Citrus Sinensis ID: 042271


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------
FRKFKNLEHLDMGEVQVDVNTSFLQIVGESKPSLKFLSLINSSKNTILDQGLRQLVHLQELYIGGYDLRGSLPWCLANMTSLQVLYASSNELTGNISPGLCELVLMRELHIDNNDLRGSLPLCLANLTSLRVLDVSDNQLTQNISSSPLMHLTSIEELILSNNHFFQSPISLEPLFNLSKRKTFDSEICAETESHYNSLTPKFQLTFISLSGYIDGGTFPKFLYHQHDLKNADLSHLNLSGKFPNWLVENNANLERLLLADNSLFGSFWMPIHSHQKLATLDVSNNFFRGHIPVEIGTYLPGLMDLNLSRNAFNGSIPSSFADMKMLERVDISYNQLTGEIPERMAARCFSLEILALSNNSLQGHIFSEKFNLTNLMTLQLDGNKFTGEILESLSKCYLLEGLYLSDNHLTGEIPRWLGNLSALEDIIMPNNNLEGPIPIEFCQLNSLKILDLSNNSIFRTLPSCFSPASIEQLHLSKNKIEGRLESIIHDSPHLVTLDLSCNSLHGSIPNQIGRLP
ccccccccEEEccccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHcccccccEEEccccccEEcccHHccccccccEEcccccccccccccccccccccccEEEccccccccccccccccccccEEEEEccccEEEcccccccccccccccEEEcccccccccccHHHHHcccccEEEcccccccccccHHHHHcccccccEEccccEEEEEccccccccccccEEEcccccccccccHHHHHccccccEEEccccEEEEcccccccccccccEEccccccccccccHHHHHccccccEEEccccEEEEEccccccccccccEEEccccccEEcccHHHHccccccccccccccccccccHHccccccccEEEcccccccccccHHHHccccccEEEccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccc
cccccccEEEEEccccccccccccHHHHcccccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEEccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEEcccccccccHHHcccccccEEEEccccccccccHHHccccccccEEEEEEccccccccccHHHccccccEEEEEccccccccccHHHHHccccccEEEEccccccccccHHHccccccEEEEEccccccccccHHHHHHcccccEEEEccccccccccHHHccccccEEEEcccccccccccHHHHHHcccccEEEEccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccc
frkfknlehldmgevqVDVNTSFLQIvgeskpslKFLSLINSSKNTILDQGLRQLVHLQELYiggydlrgslpwclANMTSLQVLYASsneltgnispgLCELVLMRElhidnndlrgslplclanltslrvldvsdnqltqnisssplmhlTSIEELILsnnhffqspisleplfnlskrktfdseicaeteshynsltpkfQLTFIslsgyidggtfpkflyhqhdlknadlshlnlsgkfpnwlvENNANLERLLLADnslfgsfwmpihshqklatldvsnnffrghipveigtylpglmdlnlsrnafngsipssfaDMKMLERVDISYNQLTGEIPERMAARCFSLEILALSNnslqghifsekfnltnLMTLQLDGNKFTGEILESLSKCYlleglylsdnhltgeiprwlgnlsalediimpnnnlegpipiefcqlnslkildlsnnsifrtlpscfspasieQLHLSKNKIEGRLEsiihdsphlvtldlscnslhgsipnqigrlp
frkfknlehldmgevqvDVNTSFLQIVGESKPSLKFLSLINSSKNTILDQGLRQLVHLQELYIGGYDLRGSLPWCLANMTSLQVLYASSNELTGNISPGLCELVLMRELHIDNNDLRGSLPLCLANLTSLRVLDVSDNQLTQNISSSPLMHLTSIEELILSNNHFFQSPISLEPLFNLSKRKTFDSEICAETeshynsltpKFQLTFISLSGYIDGGTFPKFLYHQHDLKNADLSHLNLSGKFPNWLVENNANLERLLLADNSLFGSFWMPIHSHQKLATLDVSNNFFRGHIPVEIGTYLPGLMDLNLSRNAFNGSIPSSFADMKMLERVDISYNQLTGEIPERMAARCFSLEILALSNNSLQGHIFSEKFNLTNLMTLQLDGNKFTGEILESLSKCYLLEGLYLSDNHLTGEIPRWLGNLSALEDIIMPNNNLEGPIPIEFCQLNSLKILDLSNNSIFRTLPSCFSPASIEQLHLSKNKIEGRLESIIHDSPHLVTLDLSCNslhgsipnqigrlp
FRKFKNLEHLDMGEVQVDVNTSFLQIVGESKPSLKFLSLINSSKNTILDQGLRQLVHLQELYIGGYDLRGSLPWCLANMTSLQVLYASSNELTGNISPGLCELVLMRELHIDNNDLRGSLPLCLANLTSLRVLDVSDNQLTQNISSSPLMHLTSIEELILSNNHFFQSPISLEPLFNLSKRKTFDSEICAETESHYNSLTPKFQLTFISLSGYIDGGTFPKFLYHQHDLKNADLSHLNLSGKFPNWLVennanlerllladnSLFGSFWMPIHSHQKLATLDVSNNFFRGHIPVEIGTYLPGLMDLNLSRNAFNGSIPSSFADMKMLERVDISYNQLTGEIPERMAARCFSLEILALSNNSLQGHIFSEKFNLTNLMTLQLDGNKFTGEILESLSKCYLLEGLYLSDNHLTGEIPRWLGNLSALEDIIMPNNNLEGPIPIEFCQLNSLKILDLSNNSIFRTLPSCFSPASIEQLHLSKNKIEGRLESIIHDSPHLVTLDLSCNSLHGSIPNQIGRLP
**********DMGEVQVDVNTSFLQIVGESKPSLKFLSLINSSKNTILDQGLRQLVHLQELYIGGYDLRGSLPWCLANMTSLQVLYASSNELTGNISPGLCELVLMRELHIDNNDLRGSLPLCLANLTSLRVLDVSDNQLTQNISSSPLMHLTSIEELILSNNHFFQSPISLEPLFNLSKRKTFDSEICAETESHYNSLTPKFQLTFISLSGYIDGGTFPKFLYHQHDLKNADLSHLNLSGKFPNWLVENNANLERLLLADNSLFGSFWMPIHSHQKLATLDVSNNFFRGHIPVEIGTYLPGLMDLNLSRNAFNGSIPSSFADMKMLERVDISYNQLTGEIPERMAARCFSLEILALSNNSLQGHIFSEKFNLTNLMTLQLDGNKFTGEILESLSKCYLLEGLYLSDNHLTGEIPRWLGNLSALEDIIMPNNNLEGPIPIEFCQLNSLKILDLSNNSIFRTLPSCFSPASIEQLHLSKNKIEGRLESIIHDSPHLVTLDLSCNSLH***********
FRKFKNLEHLDMGEVQVDVNTSFLQIVGESKPSLKFLSLINSSKNTILDQGLRQLVHLQELYIGGYDLRGSLPWCLANMTSLQVLYASSNELTGNISPGLCELVLMRELHIDNNDLRGSLPLCLANLTSLRVLDVSDNQLTQNISSSPLMHLTSIEELILSNNHFFQSPISLEPLFNLSKRKTFDSEICAETESHYNSLTPKFQLTFISLSGYIDGGTFPKFLYHQHDLKNADLSHLNLSGKFPNWLVENNANLERLLLADNSLFGSFWMPIHSHQKLATLDVSNNFFRGHIPVEIGTYLPGLMDLNLSRNAFNGSIPSSFADMKMLERVDISYNQLTGEIPERMAARCFSLEILALSNNSLQGHIFSEKFNLTNLMTLQLDGNKFTGEILESLSKCYLLEGLYLSDNHLTGEIPRWLGNLSALEDIIMPNNNLEGPIPIEFCQLNSLKILDLSNNSIFRTLPSCFSPASIEQLHLSKNKIEGRLESIIHDSPHLVTLDLSCNSLHGSIPNQIGRLP
FRKFKNLEHLDMGEVQVDVNTSFLQIVGESKPSLKFLSLINSSKNTILDQGLRQLVHLQELYIGGYDLRGSLPWCLANMTSLQVLYASSNELTGNISPGLCELVLMRELHIDNNDLRGSLPLCLANLTSLRVLDVSDNQLTQNISSSPLMHLTSIEELILSNNHFFQSPISLEPLFNLSKRKTFDSEICAETESHYNSLTPKFQLTFISLSGYIDGGTFPKFLYHQHDLKNADLSHLNLSGKFPNWLVENNANLERLLLADNSLFGSFWMPIHSHQKLATLDVSNNFFRGHIPVEIGTYLPGLMDLNLSRNAFNGSIPSSFADMKMLERVDISYNQLTGEIPERMAARCFSLEILALSNNSLQGHIFSEKFNLTNLMTLQLDGNKFTGEILESLSKCYLLEGLYLSDNHLTGEIPRWLGNLSALEDIIMPNNNLEGPIPIEFCQLNSLKILDLSNNSIFRTLPSCFSPASIEQLHLSKNKIEGRLESIIHDSPHLVTLDLSCNSLHGSIPNQIGRLP
**KFKNLEHLDMGEVQVDVNTSFLQIVGESKPSLKFLSLINSSKNTILDQGLRQLVHLQELYIGGYDLRGSLPWCLANMTSLQVLYASSNELTGNISPGLCELVLMRELHIDNNDLRGSLPLCLANLTSLRVLDVSDNQLTQNISSSPLMHLTSIEELILSNNHFFQSPISLEPLFNLSKRKTFDSEICAETESHYNSLTPKFQLTFISLSGYIDGGTFPKFLYHQHDLKNADLSHLNLSGKFPNWLVENNANLERLLLADNSLFGSFWMPIHSHQKLATLDVSNNFFRGHIPVEIGTYLPGLMDLNLSRNAFNGSIPSSFADMKMLERVDISYNQLTGEIPERMAARCFSLEILALSNNSLQGHIFSEKFNLTNLMTLQLDGNKFTGEILESLSKCYLLEGLYLSDNHLTGEIPRWLGNLSALEDIIMPNNNLEGPIPIEFCQLNSLKILDLSNNSIFRTLPSCFSPASIEQLHLSKNKIEGRLESIIHDSPHLVTLDLSCNSLHGSIPNQIGRLP
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FRKFKNLEHLDMGEVQVDVNTSFLQIVGESKPSLKFLSLINSSKNTILDQGLRQLVHLQELYIGGYDLRGSLPWCLANMTSLQVLYASSNELTGNISPGLCELVLMRELHIDNNDLRGSLPLCLANLTSLRVLDVSDNQLTQNISSSPLMHLTSIEELILSNNHFFQSPISLEPLFNLSKRKTFDSEICAETESHYNSLTPKFQLTFISLSGYIDGGTFPKFLYHQHDLKNADLSHLNLSGKFPNWLVENNANLERLLLADNSLFGSFWMPIHSHQKLATLDVSNNFFRGHIPVEIGTYLPGLMDLNLSRNAFNGSIPSSFADMKMLERVDISYNQLTGEIPERMAARCFSLEILALSNNSLQGHIFSEKFNLTNLMTLQLDGNKFTGEILESLSKCYLLEGLYLSDNHLTGEIPRWLGNLSALEDIIMPNNNLEGPIPIEFCQLNSLKILDLSNNSIFRTLPSCFSPASIEQLHLSKNKIEGRLESIIHDSPHLVTLDLSCNSLHGSIPNQIGRLP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query517 2.2.26 [Sep-21-2011]
C0LGS2 1136 Probable LRR receptor-lik no no 0.872 0.397 0.351 4e-44
Q9FL28 1173 LRR receptor-like serine/ no no 0.872 0.384 0.343 1e-42
C0LGQ5 1249 LRR receptor-like serine/ no no 0.872 0.361 0.304 2e-42
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.874 0.361 0.301 3e-42
P93194 1109 Receptor-like protein kin N/A no 0.912 0.425 0.299 3e-41
C0LGV1 1135 LRR receptor-like serine/ no no 0.880 0.400 0.317 4e-41
Q9LHP4 1141 Receptor-like protein kin no no 0.891 0.404 0.308 4e-40
Q9LYN8 1192 Leucine-rich repeat recep no no 0.810 0.351 0.314 3e-39
Q9SHI2 1101 Leucine-rich repeat recep no no 0.920 0.432 0.299 2e-38
Q9M0G7 1013 Leucine-rich repeat recep no no 0.727 0.371 0.341 4e-37
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function desciption
 Score =  179 bits (454), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 164/466 (35%), Positives = 236/466 (50%), Gaps = 15/466 (3%)

