E2 J2 Length = 187 | Back alignment and structure |
| >pdb|1C4Z|D Chain D, Structure Of E6ap: Insights Into Ubiquitination Pathway Length = 154 | Back alignment and structure |
| >pdb|3SQV|C Chain C, Crystal Structure Of E. Coli O157:h7 E3 Ubiquitin Ligase, Nlel, With A Human E2, Ubch7 Length = 156 | Back alignment and structure |
| >pdb|2FO3|A Chain A, Plasmodium Vivax Ubiquitin Conjugating Enzyme E2 Length = 125 | Back alignment and structure |
| >pdb|2H2Y|A Chain A, Crystal Structure Of Ubiquitin Conjugating Enzyme E2 From Plasmodium Falciparum Length = 136 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 639 | |||
| 3ceg_A | 323 | Baculoviral IAP repeat-containing protein 6; apopt | 3e-95 | |
| 2a7l_A | 136 | Hypothetical ubiquitin-conjugating enzyme LOC55284 | 7e-26 | |
| 2h2y_A | 136 | Ubiquitin-conjugating enzyme; structural genomics, | 4e-24 | |
| 3fn1_B | 167 | NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin | 6e-24 | |
| 2fo3_A | 125 | Ubiquitin-conjugating enzyme; SGC, UBC, structural | 7e-24 | |
| 1yh2_A | 169 | HSPC150 protein similar to ubiquitin-conjugating e | 1e-23 | |
| 2c4o_A | 165 | Ubiquitin-conjugating enzyme E2 D2; thioesterifica | 3e-23 | |
| 1zdn_A | 158 | Ubiquitin-conjugating enzyme E2S; structural genom | 3e-23 | |
| 2r0j_A | 149 | Ubiquitin carrier protein; ubiquitin conjugating, | 5e-23 | |
| 2c2v_B | 154 | Ubiquitin-conjugating enzyme E2 N; chaperone, heat | 6e-23 | |
| 2aak_A | 152 | UBC1, ubiquitin conjugating enzyme; ubiquitin conj | 8e-23 | |
| 1jat_A | 155 | Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig | 8e-23 | |
| 1z2u_A | 150 | Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro | 2e-22 | |
| 2pwq_A | 216 | Ubiquitin conjugating enzyme; structural genomics | 2e-22 | |
| 2e2c_A | 156 | Ubiquitin conjugating enzyme; ubiquitin conjugatio | 3e-22 | |
| 1yrv_A | 169 | Ubiquitin-conjugating ligase MGC351130; structural | 3e-22 | |
| 2grr_A | 161 | Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj | 4e-22 | |
| 2ayv_A | 166 | Ubiquitin-conjugating enzyme E2; structural genomi | 5e-22 | |
| 1ayz_A | 169 | UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin | 6e-22 | |
| 3bzh_A | 194 | Ubiquitin-conjugating enzyme E2 E1; structural gen | 7e-22 | |
| 2gjd_A | 157 | Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT | 9e-22 | |
| 1i7k_A | 179 | Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A | 1e-21 | |
| 3rcz_B | 163 | SUMO-conjugating enzyme UBC9; SUMO-like domain, pr | 1e-20 | |
| 2ucz_A | 165 | UBC7, ubiquitin conjugating enzyme; ubiquitin conj | 1e-20 | |
| 3h8k_A | 164 | Ubiquitin-conjugating enzyme E2 G2; alpha beta, al | 1e-20 | |
| 1c4z_D | 154 | UBCH7, ubiquitin conjugating enzyme E2; bilobal st | 1e-20 | |
| 1fxt_A | 149 | Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM | 1e-20 | |
| 4ddg_A | 399 | Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI | 2e-20 | |
| 1wzv_A | 155 | Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A | 2e-20 | |
| 2bep_A | 159 | Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 | 3e-20 | |
| 2awf_A | 172 | Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co | 6e-20 | |
| 3o2u_A | 190 | NEDD8-conjugating enzyme UBC12; E2 conjugase, liga | 7e-20 | |
| 2f4w_A | 187 | Ubiquitin-conjugating enzyme E2, J2; endoplasmic r | 7e-20 | |
| 1tte_A | 215 | Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq | 1e-19 | |
| 3k9o_A | 201 | Ubiquitin-conjugating enzyme E2 K; E2-25K, complex | 2e-19 | |
| 2q0v_A | 156 | Ubiquitin-conjugating enzyme E2, putative; malaria | 4e-19 | |
| 3rz3_A | 183 | Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj | 4e-19 | |
| 2onu_A | 152 | Ubiquitin-conjugating enzyme, putative; UBC, plasm | 7e-19 | |
| 1jat_B | 138 | Ubiquitin-conjugating enzyme variant MMS2; UEV, li | 1e-18 | |
| 2f4z_A | 193 | Tgtwinscan_2721 - E2 domain; ubiquitin conjugating | 1e-18 | |
| 3e46_A | 253 | Ubiquitin-conjugating enzyme E2-25 kDa; huntington | 2e-18 | |
| 2a4d_A | 160 | Ubiquitin-conjugating enzyme E2 variant 1; alterna | 3e-18 | |
| 2y9m_A | 172 | Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra | 4e-18 | |
| 2hlw_A | 170 | Ubiquitin-conjugating enzyme E2 variant 1; ubiquit | 5e-18 | |