Query: 58  LQELYIGGYDLRGSLPWCLANMTSLQVLYASSNELTGNISPGLCELVLMRELHIDNNDLR 117
           LQ L I      G +P  LAN+T LQ+L  S N+LTG I   L  L  ++ L +D N L+
Sbjct: 164 LQFLDISSNTFSGQIPSGLANLTQLQLLNLSYNQLTGEIPASLGNLQSLQYLWLDFNLLQ 223

Query: 118 GSLPLCLANLTSLRVLDVSDNQLTQNISSSPLMHLTSIEELILSNNHFFQS-PISLEPLF 176
           G+LP  ++N +SL  L  S+N++   I ++    L  +E L LSNN+F  + P SL    
Sbjct: 224 GTLPSAISNCSSLVHLSASENEIGGVIPAA-YGALPKLEVLSLSNNNFSGTVPFSLFCNT 282

Query: 177 NLSKRK----TFDSEICAETESHYNSLTPKFQLTFISLSGYIDGGTFPKFLYHQHDLKNA 232
           +L+  +     F   +  ET ++      +  L  + L      G FP +L +   LKN 
Sbjct: 283 SLTIVQLGFNAFSDIVRPETTANC-----RTGLQVLDLQENRISGRFPLWLTNILSLKNL 337

Query: 233 DLSHLNLSGKFPNWLVENNANLERLLLADNSLFGSFWMPIHSHQKLATLDVSNNFFRGHI 292
           D+S    SG+ P   + N   LE L LA+NSL G   + I     L  LD   N  +G I
Sbjct: 338 DVSGNLFSGEIPPD-IGNLKRLEELKLANNSLTGEIPVEIKQCGSLDVLDFEGNSLKGQI 396

Query: 293 PVEIGTYLPGLMDLNLSRNAFNGSIPSSFADMKMLERVDISYNQLTGEIPERMAARCFSL 352
           P  +G Y+  L  L+L RN+F+G +PSS  +++ LER+++  N L G  P  + A   SL
Sbjct: 397 PEFLG-YMKALKVLSLGRNSFSGYVPSSMVNLQQLERLNLGENNLNGSFPVELMALT-SL 454

Query: 353 EILALSNNSLQGHIFSEKFNLTNLMTLQLDGNKFTGEILESLSKCYLLEGLYLSDNHLTG 412
             L LS N   G +     NL+NL  L L GN F+GEI  S+   + L  L LS  +++G
Sbjct: 455 SELDLSGNRFSGAVPVSISNLSNLSFLNLSGNGFSGEIPASVGNLFKLTALDLSKQNMSG 514