| 2nvu_C | 180 | NEDD8-conjugating enzyme UBC12; multifunction macr | 4e-17 | |
| 2z5d_A | 179 | Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig | 2e-16 | |
| 1y8x_A | 160 | Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju | 2e-16 | |
| 4ds2_A | 167 | Ubiquitin-conjugating enzyme E2, putative; structu | 4e-16 | |
| 1yf9_A | 171 | Ubiquitin carrier protein 4; SGPP, structural geno | 3e-15 | |
| 1zuo_A | 186 | Hypothetical protein LOC92912; ligase, ubiquitin-c | 1e-11 | |
| 3obq_A | 146 | Tumor susceptibility gene 101 protein; protein tra | 4e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-04 |
| >3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Length = 323 | Back alignment and structure |
|---|
Score = 295 bits (755), Expect = 3e-95
Identities = 104/317 (32%), Positives = 157/317 (49%), Gaps = 29/317 (9%)
Query: 310 SPEEPADTPSGQDFSDNKESLDE--DDILRKFDLFKKFDAVEDHLD--------HHYASK 359
E +SL+E +++K F F+ V + D +HY S+
Sbjct: 7 LGEYSKKAAMKPKPLSVLKSLEEKYVAVMKKLQ-FDTFEMVSEDEDGKLGFKVNYHYMSQ 65
Query: 360 A--SLKQPTNKWAKRIQEEWKILENDLP----DTIFVRVYESRMDLLRAVIVGAEGTPYH 413
+ + A+R+ +E L LP ++FVR E R+D+++ +I G TPY
Sbjct: 66 VKNANDANSAARARRLAQEAVTLSTSLPLSSSSSVFVRCDEERLDIMKVLITGPADTPYA 125
Query: 414 DGLFFFDVFFPSSYPNVPPNVYYHS---GGLRLNPNLYNCGKVCLSLLNTWTGNKNEKWM 470
+G F FDV+FP YP+ PP V + +R NPNLYN GKVCLS+LNTW G EKW
Sbjct: 126 NGCFEFDVYFPQDYPSSPPLVNLETTGGHSVRFNPNLYNDGKVCLSILNTWHGRPEEKWN 185
Query: 471 PNMSTMLQVLVSIQALILNQKPYFNEPGYASWNNTAHGEVESHKYNESTFILSLK-TMLY 529
P S+ LQVLVS+Q+LIL +PYFNEPGY T G S +Y+ + ++K ML
Sbjct: 186 PQTSSFLQVLVSVQSLILVAEPYFNEPGYERSRGTPSGTQSSREYDGNIRQATVKWAMLE 245
Query: 530 TLRRPPKHFKDFVIGHFYKHAHDILAACKTYMSGAEVGSLVKGGVQNIHKGLDGCTPHFR 589
+R P FK+ + HFY +I+A C+ +++ + S K + H
Sbjct: 246 QIRNPSPCFKEVIHKHFYLKRVEIMAQCEEWIADIQQYSSDKRVGR--------TMSHHA 297
Query: 590 TSVAGQVDLLVKEFIRI 606
++ L +E +++
Sbjct: 298 AALKRHTAQLREELLKL 314
|
| >2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Length = 136 | Back alignment and structure |
|---|
| >2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Length = 136 | Back alignment and structure |
|---|
| >3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Length = 167 | Back alignment and structure |
|---|
| >2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Length = 125 | Back alignment and structure |
|---|
| >1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 169 | Back alignment and structure |
|---|
| >2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Length = 165 | Back alignment and structure |
|---|
| >1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Length = 158 | Back alignment and structure |
|---|
| >2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Length = 149 | Back alignment and structure |
|---|
| >2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Length = 154 | Back alignment and structure |
|---|
| >2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Length = 152 | Back alignment and structure |
|---|
| >1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Length = 155 | Back alignment and structure |
|---|
| >1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Length = 150 | Back alignment and structure |
|---|
| >2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Length = 216 | Back alignment and structure |
|---|
| >2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Length = 156 | Back alignment and structure |
|---|
| >1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Length = 169 | Back alignment and structure |
|---|
| >2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Length = 161 | Back alignment and structure |
|---|
| >2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 166 | Back alignment and structure |
|---|
| >1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 169 | Back alignment and structure |
|---|
| >3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Length = 194 | Back alignment and structure |
|---|
| >2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Length = 157 | Back alignment and structure |
|---|
| >1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Length = 179 | Back alignment and structure |
|---|
| >3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} Length = 163 | Back alignment and structure |
|---|
| >2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 165 | Back alignment and structure |
|---|
| >3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} PDB: 3fsh_A 2cyx_A 2kly_A Length = 164 | Back alignment and structure |
|---|
| >1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Length = 154 | Back alignment and structure |
|---|
| >1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Length = 149 | Back alignment and structure |
|---|
| >4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Length = 399 | Back alignment and structure |
|---|
| >1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Length = 155 | Back alignment and structure |
|---|
| >2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Length = 159 | Back alignment and structure |
|---|
| >2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Length = 172 | Back alignment and structure |
|---|
| >3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Length = 190 | Back alignment and structure |
|---|
| >2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 187 | Back alignment and structure |
|---|
| >1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Length = 215 | Back alignment and structure |
|---|
| >3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Length = 201 | Back alignment and structure |
|---|
| >2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Length = 156 | Back alignment and structure |
|---|
| >3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Length = 183 | Back alignment and structure |
|---|
| >2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Length = 152 | Back alignment and structure |
|---|
| >1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Length = 138 | Back alignment and structure |
|---|
| >2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 193 | Back alignment and structure |
|---|
| >3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Length = 253 | Back alignment and structure |
|---|
| >2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Length = 160 | Back alignment and structure |
|---|
| >2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Length = 172 | Back alignment and structure |
|---|
| >2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Length = 180 | Back alignment and structure |
|---|
| >2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Length = 179 | Back alignment and structure |
|---|
| >1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Length = 160 | Back alignment and structure |
|---|
| >4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Length = 167 | Back alignment and structure |
|---|
| >1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Length = 171 | Back alignment and structure |
|---|
| >1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Length = 186 | Back alignment and structure |
|---|
| >3obq_A Tumor susceptibility gene 101 protein; protein transprot, ubiquitin binding, protein transport; 1.40A {Homo sapiens} PDB: 3obs_A 3obu_A 3obx_A 3p9g_A* 3p9h_A* 2f0r_A 1kpp_A 1kpq_A 1m4p_A 1m4q_A 1s1q_A Length = 146 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 639 | |||
| 3ceg_A | 323 | Baculoviral IAP repeat-containing protein 6; apopt | 100.0 | |
| 1yh2_A | 169 | HSPC150 protein similar to ubiquitin-conjugating e | 100.0 | |
| 2pwq_A | 216 | Ubiquitin conjugating enzyme; structural genomics | 100.0 | |
| 3h8k_A | 164 | Ubiquitin-conjugating enzyme E2 G2; alpha beta, al | 100.0 | |
| 2ucz_A | 165 | UBC7, ubiquitin conjugating enzyme; ubiquitin conj | 100.0 | |
| 2ayv_A | 166 | Ubiquitin-conjugating enzyme E2; structural genomi | 100.0 | |
| 3rz3_A | 183 | Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj | 100.0 | |
| 1z2u_A | 150 | Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro | 100.0 | |
| 1zdn_A | 158 | Ubiquitin-conjugating enzyme E2S; structural genom | 100.0 | |
| 1ayz_A | 169 | UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin | 100.0 | |
| 2c4o_A | 165 | Ubiquitin-conjugating enzyme E2 D2; thioesterifica | 100.0 | |
| 4gpr_A | 151 | Ubiquitin-conjugating enzyme family protein; ubiqu | 100.0 | |
| 2e2c_A | 156 | Ubiquitin conjugating enzyme; ubiquitin conjugatio | 100.0 | |