Query: 413 EIPRWLGNLSALEDIIMPNNNLEGPIPIEFCQLNSLKILDLSNNSIFRTLPSCFS-PASI 471
           E+P  L  L  ++ I +  NN  G +P  F  L SL+ ++LS+NS    +P  F     +
Sbjct: 515 EVPVELSGLPNVQVIALQGNNFSGVVPEGFSSLVSLRYVNLSSNSFSGEIPQTFGFLRLL 574

Query: 472 EQLHLSKNKIEGRLESIIHDSPHLVTLDLSCNSLHGSIPNQIGRLP 517
             L LS N I G +   I +   L  L+L  N L G IP  + RLP
Sbjct: 575 VSLSLSDNHISGSIPPEIGNCSALEVLELRSNRLMGHIPADLSRLP 620





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9M0G7|PXL2_ARATH Leucine-rich repeat receptor-like protein kinase PXL2 OS=Arabidopsis thaliana GN=PXL2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query517
255581263 912 serine-threonine protein kinase, plant-t 0.895 0.507 0.524 1e-118
359476165 1464 PREDICTED: LRR receptor-like serine/thre 0.965 0.340 0.405 3e-88
224142481 781 predicted protein [Populus trichocarpa] 0.798 0.528 0.460 2e-86
224102049577 predicted protein [Populus trichocarpa] 0.758 0.679 0.466 6e-85
224073436 1014 predicted protein [Populus trichocarpa] 0.874 0.445 0.408 2e-81
224073422 969 predicted protein [Populus trichocarpa] 0.963 0.513 0.405 2e-81
224134891 953 predicted protein [Populus trichocarpa] 0.870 0.472 0.406 7e-80
224120284 929 predicted protein [Populus trichocarpa] 0.938 0.522 0.390 2e-79
359484714 862 PREDICTED: probable LRR receptor-like se 0.887 0.532 0.414 4e-79
224123984 1016 predicted protein [Populus trichocarpa] 0.972 0.495 0.392 9e-79
>gi|255581263|ref|XP_002531443.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223528936|gb|EEF30930.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 248/473 (52%), Positives = 315/473 (66%), Gaps = 10/473 (2%)

Query: 47  ILDQGLRQLVHLQELYIGGYDLRGSLPWCLANMTSLQVLYASSNELTGNIS--PGLCELV 104
           I  Q L    +L+ELY+   +L  S    +  MTSL+VL  S   LTG +    GLCEL+
Sbjct: 168 IQAQDLPNFENLEELYLDKIELENSFLQTVGVMTSLKVLSLSGCGLTGALPNVQGLCELI 227

Query: 105 LMRELHIDNNDLRGSLPLCLANLTSLRVLDVSDNQLTQNISSSPLMHLTSIEELILSNNH 164
            +R L + +N+  G LP CL+NLTSL++LD+S NQ   +IS+SPL  L S+ +L +SNNH
Sbjct: 228 HLRVLDVSSNEFHGILPWCLSNLTSLQLLDLSSNQFVGDISNSPLKILKSLVDLDVSNNH 287

Query: 165 FFQSPISLEPLFNLSKRKTFDSE---ICAETESHYNSLTPKFQLTFISLSGYIDGGTFPK 221
           F Q P SL P FN S  K    +   I  E E H     P+FQL  I  SGY   GTFP 
Sbjct: 288 F-QVPFSLGPFFNHSNLKHIRGQNNAIYLEAELHS---APRFQLISIIFSGYGICGTFPN 343

Query: 222 FLYHQHDLKNADLSHLNLSGKFPNWLVENNANLERLLLADNSLFGSFWMPIHSHQKLATL 281
           FLYHQ++L+  DLSHL+L G+FPNWL+ NN  LE L L +NSL G   +P+H H  L  L
Sbjct: 344 FLYHQNNLQFVDLSHLSLKGEFPNWLLTNNTRLEILDLVNNSLSGHLQLPLHPHVNLLAL 403

Query: 282 DVSNNFFRGHIPVEIGTYLPGLMDLNLSRNAFNGSIPSSFADMKMLERVDISYNQLTGEI 341
           D+SNN    HIP+EIGT+LP L  LN+S N F+GSIPSSF +M  L  +D+S NQL+G I
Sbjct: 404 DISNNHVHDHIPLEIGTFLPKLELLNMSSNGFDGSIPSSFGNMNSLRILDLSNNQLSGSI 463

Query: 342 PERMAARCFSLEILALSNNSLQGHIFSEKFNLTNLMTLQLDGNKFTGEILESLSKCYLLE 401
           PE +A  CFSL  L LSNNSLQG +FS++FNLTNL  L+LD N F+G I +SLSK   L 
Sbjct: 464 PEHLATGCFSLNTLILSNNSLQGQMFSKQFNLTNLWWLELDKNHFSGRIPKSLSKS-ALS 522

Query: 402 GLYLSDNHLTGEIPRWLGNLSALEDIIMPNNNLEGPIPIEFCQLNSLKILDLSNNSIFRT 461
            + LSDNHL+G IP W+GNLS L+++I+ NN L+GPIP+EFCQL+ L++LDL+NNS+   
Sbjct: 523 IMDLSDNHLSGMIPGWIGNLSYLQNLILSNNRLKGPIPVEFCQLHYLEVLDLANNSVSGI 582

Query: 462 LPSCFSPASIEQLHLSKNKIEGRLESIIHDSPHLVTLDLSCNSLHGSIPNQIG 514
           LPSC SP+SI  +HLS+N IEG   +    S  LVTLDLS N + G IP  IG
Sbjct: 583 LPSCLSPSSIIHVHLSQNMIEGPWTNAFSGSHFLVTLDLSSNRITGRIPTLIG 635




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359476165|ref|XP_002283141.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224142481|ref|XP_002324585.1| predicted protein [Populus trichocarpa] gi|222866019|gb|EEF03150.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224102049|ref|XP_002334215.1| predicted protein [Populus trichocarpa] gi|222870030|gb|EEF07161.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073436|ref|XP_002304095.1| predicted protein [Populus trichocarpa] gi|222841527|gb|EEE79074.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073422|ref|XP_002304093.1| predicted protein [Populus trichocarpa] gi|222841525|gb|EEE79072.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224134891|ref|XP_002327515.1| predicted protein [Populus trichocarpa] gi|222836069|gb|EEE74490.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224120284|ref|XP_002331010.1| predicted protein [Populus trichocarpa] gi|222872940|gb|EEF10071.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359484714|ref|XP_002264041.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224123984|ref|XP_002330258.1| predicted protein [Populus trichocarpa] gi|222871714|gb|EEF08845.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query517
TAIR|locus:2019662 965 RLP15 "AT1G74190" [Arabidopsis 0.969 0.519 0.357 9.2e-68
TAIR|locus:2101943 891 RLP45 "AT3G53240" [Arabidopsis 0.955 0.554 0.354 8.9e-67
TAIR|locus:2025012 1083 RLP1 "AT1G07390" [Arabidopsis 0.965 0.460 0.365 1.1e-65
TAIR|locus:2037313 1000 RLP13 "AT1G74170" [Arabidopsis 0.967 0.5 0.362 1.6e-65
TAIR|locus:2037308 976 RLP14 "AT1G74180" [Arabidopsis 0.901 0.477 0.368 1.3e-62
TAIR|locus:2155909 908 RLP56 "AT5G49290" [Arabidopsis 0.959 0.546 0.344 4.3e-57
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.874 0.397 0.344 2.6e-48
TAIR|locus:2040075 935 RLP21 "AT2G25470" [Arabidopsis 0.969 0.535 0.297 7.1e-46
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.893 0.393 0.300 1.2e-44
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.970 0.400 0.282 3.8e-44
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 688 (247.2 bits), Expect = 9.2e-68, P = 9.2e-68
 Identities = 190/531 (35%), Positives = 277/531 (52%)