| 2r0j_A | 149 | Ubiquitin carrier protein; ubiquitin conjugating, | 100.0 | |
| 2c2v_B | 154 | Ubiquitin-conjugating enzyme E2 N; chaperone, heat | 100.0 | |
| 2awf_A | 172 | Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co | 100.0 | |
| 3rcz_B | 163 | SUMO-conjugating enzyme UBC9; SUMO-like domain, pr | 100.0 | |
| 2aak_A | 152 | UBC1, ubiquitin conjugating enzyme; ubiquitin conj | 100.0 | |
| 1jat_A | 155 | Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig | 100.0 | |
| 1fxt_A | 149 | Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM | 100.0 | |
| 3fn1_B | 167 | NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin | 100.0 | |
| 1i7k_A | 179 | Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A | 100.0 | |
| 3bzh_A | 194 | Ubiquitin-conjugating enzyme E2 E1; structural gen | 100.0 | |
| 3k9o_A | 201 | Ubiquitin-conjugating enzyme E2 K; E2-25K, complex | 100.0 | |
| 2gjd_A | 157 | Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT | 100.0 | |
| 2bep_A | 159 | Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 | 100.0 | |
| 2f4z_A | 193 | Tgtwinscan_2721 - E2 domain; ubiquitin conjugating | 100.0 | |
| 1wzv_A | 155 | Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A | 100.0 | |
| 2grr_A | 161 | Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj | 100.0 | |
| 3e46_A | 253 | Ubiquitin-conjugating enzyme E2-25 kDa; huntington | 100.0 | |
| 1yrv_A | 169 | Ubiquitin-conjugating ligase MGC351130; structural | 100.0 | |
| 2fo3_A | 125 | Ubiquitin-conjugating enzyme; SGC, UBC, structural | 100.0 | |
| 2h2y_A | 136 | Ubiquitin-conjugating enzyme; structural genomics, | 100.0 | |
| 1y8x_A | 160 | Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju | 100.0 | |
| 1tte_A | 215 | Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq | 100.0 | |
| 1c4z_D | 154 | UBCH7, ubiquitin conjugating enzyme E2; bilobal st | 100.0 | |
| 2y9m_A | 172 | Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra | 100.0 | |
| 2nvu_C | 180 | NEDD8-conjugating enzyme UBC12; multifunction macr | 100.0 | |
| 4ddg_A | 399 | Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI | 100.0 | |
| 2onu_A | 152 | Ubiquitin-conjugating enzyme, putative; UBC, plasm | 100.0 | |
| 3o2u_A | 190 | NEDD8-conjugating enzyme UBC12; E2 conjugase, liga | 99.98 | |
| 2z5d_A | 179 | Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig | 99.98 | |
| 2a7l_A | 136 | Hypothetical ubiquitin-conjugating enzyme LOC55284 | 99.98 | |
| 2a4d_A | 160 | Ubiquitin-conjugating enzyme E2 variant 1; alterna | 99.98 | |
| 2hlw_A | 170 | Ubiquitin-conjugating enzyme E2 variant 1; ubiquit | 99.97 | |
| 2q0v_A | 156 | Ubiquitin-conjugating enzyme E2, putative; malaria | 99.97 | |
| 1yf9_A | 171 | Ubiquitin carrier protein 4; SGPP, structural geno | 99.97 | |
| 2f4w_A | 187 | Ubiquitin-conjugating enzyme E2, J2; endoplasmic r | 99.97 | |
| 1jat_B | 138 | Ubiquitin-conjugating enzyme variant MMS2; UEV, li | 99.97 | |
| 4ds2_A | 167 | Ubiquitin-conjugating enzyme E2, putative; structu | 99.97 | |
| 1zuo_A | 186 | Hypothetical protein LOC92912; ligase, ubiquitin-c | 99.97 | |
| 2z6o_A | 172 | UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, p | 99.84 | |
| 3r3q_A | 162 | Suppressor protein STP22 of temperature-sensitive | 99.59 | |
| 3kpa_A | 168 | Probable ubiquitin fold modifier conjugating ENZY; | 99.45 | |
| 3obq_A | 146 | Tumor susceptibility gene 101 protein; protein tra | 99.16 | |
| 2ebm_A | 128 | RWD domain-containing protein 1; alpha+beta sandwi | 91.21 | |
| 2day_A | 128 | Ring finger protein 25; ligase, metal-binding, UB1 | 88.92 | |
| 3zqs_A | 186 | E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A | 87.09 | |
| 2yz0_A | 138 | Serine/threonine-protein kinase GCN2; A-B-B-B-B-A- | 85.71 |
| >3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.3e-48 Score=406.32 Aligned_cols=259 Identities=38% Similarity=0.710 Sum_probs=221.4
Q ss_pred hhhcccccccCCc--------ccccccc--cccCCCCHHHHHHHHHHHHHHHhCCCC----CeeEEecCCCCceEEEEEE
Q 042246 340 DLFKKFDAVEDHL--------DHHYASK--ASLKQPTNKWAKRIQEEWKILENDLPD----TIFVRVYESRMDLLRAVIV 405 (639)
Q Consensus 340 ~~fk~fd~ve~~s--------dHhy~~~--ss~~~~s~~a~KRL~KELk~Lqk~~P~----gI~Vrp~ednL~~W~avI~ 405 (639)
.+|.+||++.+.+ +|||.+. ......+..+.+||++|++.|++++|. ++++.+.++|++.|+++|.
T Consensus 38 ~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~kRL~kEl~~L~k~~p~g~~~~i~v~~~ednl~~w~~~I~ 117 (323)
T 3ceg_A 38 LQFDTFEMVSEDEDGKLGFKVNYHYMSQVKNANDANSAARARRLAQEAVTLSTSLPLSSSSSVFVRCDEERLDIMKVLIT 117 (323)
T ss_dssp TSEEEECCEEECTTSCEEESSCCTTHHHHHTCCCCCCHHHHHHHHHHHHHHHHHCCCCSSCCEEEEEESSCTTEEEEEEE
T ss_pred hcCceeeecccccccccccccchHHHhhhhccCCCCCHHHHHHHHHHHHHHHhCCCCCcccceeecccCCCccccEEEEe
Confidence 3599999887655 4788765 223456789999999999999999886 4668889999999999999
Q ss_pred cCCCCCCCCceEEEEEEcCCCCCCCCCeeeeccCC---cccCCCccCCCceeecCccccCCCCCCCCCcCcccHHHHHHH
Q 042246 406 GAEGTPYHDGLFFFDVFFPSSYPNVPPNVYYHSGG---LRLNPNLYNCGKVCLSLLNTWTGNKNEKWMPNMSTMLQVLVS 482 (639)
Q Consensus 406 GP~gTPYeGGlF~fdI~FP~dYP~~PPkV~F~T~~---~IfHPNVy~~GkVCLSLL~Tw~G~~~E~WSPa~sTIlqVLlS 482 (639)
||+||||+||+|+|+|.||++||++||+|+|.|++ .|||||||.+|+|||++|++|.|...+.|+|++++|.+||++
T Consensus 118 GP~~TpYegG~F~l~I~fP~dYP~~PP~V~F~T~~g~~~ifHPNV~~~G~ICLsiL~~~~g~~~e~WsPa~stI~~VLls 197 (323)
T 3ceg_A 118 GPADTPYANGCFEFDVYFPQDYPSSPPLVNLETTGGHSVRFNPNLYNDGKVCLSILNTWHGRPEEKWNPQTSSFLQVLVS 197 (323)
T ss_dssp BCTTSTTBTCEEEEEEECCTTTTTSCCEEEECCSTTTTCCCBTTBCTTCBBCCGGGTSSCCCGGGSCCTTTCCHHHHHHH
T ss_pred CCCCCCcCCCEEEEEEeCCCCCCCCCCeEEEeccCCCcccccCCCCcCCeEechhhccccCCCcCCCCcCcCCHHHHHHH
Confidence 99999999999999999999999999999999973 499999999999999999999998889999996689999999
Q ss_pred HHHHHhcCCCCCCCCCcccccCCcchhhhhhhccHHHHHHHHH-HHHHHhcCCChhhHHHHHHHHhhcHHHHHHHHHHhh
Q 042246 483 IQALILNQKPYFNEPGYASWNNTAHGEVESHKYNESTFILSLK-TMLYTLRRPPKHFKDFVIGHFYKHAHDILAACKTYM 561 (639)
Q Consensus 483 IQsLLl~pnPyfnEPg~e~l~~ta~ge~~s~~Yne~~f~~s~k-tm~~~L~kpPk~Fe~~V~~HF~~~a~~Il~~~k~~~ 561 (639)
||+||.+++|++++|+++...+..........|++.++..+++ +|.++|++||..|+++|+.||+.++..|+++|++|+
T Consensus 198 IqsLL~~~~Pn~~dP~~~~a~a~~~~~~d~~~Y~~~vr~~t~k~A~~~~l~~Pp~~f~~~i~~hF~~~~~~i~~~~~~w~ 277 (323)
T 3ceg_A 198 VQSLILVAEPYFNEPGYERSRGTPSGTQSSREYDGNIRQATVKWAMLEQIRNPSPCFKEVIHKHFYLKRVEIMAQCEEWI 277 (323)
T ss_dssp HHHHTSCSSGGGGSTTGGGGTTSHHHHHHHHHHHHHHHHHHHHHTTHHHHHSCCTTTHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHcCCCCCCCCccCHHHHHhhhhhhhHHHHHHHHHHHHHHHhhHHHHhCCCcccHHHHHHHHHHhHHHHHHHHHHHH
Confidence 9999999999999999887666666677889999999999998 899999999999999999999999999999999999
Q ss_pred ccCCccccccCCcccccCCCCCCChHHHHHHHHhHHHHHHHHHhc
Q 042246 562 SGAEVGSLVKGGVQNIHKGLDGCTPHFRTSVAGQVDLLVKEFIRI 606 (639)
Q Consensus 562 ~ga~vg~~~~g~~~~~~~~~~~~s~~Fk~~l~~~~~~Lv~~F~~~ 606 (639)
+++..... +............+|...+..|.++|.++
T Consensus 278 ~e~~~~~~--------~~~~~~~~~~~~~~l~~~~~~l~~~l~~~ 314 (323)
T 3ceg_A 278 ADIQQYSS--------DKRVGRTMSHHAAALKRHTAQLREELLKL 314 (323)
T ss_dssp HHHTTC--------------CHHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred Hhhhhhcc--------ccccchhhhhHHHHHHHHHHHHHHHHHhc
Confidence 87542210 11111122344577888999999999887
|
| >1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A | Back alignment and structure |
|---|
| >2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A | Back alignment and structure |
|---|
| >1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... | Back alignment and structure |
|---|
| >1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A | Back alignment and structure |
|---|
| >4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A | Back alignment and structure |
|---|
| >2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A | Back alignment and structure |
|---|
| >3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A | Back alignment and structure |
|---|
| >1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F | Back alignment and structure |
|---|
| >1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A | Back alignment and structure |
|---|
| >3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A | Back alignment and structure |
|---|
| >1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A | Back alignment and structure |
|---|
| >3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A | Back alignment and structure |
|---|
| >2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B | Back alignment and structure |
|---|
| >2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A | Back alignment and structure |
|---|
| >2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A | Back alignment and structure |
|---|
| >2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A | Back alignment and structure |
|---|
| >3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* | Back alignment and structure |
|---|
| >1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 | Back alignment and structure |
|---|
| >1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C | Back alignment and structure |
|---|