Query:     2 RKFKNLEHLDMGEVQVDVNTSFLQIVGESKPSLKFLSLINSSKNTILDQGLRQLVHLQEL 61
             RK + LE LD+   + + N+ F  +   +  +  FL   N+   +   + LR L +L+ L
Sbjct:   129 RKLRKLEILDLASNKFN-NSIFHFLSAATSLTTLFLRS-NNMDGSFPAKELRDLTNLELL 186

Query:    62 YIGGYDLRGSLPWC-LANMTSLQVLYASSNELTGN--------------ISPGLCELVLM 106
              +      GS+P   L+++  L+ L  S NE +G+              I  G+CEL  M
Sbjct:   187 DLSRNRFNGSIPIQELSSLRKLKALDLSGNEFSGSMELQGKFCTDLLFSIQSGICELNNM 246

Query:   107 RELHIDNNDLRGSLPLCLANLTSLRVLDVSDNQLTQNISSSPLMHLTSIEELILSNNHFF 166
             +EL +  N L G LP CL +LT LRVLD+S N+LT  + SS L  L S+E L L +N F 
Sbjct:   247 QELDLSQNKLVGHLPSCLTSLTGLRVLDLSSNKLTGTVPSS-LGSLQSLEYLSLFDNDF- 304

Query:   167 QSPISLEPLFNLSKRKTFDSEICAETES----HYNSLTPKFQLTFISLSGYIDGGTFPKF 222
             +   S   L NLS       ++C+++ S      +S  PKFQL+ I+L    +    P F
Sbjct:   305 EGSFSFGSLANLSNLMVL--KLCSKSSSLQVLSESSWKPKFQLSVIALRS-CNMEKVPHF 361

Query:   223 LYHQHDLKNADLSHLNLSGKFPNWLVXXXXXXXXXXXXXXSLFGSFWMPIHSHQKLATLD 282
             L HQ DL++ DLS  N+SGK P+WL+              +LF SF +P  +H  L  LD
Sbjct:   362 LLHQKDLRHVDLSDNNISGKLPSWLLANNTKLKVLLLQN-NLFTSFQIPKSAHN-LLFLD 419

Query:   283 VSNNFFRGHIPVEIGTYLPGLMDLNLSRNAFNGSIPSSFADMKMLERVDISYNQLTGEIP 342
             VS N F    P  IG   P L  LN S+N F  ++PSS  +M  ++ +D+S N   G +P
Sbjct:   420 VSANDFNHLFPENIGWIFPHLRYLNTSKNNFQENLPSSLGNMNGIQYMDLSRNSFHGNLP 479

Query:   343 ERMAARCFSLEILALSNNSLQGHIFSEKFNLTNLMTLQLDGNKFTGEILESLSKCYLLEG 402
                   C+S+ IL LS+N L G IF E  N TN++ L +D N FTG+I + L     LE 
Sbjct:   480 RSFVNGCYSMAILKLSHNKLSGEIFPESTNFTNILGLFMDNNLFTGKIGQGLRSLINLEL 539

Query:   403 LYLSDNHLTGEIPRWLGNLSALEDIIMPNNNLEGPIPIEFCQLNSLKILDLSNNSIFRTL 462
             L +S+N+LTG IP W+G L +L  +++ +N L+G IP+     +SL++LDLS NS+   +
Sbjct:   540 LDMSNNNLTGVIPSWIGELPSLTALLISDNFLKGDIPMSLFNKSSLQLLDLSANSLSGVI 599

Query:   463 PSCFSPASIEQLHLSKNKIEGRLESIIHDSPHLVTLDLSCNSLHGSIPNQI 513
             P      +   L L  NK+ G +   +  +  +  LDL  N   G IP  I
Sbjct:   600 PPQHDSRNGVVLLLQDNKLSGTIPDTLLANVEI--LDLRNNRFSGKIPEFI 648


GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query517
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-46
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-44
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-39
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-31
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-31
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-06
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  173 bits (440), Expect = 2e-46
 Identities = 148/462 (32%), Positives = 222/462 (48%), Gaps = 35/462 (7%)

Query: 54  QLVHLQELYIGGYDLRGSLPWCLANMT-SLQVLYASSNELTGNISPGLCELVLMRELHID 112
           +L ++Q + +    L G +P  +   + SL+ L  S+N  TG+I  G   +  +  L + 
Sbjct: 91  RLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRG--SIPNLETLDLS 148

Query: 113 NNDLRGSLPLCLANLTSLRVLDVSDNQLTQNISSSPLMHLTSIEELILSNNHFF-QSPIS 171
           NN L G +P  + + +SL+VLD+  N L   I +S L +LTS+E L L++N    Q P  
Sbjct: 149 NNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNS-LTNLTSLEFLTLASNQLVGQIPRE 207

Query: 172 LEPLFNLSKRKTFDSEICAETESHYNSLTPKFQLTFISLSGYIDGGTFPKFLYHQHDLKN 231
           L  + +L                          L + +LSG I     P  +     L +
Sbjct: 208 LGQMKSLKW----------------------IYLGYNNLSGEI-----PYEIGGLTSLNH 240

Query: 232 ADLSHLNLSGKFPNWLVENNANLERLLLADNSLFGSFWMPIHSHQKLATLDVSNNFFRGH 291
            DL + NL+G  P+ L  N  NL+ L L  N L G     I S QKL +LD+S+N   G 
Sbjct: 241 LDLVYNNLTGPIPSSL-GNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGE 299

Query: 292 IPVEIGTYLPGLMDLNLSRNAFNGSIPSSFADMKMLERVDISYNQLTGEIPERMAARCFS 351
           IP E+   L  L  L+L  N F G IP +   +  L+ + +  N+ +GEIP+ +     +
Sbjct: 300 IP-ELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHN-N 357

Query: 352 LEILALSNNSLQGHIFSEKFNLTNLMTLQLDGNKFTGEILESLSKCYLLEGLYLSDNHLT 411
           L +L LS N+L G I     +  NL  L L  N   GEI +SL  C  L  + L DN  +
Sbjct: 358 LTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFS 417

Query: 412 GEIPRWLGNLSALEDIIMPNNNLEGPIPIEFCQLNSLKILDLSNNSIFRTLPSCFSPASI 471
           GE+P     L  +  + + NNNL+G I      + SL++L L+ N  F  LP  F    +
Sbjct: 418 GELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRL 477

Query: 472 EQLHLSKNKIEGRLESIIHDSPHLVTLDLSCNSLHGSIPNQI 513
           E L LS+N+  G +   +     L+ L LS N L G IP+++
Sbjct: 478 ENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDEL 519