| >2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A | Back alignment and structure |
|---|
| >2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A | Back alignment and structure |
|---|
| >2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C | Back alignment and structure |
|---|
| >2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A | Back alignment and structure |
|---|
| >2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C | Back alignment and structure |
|---|
| >1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B | Back alignment and structure |
|---|
| >4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A | Back alignment and structure |
|---|
| >2z6o_A UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, polymorphism, UBL conjugation pathway, ligase; 1.60A {Homo sapiens} PDB: 2z6p_A 1ywz_A 2in1_A 2k07_A 3e2g_A 3evx_A | Back alignment and structure |
|---|
| >3r3q_A Suppressor protein STP22 of temperature-sensitive factor receptor and arginine permease...; endosomal sorting, ESCRT-I; 1.45A {Saccharomyces cerevisiae} SCOP: d.20.1.2 PDB: 3r42_A 1uzx_A* | Back alignment and structure |
|---|
| >3kpa_A Probable ubiquitin fold modifier conjugating ENZY; UBL conjugation pathway, ligase, structural genomics, PSI; 2.20A {Leishmania major} SCOP: d.20.1.4 | Back alignment and structure |
|---|
| >3obq_A Tumor susceptibility gene 101 protein; protein transprot, ubiquitin binding, protein transport; 1.40A {Homo sapiens} SCOP: d.20.1.2 PDB: 3obs_A 3obu_A 3obx_A 3p9g_A* 3p9h_A* 2f0r_A 1kpp_A 1kpq_A 1m4p_A 1m4q_A 1s1q_A | Back alignment and structure |
|---|
| >2ebm_A RWD domain-containing protein 1; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2day_A Ring finger protein 25; ligase, metal-binding, UB1 conjugation, UB1 conjugation pathway, RWD domain, alpha+beta sandwich fold, structural genomics; NMR {Homo sapiens} SCOP: d.20.1.3 PDB: 2dmf_A | Back alignment and structure |
|---|
| >3zqs_A E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2yz0_A Serine/threonine-protein kinase GCN2; A-B-B-B-B-A-A, amino acid starvation signal response, EIF2alpha kinase, transferase; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 639 | ||||
| d1z2ua1 | 147 | d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, U | 4e-24 | |
| d2a7la1 | 117 | d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 | 2e-23 | |
| d2f4wa1 | 157 | d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, | 4e-23 | |
| d2fo3a1 | 109 | d.20.1.1 (A:9-117) Putative ubiquitin-conjugating | 1e-21 | |
| d1s1qa_ | 141 | d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG10 | 2e-21 | |
| d2awfa1 | 125 | d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, U | 4e-21 | |
| d2a4da1 | 139 | d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, | 9e-21 | |
| d2ucza_ | 164 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B | 2e-19 | |
| d1yh2a1 | 154 | d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, U | 3e-19 | |
| d1z3da1 | 149 | d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, U | 5e-19 | |
| d1y6la_ | 148 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H | 8e-19 | |
| d1ayza_ | 153 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B | 2e-18 | |
| d1pzva_ | 161 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {N | 4e-18 | |
| d1jata_ | 152 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B | 7e-18 | |
| d1j7db_ | 149 | d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {H | 8e-18 | |
| d1wzva1 | 150 | d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, U | 3e-17 | |
| d1fzya_ | 149 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B | 9e-16 | |
| d1zdna1 | 151 | d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, U | 1e-15 | |
| d2e2ca_ | 156 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {C | 3e-15 | |
| d1jatb_ | 136 | d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {B | 4e-15 | |
| d2uyza1 | 156 | d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, U | 5e-15 | |
| d1i7ka_ | 146 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H | 4e-14 | |
| d1yrva1 | 148 | d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, U | 4e-14 | |
| d1uzxa_ | 152 | d.20.1.2 (A:) Vacuolar protein sorting-associated | 5e-14 | |
| d1c4zd_ | 144 | d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {H | 3e-13 | |
| d1y8xa1 | 157 | d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, | 5e-13 | |
| d2f4za1 | 161 | d.20.1.1 (A:32-192) Hypothetical protein Tgtwinsca | 2e-12 | |
| d2bepa1 | 154 | d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2 | 6e-12 | |
| d2z5da1 | 152 | d.20.1.1 (A:23-174) Ubiquitin conjugating enzyme, | 4e-11 | |
| d1yf9a1 | 158 | d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, | 1e-09 | |
| d1zuoa1 | 162 | d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme | 2e-07 |
| >d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Length = 147 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: UBC-like superfamily: UBC-like family: UBC-related domain: Ubiquitin conjugating enzyme, UBC species: Caenorhabditis elegans, E2 2 [TaxId: 6239]
Score = 96.4 bits (239), Expect = 4e-24
Identities = 36/131 (27%), Positives = 60/131 (45%), Gaps = 10/131 (7%)
Query: 371 KRIQEEWKILENDLPDTIFVRVYESRMDLLRAVIVGAEGTPYHDGLFFFDVFFPSSYPNV 430
KRIQ+E + L D P + +A I+G +PY G+FF + FP+ YP
Sbjct: 4 KRIQKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPESPYQGGVFFLTIHFPTDYPFK 63
Query: 431 PPNVYYHSGGLRLNPNLYNCGKVCLSLLNTWTGNKNEKWMPNMSTMLQVLVSIQALILNQ 490
PP V + + +PN+ + G +CL +L + T+ +VL+SI +L+ +
Sbjct: 64 PPKVAFTTR--IYHPNINSNGSICLDILRSQWSPAL--------TISKVLLSICSLLCDP 113
Query: 491 KPYFNEPGYAS 501
P +
Sbjct: 114 NPDDPLVPEIA 124
|
| >d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Length = 157 | Back information, alignment and structure |
|---|
| >d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Length = 109 | Back information, alignment and structure |
|---|
| >d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Length = 164 | Back information, alignment and structure |
|---|
| >d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Length = 154 | Back information, alignment and structure |
|---|
| >d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Length = 149 | Back information, alignment and structure |
|---|
| >d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Length = 148 | Back information, alignment and structure |
|---|
| >d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Length = 153 | Back information, alignment and structure |
|---|
| >d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Length = 161 | Back information, alignment and structure |
|---|
| >d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Length = 152 | Back information, alignment and structure |
|---|
| >d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
| >d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Length = 150 | Back information, alignment and structure |
|---|
| >d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Length = 149 | Back information, alignment and structure |
|---|
| >d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Length = 151 | Back information, alignment and structure |
|---|
| >d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Length = 156 | Back information, alignment and structure |
|---|
| >d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Length = 136 | Back information, alignment and structure |
|---|
| >d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Length = 146 | Back information, alignment and structure |
|---|
| >d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Length = 148 | Back information, alignment and structure |
|---|
| >d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 152 | Back information, alignment and structure |
|---|
| >d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Length = 144 | Back information, alignment and structure |
|---|
| >d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Length = 157 | Back information, alignment and structure |
|---|
| >d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Length = 161 | Back information, alignment and structure |
|---|
| >d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Length = 154 | Back information, alignment and structure |
|---|
| >d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Length = 158 | Back information, alignment and structure |
|---|
| >d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 639 | |||
| d2ucza_ | 164 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 100.0 | |
| d1y6la_ | 148 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 100.0 | |
| d1z2ua1 | 147 | Ubiquitin conjugating enzyme, UBC {Caenorhabditis | 100.0 | |
| d1yh2a1 | 154 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 100.0 | |
| d1ayza_ | 153 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 100.0 | |
| d1z3da1 | 149 | Ubiquitin conjugating enzyme, UBC {Nematode (Caeno | 100.0 | |
| d1i7ka_ | 146 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 100.0 | |
| d1j7db_ | 149 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 100.0 | |
| d1zdna1 | 151 | Ubiquitin conjugating enzyme, UBC {Human(Homo sapi | 100.0 | |
| d1jata_ | 152 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 100.0 | |
| d2uyza1 | 156 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 100.0 | |