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 517
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
KOG4237498 consensus Extracellular matrix protein slit, conta 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
KOG4237498 consensus Extracellular matrix protein slit, conta 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.78
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.76
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.67
KOG0617264 consensus Ras suppressor protein (contains leucine 99.55
KOG0617264 consensus Ras suppressor protein (contains leucine 99.51
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.42
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.31
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.27
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.22
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.19
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.19
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.14
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.13
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.12
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.1
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.05
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.0
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.99
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.92
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.89
PLN03150623 hypothetical protein; Provisional 98.88
PLN03150623 hypothetical protein; Provisional 98.86
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.85
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.82
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.79
KOG4341483 consensus F-box protein containing LRR [General fu 98.76
KOG4341483 consensus F-box protein containing LRR [General fu 98.71
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.68
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.59
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.52
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.46
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.41
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.36
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.33
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.3
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.27
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.22
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.13
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.11
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.04
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.03
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.01
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.01
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.0
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.94
PRK15386 426 type III secretion protein GogB; Provisional 97.93
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.88
PRK15386 426 type III secretion protein GogB; Provisional 97.84
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.83
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.71
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.3
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.29
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.15
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.12
KOG4308 478 consensus LRR-containing protein [Function unknown 96.22
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.73
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.19
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.79
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.67
KOG4308478 consensus LRR-containing protein [Function unknown 93.14
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 91.8
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.76
smart0037026 LRR Leucine-rich repeats, outliers. 90.93
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.93
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.56
smart0037026 LRR Leucine-rich repeats, outliers. 89.3
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.3
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=5.4e-53  Score=454.53  Aligned_cols=500  Identities=29%  Similarity=0.408  Sum_probs=386.2

Q ss_pred             CCCCcCceeeCCCccccccccchhhccCCCCcceEEeccccccCCcchhhhhhcccCcEEEecCCcccCCccccccCCCC
Q 042271            2 RKFKNLEHLDMGEVQVDVNTSFLQIVGESKPSLKFLSLINSSKNTILDQGLRQLVHLQELYIGGYDLRGSLPWCLANMTS   81 (517)
Q Consensus         2 ~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~l~~l~~   81 (517)
                      +.+++|++|++++|  .+.+.++...+..+++|++|++++|.+....+  .+.+++|++|++++|.+.+..|..+.++++
T Consensus        90 ~~l~~L~~L~Ls~n--~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p--~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~  165 (968)
T PLN00113         90 FRLPYIQTINLSNN--QLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIP--RGSIPNLETLDLSNNMLSGEIPNDIGSFSS  165 (968)
T ss_pred             hCCCCCCEEECCCC--ccCCcCChHHhccCCCCCEEECcCCccccccC--ccccCCCCEEECcCCcccccCChHHhcCCC
Confidence            45677777777777  55556665545577777777777665543222  244677777777777777677777777888


Q ss_pred             CcEEEccCCccCCCCCcchhccccCcEEEccccccCCcccccccCCCCCcEEeccCCccccccCCCcccCCCCCceeecc
Q 042271           82 LQVLYASSNELTGNISPGLCELVLMRELHIDNNDLRGSLPLCLANLTSLRVLDVSDNQLTQNISSSPLMHLTSIEELILS  161 (517)
Q Consensus        82 L~~L~l~~~~~~~~~~~~l~~l~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~L~~~~~~~~~~~~~l~~l~~L~~L~l~  161 (517)
                      |++|++++|.+.+..|..++++++|++|++++|.+++..|..+.++++|++|++++|.+.+.++. .+..+++|++|+++
T Consensus       166 L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~-~l~~l~~L~~L~L~  244 (968)
T PLN00113        166 LKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPY-EIGGLTSLNHLDLV  244 (968)
T ss_pred             CCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCCh-hHhcCCCCCEEECc
Confidence            88888887777767777777788888888888877777777777788888888888777655554 67777888888887


Q ss_pred             cCCCCCCCCCcccccCcccccccccccccccccccCCCCCcceeeEeeccccccCCCccccccccCCcCEeeccCCcCCC
Q 042271          162 NNHFFQSPISLEPLFNLSKRKTFDSEICAETESHYNSLTPKFQLTFISLSGYIDGGTFPKFLYHQHDLKNADLSHLNLSG  241 (517)
Q Consensus       162 ~~~~~~~~~~~~~l~~l~~L~~l~l~~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~  241 (517)
                      +|.+..  .....+.++++|+.+++............+....+|+.+++++|.+.+.+|.++..+++|+.+++.+|.+.+
T Consensus       245 ~n~l~~--~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~  322 (968)
T PLN00113        245 YNNLTG--PIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTG  322 (968)
T ss_pred             Cceecc--ccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCC
Confidence            776421  112345667777777776654433333334445578888888887777788888888888888888888877


Q ss_pred             CCChhhhhcccccceEeccCCccCCCcccccccCCcccEEEccCCcccccCChhhhhccCCCcEEEccCCcCCCCCchhh
Q 042271          242 KFPNWLVENNANLERLLLADNSLFGSFWMPIHSHQKLATLDVSNNFFRGHIPVEIGTYLPGLMDLNLSRNAFNGSIPSSF  321 (517)
Q Consensus       242 ~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~i~~~~~~~~  321 (517)
                      ..|..+ ..+++|+.|++++|.+.+..+..+..+++|+.|++++|.+.+.+|..+.. +++|+.|++++|.+.+.++..+
T Consensus       323 ~~~~~~-~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~-~~~L~~L~l~~n~l~~~~p~~~  400 (968)
T PLN00113        323 KIPVAL-TSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCS-SGNLFKLILFSNSLEGEIPKSL  400 (968)
T ss_pred             cCChhH-hcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhC-cCCCCEEECcCCEecccCCHHH
Confidence            777664 56788888888888877777777777888888888888887777776665 6788888888888887888888


Q ss_pred             hcCCCCcEEeccccccccccchhHHhhcCCCcEEEccCCcccccccccccCCCCCcEEEccCcccccccchhhhhcccCC
Q 042271          322 ADMKMLERVDISYNQLTGEIPERMAARCFSLEILALSNNSLQGHIFSEKFNLTNLMTLQLDGNKFTGEILESLSKCYLLE  401 (517)
Q Consensus       322 ~~l~~L~~L~l~~~~i~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~  401 (517)
                      ..+++|+.|++++|.+.+..|.. +..+++|+.+++++|.+++..+..+..+++|+.|++++|.+.+..+..+ ..++|+
T Consensus       401 ~~~~~L~~L~L~~n~l~~~~p~~-~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~  478 (968)
T PLN00113        401 GACRSLRRVRLQDNSFSGELPSE-FTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLE  478 (968)
T ss_pred             hCCCCCCEEECcCCEeeeECChh-HhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccce
Confidence            88888888888888888666644 4568888889998888887777777788889999999888876555544 457899


Q ss_pred             eEEecCCCCCCccchhhcCCCCCcEEECCCCcccccccccccCCCCccEEEccCCccccCCCCCCC-cccccEEEccCCc
Q 042271          402 GLYLSDNHLTGEIPRWLGNLSALEDIIMPNNNLEGPIPIEFCQLNSLKILDLSNNSIFRTLPSCFS-PASIEQLHLSKNK  480 (517)
Q Consensus       402 ~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~-~~~L~~L~l~~n~  480 (517)
                      .|++++|++.+..|..+..+++|+.|++++|.+.+..|..+..+++|+.|++++|.+++..+..+. +++|++|++++|.
T Consensus       479 ~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~  558 (968)
T PLN00113        479 NLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQ  558 (968)
T ss_pred             EEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCc
Confidence            999999999888888899999999999999999988898999999999999999999888877766 7899999999999


Q ss_pred             CCccchhhhcCCCcccEEECCCCcCCCCCCcc
Q 042271          481 IEGRLESIIHDSPHLVTLDLSCNSLHGSIPNQ  512 (517)
Q Consensus       481 ~~~~~~~~l~~~~~L~~l~l~~n~~~~~~~~~  512 (517)
                      +++.+|..+..+++|+++++++|++++.+|..
T Consensus       559 l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~  590 (968)
T PLN00113        559 LSGEIPKNLGNVESLVQVNISHNHLHGSLPST  590 (968)
T ss_pred             ccccCChhHhcCcccCEEeccCCcceeeCCCc
Confidence            99888999999999999999999999988853



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query517
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 7e-29
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-06
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 8e-29
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-06
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-12
1ogq_A 313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-04
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 9e-05
4fho_A231 Crystal Structure Of An Internalin C2 (Inlc2) From 4e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 125 bits (313), Expect = 7e-29, Method: Compositional matrix adjust. Identities = 161/576 (27%), Positives = 247/576 (42%), Gaps = 74/576 (12%) Query: 1 FRKFKNLEHLDMGEVQVDVNTSFLQIVGESKPSLKFLSLINSSKNTI-----LDQGLR-- 53 F+ +L LD+ + + L +G S LKFL N S NT+ + GL+ Sbjct: 93 FKCSASLTSLDLSRNSLSGPVTTLTSLG-SCSGLKFL---NVSSNTLDFPGKVSGGLKLN 148 Query: 54 --QLVHLQELYIGGYDLRGSLPWCLANMTS-LQVLYASSNELTGNISPGLCELVLMRELH 110 +++ L I G ++ G W L++ L+ L S N+++G++ C V + L Sbjct: 149 SLEVLDLSANSISGANVVG---WVLSDGCGELKHLAISGNKISGDVDVSRC--VNLEFLD 203 Query: 111 IDNNDLRGSLPLCLANLTSLRVLDVSDNQLTQNISSSPLMHLTSIEELILSNNHFFQSPI 170 + +N+ +P L + ++L+ LD+S N+L+ + S + + T ++ L +S+N F PI Sbjct: 204 VSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRA-ISTCTELKLLNISSNQFV-GPI 260 Query: 171 SLEPLFNLSKRKTFDSEICAETESHYNSLTPKFQLTFISLSGYIDGGTFPKFLYHQHDLK 230 PL +L +++ E + LT + LSG G P F L+ Sbjct: 261 PPLPLKSLQYLSLAENKFTGEIPDFLSGACD--TLTGLDLSGNHFYGAVPPFFGSCSLLE 318 Query: 231 NADLSHLNLSGKFPNWLVXXXXXXXXXXXXXXSLFGSFWMPIHS-HQKLATLDVSNNFFR 289 + LS N SG+ P + G + + L TLD+S+N F Sbjct: 319 SLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFS 378 Query: 290 GHI-PVEIGTYLPGLMDLNLSRNAFNGSIPSSFADMKMLERVDISYNQLTGEIPERMAAR 348 G I P L +L L N F G IP + ++ L + +S+N L+G IP + + Sbjct: 379 GPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 438 Query: 349 CFSLEILALSNNSLQGHIFSEKFNLTNLMTLQLDGNKFTGEILESLSKCYLLEGLYLSDN 408 L L L N L+G I E + L TL LD N TGEI LS C L + LS+N Sbjct: 439 S-KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNN 497 Query: 409 HLTGEIPRWLGNLSALEDIIMPNNNLEGPIPIEFCQLNSLKILDLSNNSIFRTLPSC--- 465 LTGEIP+W+G L L + + NN+ G IP E SL LDL+ N T+P+ Sbjct: 498 RLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFK 557 Query: 466 -----------------------------------FSPASIEQLHLSKNKIEGRLESII- 489 F EQL+ + + S + Sbjct: 558 QSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVY 617 Query: 490 --HDSP------HLVTLDLSCNSLHGSIPNQIGRLP 517 H SP ++ LD+S N L G IP +IG +P Sbjct: 618 GGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMP 653
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|4FHO|A Chain A, Crystal Structure Of An Internalin C2 (Inlc2) From Listeria Monocytogenes Str. 4b F2365 At 1.90 A Resolution Length = 231 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query517
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-93
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-91
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-84
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-79
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-71
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-70
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-50
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-27
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-57
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-56
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-53
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-40
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-32
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-23
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-55
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-49
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-29
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-28
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-54
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-49
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-44
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-30
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-21
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-54
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-51
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-41
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-28
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-27
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-53
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-47
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-44
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-37
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-33
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-23
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-50
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-45
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-23
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-46
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-44
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-44
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-28
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-39
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-37
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-29
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-34
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-18
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-28
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-28
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-24
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-34
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-30
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-24
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-07
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-26
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-24
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-23
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-24
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-22
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-16
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-14
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-22
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-18
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-21
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-12
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-20
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-13
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-16
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-18
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-07
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-07
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-06
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-12
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-12
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-11
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 7e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-08
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 8e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-10
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 3e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-11
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-08
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-11
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-07
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-07
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 9e-07
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 9e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  299 bits (769), Expect = 2e-93
 Identities = 130/477 (27%), Positives = 206/477 (43%), Gaps = 29/477 (6%)

Query: 57  HLQELYIGGYDLR---GSLPWCLANMTSLQVLYASSNELTGNISPGLCELVLMRELHIDN 113
            +  + +    L     ++   L ++T L+ L+ S++ + G++  G      +  L +  
Sbjct: 51  KVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSV-SGFKCSASLTSLDLSR 109

Query: 114 NDLRGSLP--LCLANLTSLRVLDVSDNQLTQNISSSPLMHLTSIEELILSNNHFFQS-PI 170
           N L G +     L + + L+ L+VS N L      S  + L S+E L LS N    +  +
Sbjct: 110 NSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVV 169

Query: 171 SLEPLFNLSKRKTFDSEICAETESHYNSLTPKF------QLTFISLSGYIDGGTFPKFLY 224
                    + K              N ++          L F+ +S        P FL 
Sbjct: 170 GWVLSDGCGELKHLA--------ISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIP-FLG 220

Query: 225 HQHDLKNADLSHLNLSGKFPNWLVENNANLERLLLADNSLFGSFWMPIHSHQKLATLDVS 284
               L++ D+S   LSG F   +      L+ L ++ N   G    P    + L  L ++
Sbjct: 221 DCSALQHLDISGNKLSGDFSRAIS-TCTELKLLNISSNQFVGPI--PPLPLKSLQYLSLA 277

Query: 285 NNFFRGHIPVEIGTYLPGLMDLNLSRNAFNGSIPSSFADMKMLERVDISYNQLTGEIPER 344
            N F G IP  +      L  L+LS N F G++P  F    +LE + +S N  +GE+P  
Sbjct: 278 ENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMD 337

Query: 345 MAARCFSLEILALSNNSLQGHIFSEKFNLT-NLMTLQLDGNKFTGEILESLSKCYL--LE 401
              +   L++L LS N   G +     NL+ +L+TL L  N F+G IL +L +     L+
Sbjct: 338 TLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQ 397

Query: 402 GLYLSDNHLTGEIPRWLGNLSALEDIIMPNNNLEGPIPIEFCQLNSLKILDLSNNSIFRT 461
            LYL +N  TG+IP  L N S L  + +  N L G IP     L+ L+ L L  N +   
Sbjct: 398 ELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGE 457

Query: 462 LPSCFS-PASIEQLHLSKNKIEGRLESIIHDSPHLVTLDLSCNSLHGSIPNQIGRLP 517
           +P       ++E L L  N + G + S + +  +L  + LS N L G IP  IGRL 
Sbjct: 458 IPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLE 514


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query517
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.98
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.95
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.78
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.74
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.73
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.72
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.72
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.7
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.69
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.69
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.66
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.61
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.61
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.6
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.6
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.57
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.56
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.56
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.54
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.54
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.46
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.46
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.43
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.43
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.41
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.4
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.36
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.35
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.34
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.26
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.14
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.01
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.94
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.71
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.55
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.46
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.44
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.37
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.33
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.79
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.42
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.32
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.22
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 81.06
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=5e-57  Score=472.74  Aligned_cols=501  Identities=29%  Similarity=0.377  Sum_probs=269.8