| d2e2ca_ | 156 | Ubiquitin conjugating enzyme, UBC {Clam (Spisula s | 100.0 | |
| d1pzva_ | 161 | Ubiquitin conjugating enzyme, UBC {Nematode (Caeno | 100.0 | |
| d1yrva1 | 148 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 100.0 | |
| d1wzva1 | 150 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 100.0 | |
| d1fzya_ | 149 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 100.0 | |
| d2bepa1 | 154 | Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain | 99.98 | |
| d1c4zd_ | 144 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.98 | |
| d2awfa1 | 125 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.97 | |
| d2a7la1 | 117 | Ubiquitin-protein ligase W (E2 W) {Human (Homo sap | 99.97 | |
| d2fo3a1 | 109 | Putative ubiquitin-conjugating enzyme, E2 domain { | 99.97 | |
| d2f4za1 | 161 | Hypothetical protein Tgtwinscan_2721, E2 domain {T | 99.97 | |
| d2f4wa1 | 157 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.97 | |
| d1y8xa1 | 157 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.96 | |
| d2z5da1 | 152 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.96 | |
| d1zuoa1 | 162 | Ubiquitin-conjugating enzyme E2 Q2, C-terminal dom | 99.95 | |
| d2a4da1 | 139 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.95 | |
| d1yf9a1 | 158 | Ubiquitin conjugating enzyme, UBC {Leishmania majo | 99.95 | |
| d1jatb_ | 136 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 99.95 | |
| d1s1qa_ | 141 | Tumor susceptibility gene 101 (TSG101) {Human (Hom | 99.72 | |
| d1uzxa_ | 152 | Vacuolar protein sorting-associated {Baker's yeast | 99.55 | |
| d2in1a1 | 162 | Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapie | 96.6 | |
| d2daya1 | 115 | E3 ubiquitin-protein ligase RNF25 {Human (Homo sap | 89.34 |
| >d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: UBC-like superfamily: UBC-like family: UBC-related domain: Ubiquitin conjugating enzyme, UBC species: Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]
Probab=100.00 E-value=2.8e-35 Score=275.68 Aligned_cols=153 Identities=26% Similarity=0.456 Sum_probs=132.5
Q ss_pred CHHHHHHHHHHHHHHHhCCCCCeeEEe-cCCCCceEEEEEEcCCCCCCCCceEEEEEEcCCCCCCCCCeeeeccCCcccC
Q 042246 366 TNKWAKRIQEEWKILENDLPDTIFVRV-YESRMDLLRAVIVGAEGTPYHDGLFFFDVFFPSSYPNVPPNVYYHSGGLRLN 444 (639)
Q Consensus 366 s~~a~KRL~KELk~Lqk~~P~gI~Vrp-~ednL~~W~avI~GP~gTPYeGGlF~fdI~FP~dYP~~PPkV~F~T~~~IfH 444 (639)
+..|.|||++|+++|+++++.||+|.+ .++|++.|+++|.||+||||+||+|+|+|.||++||++||+|+|.|+ +||
T Consensus 1 s~~a~kRL~~E~~~l~~~~~~gi~~~p~~e~nl~~w~~~I~Gp~~tpy~gg~f~~~i~fp~~YP~~pP~v~f~t~--i~H 78 (164)
T d2ucza_ 1 SKTAQKRLLKELQQLIKDSPPGIVAGPKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPKLTFTPS--ILH 78 (164)
T ss_dssp CHHHHHHHHHHHHHHHHSCCTTEEEEESSSSCCSEEEEEEECCTTSTTTTCEEEEEEECCTTTTTSCCEEEESSC--CSC
T ss_pred CHHHHHHHHHHHHHHhhCCCCCEEEEECCccchhhhheeeeCCCcccccCCeeEEEEecCCCCCCCCCeEEeecC--cee
Confidence 468999999999999999999999997 56799999999999999999999999999999999999999999999 999
Q ss_pred CCccCCCceeecCccccC------CCCCCCCCcCcccHHHHHHHHHHHHhcCCCCCCCCCcccccCCcchhhhhhhccHH
Q 042246 445 PNLYNCGKVCLSLLNTWT------GNKNEKWMPNMSTMLQVLVSIQALILNQKPYFNEPGYASWNNTAHGEVESHKYNES 518 (639)
Q Consensus 445 PNVy~~GkVCLSLL~Tw~------G~~~E~WSPa~sTIlqVLlSIQsLLl~pnPyfnEPg~e~l~~ta~ge~~s~~Yne~ 518 (639)
|||+.+|+||+++|+++. ....+.|+|++ +|.+||++|++||.+||+ ++|... .
T Consensus 79 Pnv~~~G~vCl~il~~~~~~~~~~~~~~~~w~p~~-ti~~il~~i~~ll~~p~~--~~p~n~----e------------- 138 (164)
T d2ucza_ 79 PNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQ-SVEKILLSVMSMLSEPNI--ESGANI----D------------- 138 (164)
T ss_dssp TTBCTTSBBCCGGGSCCCSCTTSTTTTTTSCCTTC-CHHHHHHHHHHHHHSCCG--GGCCCH----H-------------
T ss_pred ceEcCCCCeeeccccCccccccccccccccCCccc-cHHHHHHHHHHHHhCCCC--CCcccH----H-------------
Confidence 999999999999998643 23457899996 999999999999999887 777321 1
Q ss_pred HHHHHHHHHHHHhcCCChhhHHHHHHHHhh
Q 042246 519 TFILSLKTMLYTLRRPPKHFKDFVIGHFYK 548 (639)
Q Consensus 519 ~f~~s~ktm~~~L~kpPk~Fe~~V~~HF~~ 548 (639)
++.++++.++.|++.|+++.++
T Consensus 139 --------aa~l~~~~~~~f~~~~r~~~~k 160 (164)
T d2ucza_ 139 --------ACILWRDNRPEFERQVKLSILK 160 (164)
T ss_dssp --------HHHHHHTTHHHHHHHHHHHHHH
T ss_pred --------HHHHHHHCHHHHHHHHHHHHHH
Confidence 2444566677888877766554
|
| >d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} | Back information, alignment and structure |
|---|
| >d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} | Back information, alignment and structure |
|---|
| >d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2in1a1 d.20.1.4 (A:3-164) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2daya1 d.20.1.3 (A:8-122) E3 ubiquitin-protein ligase RNF25 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|