Q ss_pred             CCCCCcCceeeCCCccccccccchh--hccCCCCcceEEeccccccCC-cchhhhhhcccCcEEEecCCcccCCcccc--
Q 042271            1 FRKFKNLEHLDMGEVQVDVNTSFLQ--IVGESKPSLKFLSLINSSKNT-ILDQGLRQLVHLQELYIGGYDLRGSLPWC--   75 (517)
Q Consensus         1 ~~~l~~L~~L~l~~~~~~~~~~~~~--~~~~~~~~L~~L~l~~~~~~~-~~~~~l~~l~~L~~L~l~~~~~~~~~~~~--   75 (517)
                      |+++++||+|++++|  .+.+.++.  . ++++++|++|++++|.+.. ++...+.++++|++|++++|.+.+..+..  
T Consensus        96 ~~~l~~L~~L~Ls~n--~l~~~~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~  172 (768)
T 3rgz_A           96 FKCSASLTSLDLSRN--SLSGPVTTLTS-LGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWV  172 (768)
T ss_dssp             CCCCTTCCEEECCSS--EEEEEGGGGGG-GGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHH
T ss_pred             hccCCCCCEEECCCC--cCCCcCCChHH-HhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhh
Confidence            456777888888877  55555554  3 6777777777777555432 22212245556666666665555444433  


Q ss_pred             -cc----------------------CCCCCcEEEccCCccCCCCCcchhccccCcEEEccccccCCcccccccCCCCCcE
Q 042271           76 -LA----------------------NMTSLQVLYASSNELTGNISPGLCELVLMRELHIDNNDLRGSLPLCLANLTSLRV  132 (517)
Q Consensus        76 -l~----------------------~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~L~~~~~~~~~~~~~~~l~~L~~  132 (517)
                       +.                      .+++|++|++++|.+.+..|. ++.+++|++|++++|.+++..|.++..+++|++
T Consensus       173 ~~~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~  251 (768)
T 3rgz_A          173 LSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKL  251 (768)
T ss_dssp             HTTCCTTCCEEECCSSEEESCCBCTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCE
T ss_pred             hhccCCCCCEEECCCCcccccCCcccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHHhcCCCCCE
Confidence             33                      445555555555555544443 555555555555555555555555555555555


Q ss_pred             EeccCCccccccCCCcccCCCCCceeecccCCCCCCCCCcccccCcccccccccccccccccccCCCCCcceeeEeeccc
Q 042271          133 LDVSDNQLTQNISSSPLMHLTSIEELILSNNHFFQSPISLEPLFNLSKRKTFDSEICAETESHYNSLTPKFQLTFISLSG  212 (517)
Q Consensus       133 L~L~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~l~~l~~L~~l~l~~~~~~~~~~~~~~~~~~L~~l~l~~  212 (517)
                      |++++|.+.+.++.  . .+++|++|++++|.+. +.........++.|+.+++............+....+|+++++.+
T Consensus       252 L~Ls~n~l~~~~~~--~-~l~~L~~L~L~~n~l~-~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~  327 (768)
T 3rgz_A          252 LNISSNQFVGPIPP--L-PLKSLQYLSLAENKFT-GEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSS  327 (768)
T ss_dssp             EECCSSCCEESCCC--C-CCTTCCEEECCSSEEE-ESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCS
T ss_pred             EECCCCcccCccCc--c-ccCCCCEEECcCCccC-CccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCC
Confidence            55555555433332  1 3444444444444421 011101111123344444433222222122222223344444444


Q ss_pred             cccCCCcccc-ccccCCcCEeeccCCcCCCCCChhhhhc--------------------------ccccceEeccCCccC
Q 042271          213 YIDGGTFPKF-LYHQHDLKNADLSHLNLSGKFPNWLVEN--------------------------NANLERLLLADNSLF  265 (517)
Q Consensus       213 ~~~~~~~~~~-~~~~~~L~~l~l~~~~~~~~~~~~~~~~--------------------------~~~L~~L~l~~~~~~  265 (517)
                      |.+.+.+|.. +..+++|+.|++++|.+.+.+|..+...                          +++|++|++++|.+.
T Consensus       328 n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~  407 (768)
T 3rgz_A          328 NNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT  407 (768)
T ss_dssp             SEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEE
T ss_pred             CcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccc
Confidence            4333333322 3333344444444443333333332111                          234444444444444


Q ss_pred             CCcccccccCCcccEEEccCCcccccCChhhhhccCCCcEEEccCCcCCCCCchhhhcCCCCcEEeccccccccccchhH
Q 042271          266 GSFWMPIHSHQKLATLDVSNNFFRGHIPVEIGTYLPGLMDLNLSRNAFNGSIPSSFADMKMLERVDISYNQLTGEIPERM  345 (517)
Q Consensus       266 ~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~i~~~~~~~~~~l~~L~~L~l~~~~i~~~~~~~~  345 (517)
                      +..+..+..+++|+.|++++|.+++.+|..+.. +++|+.|++++|.+.+.++..+..+++|++|++++|.+.+.+|.. 
T Consensus       408 ~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~-l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~-  485 (768)
T 3rgz_A          408 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGS-LSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSG-  485 (768)
T ss_dssp             EECCGGGGGCTTCCEEECCSSEEESCCCGGGGG-CTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGG-
T ss_pred             cccCHHHhcCCCCCEEECcCCcccCcccHHHhc-CCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHH-
Confidence            444445555566666666666655555555444 556666666666666556666666666666666666665444433 


Q ss_pred             HhhcCCCcEEEccCCcccccccccccCCCCCcEEEccCcccccccchhhhhcccCCeEEecCCCCCCccchh--------
Q 042271          346 AARCFSLEILALSNNSLQGHIFSEKFNLTNLMTLQLDGNKFTGEILESLSKCYLLEGLYLSDNHLTGEIPRW--------  417 (517)
Q Consensus       346 ~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~--------  417 (517)
                      +..+++|+.|++++|.+++..+..+..+++|++|++++|.+.+..+..+..+++|+.|++++|++.+.+|..        
T Consensus       486 l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~  565 (768)
T 3rgz_A          486 LSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKI  565 (768)
T ss_dssp             GGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCB
T ss_pred             HhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchh
Confidence            334666666666666666555666666666666666666666566666666666666666666655443332        


Q ss_pred             --------------------------------------------------------------hcCCCCCcEEECCCCccc
Q 042271          418 --------------------------------------------------------------LGNLSALEDIIMPNNNLE  435 (517)
Q Consensus       418 --------------------------------------------------------------~~~~~~L~~L~l~~~~~~  435 (517)
                                                                                    +..+++|+.|++++|++.
T Consensus       566 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~  645 (768)
T 3rgz_A          566 AANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLS  645 (768)
T ss_dssp             CCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCB
T ss_pred             hhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCccc
Confidence                                                                          222355666666666666


Q ss_pred             ccccccccCCCCccEEEccCCccccCCCCCCC-cccccEEEccCCcCCccchhhhcCCCcccEEECCCCcCCCCCCc
Q 042271          436 GPIPIEFCQLNSLKILDLSNNSIFRTLPSCFS-PASIEQLHLSKNKIEGRLESIIHDSPHLVTLDLSCNSLHGSIPN  511 (517)
Q Consensus       436 ~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~-~~~L~~L~l~~n~~~~~~~~~l~~~~~L~~l~l~~n~~~~~~~~  511 (517)
                      +.+|..+..+++|+.|++++|++++..|..+. +++|++|++++|++++.+|..|..+++|++|++++|+++|.+|.
T Consensus       646 g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~  722 (768)
T 3rgz_A          646 GYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPE  722 (768)
T ss_dssp             SCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCS
T ss_pred             ccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCC
Confidence            66666666666777777777766666665554 66677777777777666666667677777777777777666665



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 517
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-19
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-10
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 8e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 87.7 bits (216), Expect = 2e-19
 Identities = 69/390 (17%), Positives = 142/390 (36%), Gaps = 35/390 (8%)

Query: 77  ANMTSLQVLYASSNELTGNISPGLCELVLMRELHIDNNDLRGSLPLCLANLTSLRVLDVS 136
             +            +T  +S    +L  +  L  D   ++ S+   +  L +L  ++ S
Sbjct: 19  TALAEKMKTVLGKTNVTDTVS--QTDLDQVTTLQADRLGIK-SID-GVEYLNNLTQINFS 74

Query: 137 DNQLTQNISSSPLMHLTSIEELILSNNHFFQSP----------ISLEPLFNLSKRKTFDS 186
           +NQLT     +PL +LT + +++++NN                ++L            + 
Sbjct: 75  NNQLT---DITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNL 131

Query: 187 EICAETESHYNSLTPKFQLTFISLSGYIDGGTFPKFLYHQHDLKNADLSHLNLSGKFPNW 246
                 E   N+++    L+ ++    +  G     L    +L   +   ++ +      
Sbjct: 132 TNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDIS 191

Query: 247 LVENNANLERLLLADNSLFGSFWMPIHSHQKLATLDVSNNFFRGHIPVEIGTYLPGLMDL 306
           ++    NLE L+  +N +      P+     L  L ++ N  +    +     L  L DL
Sbjct: 192 VLAKLTNLESLIATNNQISDIT--PLGILTNLDELSLNGNQLKD---IGTLASLTNLTDL 246

Query: 307 NLSRNAFNGSIPSSFADMKMLERVDISYNQLTGEIPERMAARCFSLEILALSNNSLQGHI 366
           +L+ N  +   P   + +  L  + +  NQ++   P           +  L  N  Q   
Sbjct: 247 DLANNQISNLAP--LSGLTKLTELKLGANQISNISPL-----AGLTALTNLELNENQLED 299

Query: 367 FSEKFNLTNLMTLQLDGNKFTGEILESLSKCYLLEGLYLSDNHLTGEIPRWLGNLSALED 426
            S   NL NL  L L  N  +   +  +S    L+ L+ ++N ++      L NL+ +  
Sbjct: 300 ISPISNLKNLTYLTLYFNNISD--ISPVSSLTKLQRLFFANNKVSD--VSSLANLTNINW 355

Query: 427 IIMPNNNLEGPIPIEFCQLNSLKILDLSNN 456
           +   +N +    P     L  +  L L++ 
Sbjct: 356 LSAGHNQISDLTP--LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query517
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.83
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.79
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.76
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.75
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.71
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.63
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.62
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.54
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.53
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.52
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.5
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.5
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.37
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.29
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.28
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.28
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.48
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.19
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.15
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.05
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.75
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.51
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.95  E-value=1e-25  Score=215.14  Aligned_cols=189  Identities=23%  Similarity=0.258  Sum_probs=120.8

Q ss_pred             cCCCcEEEccCCcCCCCCchhhhcCCCCcEEeccccccccccchhHHhhcCCCcEEEccCCcccccccccccCCCCCcEE
Q 042271          300 LPGLMDLNLSRNAFNGSIPSSFADMKMLERVDISYNQLTGEIPERMAARCFSLEILALSNNSLQGHIFSEKFNLTNLMTL  379 (517)
Q Consensus       300 ~~~L~~L~l~~~~i~~~~~~~~~~l~~L~~L~l~~~~i~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~L~~L  379 (517)
                      +++++.+++++|.+++..  .+..+++|+++++++|.+. .++  .+..+++|+.+++++|.+++..  .+..+++|++|
T Consensus       196 l~~~~~l~l~~n~i~~~~--~~~~~~~L~~L~l~~n~l~-~~~--~l~~l~~L~~L~l~~n~l~~~~--~~~~~~~L~~L  268 (384)
T d2omza2         196 LTNLESLIATNNQISDIT--PLGILTNLDELSLNGNQLK-DIG--TLASLTNLTDLDLANNQISNLA--PLSGLTKLTEL  268 (384)
T ss_dssp             CTTCSEEECCSSCCCCCG--GGGGCTTCCEEECCSSCCC-CCG--GGGGCTTCSEEECCSSCCCCCG--GGTTCTTCSEE
T ss_pred             ccccceeeccCCccCCCC--cccccCCCCEEECCCCCCC-Ccc--hhhcccccchhccccCccCCCC--cccccccCCEe
Confidence            455555555555555332  2344555666666666555 222  2334556666666666655432  35566677777


Q ss_pred             EccCcccccccchhhhhcccCCeEEecCCCCCCccchhhcCCCCCcEEECCCCcccccccccccCCCCccEEEccCCccc
Q 042271          380 QLDGNKFTGEILESLSKCYLLEGLYLSDNHLTGEIPRWLGNLSALEDIIMPNNNLEGPIPIEFCQLNSLKILDLSNNSIF  459 (517)
Q Consensus       380 ~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~n~l~  459 (517)
                      +++++.+...  ..+..++.++.+.+.+|.+.+  ...+..+++++.|++++|++.+..  .+..+++|++|++++|+++
T Consensus       269 ~l~~~~l~~~--~~~~~~~~l~~l~~~~n~l~~--~~~~~~~~~l~~L~ls~n~l~~l~--~l~~l~~L~~L~L~~n~l~  342 (384)
T d2omza2         269 KLGANQISNI--SPLAGLTALTNLELNENQLED--ISPISNLKNLTYLTLYFNNISDIS--PVSSLTKLQRLFFANNKVS  342 (384)
T ss_dssp             ECCSSCCCCC--GGGTTCTTCSEEECCSSCCSC--CGGGGGCTTCSEEECCSSCCSCCG--GGGGCTTCCEEECCSSCCC
T ss_pred             eccCcccCCC--Ccccccccccccccccccccc--ccccchhcccCeEECCCCCCCCCc--ccccCCCCCEEECCCCCCC
Confidence            7777766532  235667777777777777763  234677777778888877777543  3667788888888888876


Q ss_pred             cCCCCCCCcccccEEEccCCcCCccchhhhcCCCcccEEECCCCc
Q 042271          460 RTLPSCFSPASIEQLHLSKNKIEGRLESIIHDSPHLVTLDLSCNS  504 (517)
Q Consensus       460 ~~~~~~~~~~~L~~L~l~~n~~~~~~~~~l~~~~~L~~l~l~~n~  504 (517)
                      +. +....+++|++|++++|++++..|  +.++++|++|+|++|.
T Consensus       343 ~l-~~l~~l~~L~~L~l~~N~l~~l~~--l~~l~~L~~L~L~~Na  384 (384)
T d2omza2         343 DV-SSLANLTNINWLSAGHNQISDLTP--LANLTRITQLGLNDQA  384 (384)
T ss_dssp             CC-GGGGGCTTCCEEECCSSCCCBCGG--GTTCTTCSEEECCCEE
T ss_pred             CC-hhHcCCCCCCEEECCCCcCCCChh--hccCCCCCEeeCCCCc
Confidence            53 233337888888888888887654  7888888888888873



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure