Citrus Sinensis ID: 042296

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------

MSIIGEAVLSASIELLVNKLASEGLRFFARQEQILADLMKWKKMLMKINVVLDDADERQRTDKSVKLWLGELQNLAYDVEDLLDEFETEALGRKLLLGDGESDAANDDQPSSSTGTSIFRKLIPTCCTTFTPRSIKFDYTIMSKIKEINARFQDIVSQKDLLDFKENSVGRSRKVRQRRETTSLVNEAKVYGMGGLGKTTLAQLVYNDARLQDHFDLKAWTCVSEDFDITRITKSILNSIGTDQNVDSLDFDKLQVELKKQLSQKKFLLVLDDVWNENYNDWIDLSRPFEAGAPGSKIVVTTRNQAVVAIMGTVPAYPLKELSDEDCLNVFTQHSLGTRDFNMHKSLEEIGKKIVIKCNGLPLAAKTLGGLLRGKTDQRDWEDVLNCKIWDLPEERCDILPALKVSYYYLSPRLKQCFTYCSLLPKDYEFKEEEIILLWIAVGFLDQEDNGRESEDLGHMFFKELHSRSLFQKSSNDTLRFVMHDLVNDLAQWAAGNIYLRMEDAPGGNKQQRFSKSLRHLSYIPGGHDGVKRFADFDDTEHLRTFLPVMLSNCWGGYLAYSILQRLLKLHRLKVFSLCGYQISELPNSVGDLRYLRYLNLSRTCIEILPDSINKLYNLHTLLLEDCDRLKKLCADMGNLIKLHHLNNSTTNSLEEMPRGIGKLTFLQTLCNFAVGKDSGSGLQDLKLLMYLRGTLKISKLENVKHVGDAKEAQLDKKKNLKVLLLQWTCNTDTDGSRDLGTETRVLDMLRPHQNLEQFFISGYGGTKFPIWLGDSYFSNLVTLKFQNCHKCTSLPSIGKLLSLKHLEVCRMNRVKSLGSQFYGNGCPSPFPCLETLRFEDMQEWEDWIPHGFDQEAEVFPNLRELHLLRCSKLQGTFPERLPSLEILVIQSCEELLVSIRRLPALCKFEISGCKKVVWRSPTDLGSQNLVVCRDISEQVFLQGPLKLQLPKLEELEIANIDELTYIWQNETRLLQDISSLKRLKIKSCPNLQSLVEEDEQNQLGLSCRIEYLELINCQGLVKLPQTSLSLINSLKEIGIYNCSSLVCFPEAALPSQLRIISIQYCNALKSLPVTWMHDTNTSLETLKVYGCNLLTYITSVQLPASLKHVEIEDCSNLRTLREEGEIHNGSRRDTSLLEHLRIVNCQSLITLFSKNELPDSLEHLEVGICSKLKFLSCSGNLPQALKFICVFRCSKLESIAERLDNNTSLEVFKIGCCDNLKILPGGLHKLRHLQEVGIWSCGNLVSFPEGGLPSANLTKLQITWCDKLEALPEGMNSLRELNIGGLASMVCFPVEADGAMFPSNLQSLDIHDTKIWKSLMEWGEGGLNRFSSLQRLSIGGLHDVVSFSPQELGTTLPASLTHLWIYDFQNLECLSSVGQNLTSLVYLWLYACPKLKYFSDKGLPTSLLQLYIKDCPLIEEKCRKDQGQYWHLLTHIPDVRLNRLL

cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHcHHHHHHccccEEEEEEcccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccEEEEEEcccccccHHcHHHHHccccccccccEEEEEcccHHHHHcccccccEEcccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHccccccccccccccHHHHcccccccccccccccccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccEEEccccccEEEccHHHHHHHHHHHccEEEEEcccccccccccccccEEEEEEccccccccccccccccccccEEEccccccccccccHHHHHHHHcccccccEEEcccccccccccccccccccccccccccccccccHHHHHcccHHHccccccccccccHHHccccccccEEEcccccccccccccccccccccccccEEEcccccccccccccccccccEEEEccccccccccccccccccccccccEEEEEEccccccccccccHHHHHHHcccccccccccEEEEcccccccccccccccccccEEEEEEcccccccccccccccccccEEcccccccEEccccccccccccccccccEEEEcccccccccccccccccccccccccEEEEccccccccccccccccccEEEEcccccccccccccccccEEEEccccccccccccccccccEEEEcccccHHHcccccccccccccEEEEccccccccccccccccccccccccEEEEEccccccccccccccccccccccccEEEEEEcccccccccccccccccccEEEEcccccccccccccccccccEEEEccccccccccccccccccccccEEEEEccccccccccccccccccEEEEcccccccccccccccccccccccccccEEEEccccccccccccccccccccEEEEEcccccEEcccccccccccEEEEEEEcccccccHHcccccccccEEEEccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccEEEEcccccccccccccccccccccccEEEEEccccccHHHccccccccccccccEEEEEccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEEccHHHHHHHcccccccccccccccEEEEcccc

ccHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHcHHHHHHcccccccccccccccccccccccEccccHHHHHHHHHHHccccccccEEEEEEEccccccHHHHHHHHHccHHHHHHccEEEEEEEcccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHccccccEEEEEEccHHHHHHHccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHcHHHccccccccccHHHEEcHccccHHHHHHHHEHHcccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccccccccEEHHHHHHHHHHHHcccEEEEEcccccccccccccccEEEEEEEccccccccccccHHHHHHHcEEccccccccccccccccHHHHHHHccEEEEEEEcccccccccccccccHHEEEEEccccccccccccccccHHHHEEEHcccHHHHHccHcccccccccEEEccccccHccccccccccHcccEccEEEEcccccccHHHHHHHHHcccEEEEEcccccccHHHHHHHccccccccEEEEEEEccccccccccccccHHHHHHHcccccccEEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEccccccEEccHHHccccccccccccEEEEEcccHHHHHcccccccHHccccccccEEEEcccccHccccHHHccHHHHEEEcccHHHcccccccccHHEEEEccccccEcccccccccccEEEEcccccccccccccccccccccEEEEccccccccccccccccccccccccEEEEccccccccccHHHccccccccccccEEEEccccccccccccHccccccccEEEEcccccccccccccccccccEEEEccccccccccHHcccccccccEEEEEcccccccccccccccccccEEEEcccccHccccHHcccccccccccccccEEEEcccccHHcccccccccccccEEEEccccccccccccccccccccEEEEccccccccccccccccccccEEEEccccccccccccccccccccEEEEccccccccccccccccccccEEEEcccHHHcccccccccccEEEEcccccccccccccccccccccccEEEEcccHHHHccHHHHHccccccccccEEEEcccccccccccccccccccccccEEEEcccccHHHccccccccccccEEEEcccccccccccccccccccEEEEcccHHHHHHHHcccccccccEccccEEEEEEcc

MSIIGEAVLSASIELLVNKLASEGLRFFARQEQILADLMKWKKMLMKINVVLddaderqrtDKSVKLWLGELQNLAYDVEDLLDEFETEALGRKLllgdgesdaanddqpssstgtsifrkliptccttftprsikfDYTIMSKIKEINARFQDIVSqkdlldfkensvgrsrkvrqRRETTSLVNEakvygmgglgkTTLAQLVYNDarlqdhfdlkawtcvsedfdiTRITKSILNsigtdqnvdsldFDKLQVELKKQLSQKKFLLVLDDVWNenyndwidlsrpfeagapgskivVTTRNQAVVAIMgtvpayplkelsdedclnvftqhslgtrdfnMHKSLEEIGKKIVIKCNGLPLAAKTLggllrgktdqrdwedvlnckiwdlpeercdilPALKVSYYYLSPRLKQCFTYcsllpkdyefkEEEIILLWIAVGfldqedngresedLGHMFFKELHSRSLFQKSSNDTLRFVMHDLVNDLAQWAAGNIYlrmedapggnkqqrFSKSLrhlsyipgghdgvkrfadfddtehLRTFLPVmlsncwggYLAYSILQRLLKLHRLKVFSLCGyqiselpnsvgdlrylrYLNLSRTCIEILPDSINKLYNLHTLLLEDCDRLKKLCADMGnliklhhlnnsttnsleemprgigkLTFLQTLCNfavgkdsgsglqDLKLLMYLRGTlkisklenvkhvgdakeaqldkKKNLKVLLLQWTCntdtdgsrdlgteTRVLDMLRPHQNLEQFFIsgyggtkfpiwlgdsyfsnlvtlkfqnchkctslpsigkllslkHLEVCRMNRvkslgsqfygngcpspfpcletlrfedmqewedwiphgfdqeaevfpnlrELHLLRCSKLqgtfperlpsLEILVIQSCEELLVSIRRLPALCkfeisgckkvvwrsptdlgsqnlvvcrdiseqvflqgplklqlpkleeleIANIDELTYIWQNETRLLQDISSLkrlkikscpnlqslveedeqnqlgLSCRIEYLELIncqglvklpqtsLSLINSLKeigiyncsslvcfpeaalpsqLRIISIQYCNALkslpvtwmhdtntslETLKVYGCNLLTYITsvqlpaslkhveiedcsnlrtlreegeihngsrrdtslLEHLRIVNCQSLITLfsknelpdsleHLEVGIcsklkflscsgnlpqALKFICVFRCSKLESIAErldnntslevfkigccdnlkilpgglhKLRHLqevgiwscgnlvsfpegglpsanltkLQITWCDKLEALPEGMNSLRELnigglasmvcfpveadgamfpsnlqsldihdTKIWKSLMEWGegglnrfsslqrlsigglhdvvsfspqelgttlpaslTHLWIYDFQNLECLSSVGQNLTSLVYLWLYacpklkyfsdkglptSLLQLYIKDCPLIEEKCRKDQGQYWHLlthipdvrlnrll

MSIIGEAVLSASIELLVNKLASEGLRFFARQEQILADLMKWKKMLMKINVVLDDADERQRTDKSVKLWLGELQNLAYDVEDLLDEFETEALGRKLLLGDgesdaanddqpssstgtsifrkliptccttftprsiKFDYTIMSKIKEINARFQDIvsqkdlldfkensvgrsrkvrqrrettslvneakvygmgglGKTTLAQLVYNDARLQDHFDLKAWTCVSEDFDITRITKSILNsigtdqnvdSLDFDKLQVELKKQLSQKKFLLVLDDVWNENYNDWIDLSRPFEAGAPGSKIVVTTRNQAVVAIMGTVPAYPLKELSDEDCLNVFTQHSLGTRDFNMHKSLEEIGKKIVIKCNGLPLAAKTLggllrgktdqrdwEDVLNckiwdlpeercDILPALKVSYYYLSPRLKQCFTYCSLLPKDYEFKEEEIILLWIAVGFLDQEDNGRESEDLGHMFFKELHSRSLFQKSSNDTLRFVMHDLVNDLAQWAAGNIYLRMEDAPGGNKQQRFSKSLRHLSYIPGGHDGVKRFADFDDTEHLRTFLPVMLSNCWGGYLAYSILQRLLKLHRLKVFSLCGYqiselpnsvgdLRYLRYLNLSRTCIEILPDSINKLYNLHTLLLEDCDRLKKLCADMGNLIKLHHLNNSTTNSLEEMPRGIGKLTFLQTLCNFAVgkdsgsglqDLKLLMYLRGTLkisklenvkhvgdakeaqldkkknlKVLLLQWtcntdtdgsrdLGTETRVLDMLRPHQNLEQFFISGYGGTKFPIWLGDSYFSNLVTLKFQNCHKCTSLPSIGKLLSLKHLEVCRMNRVKSLGSQFYGNGCPSPFPCLETLRFEDMQEWEDWIPHGFDQEAEVFPNLRELHLLRCSKLQGTFPERLPSLEILVIQSCEELLVSIRRLPALCKFEIsgckkvvwrsptdlGSQNLVVCRDISEQVFLQGPLKLQLPKLEELEIANIDELTYIWQNETRLLQDISSLKRLKIKSCPNLQSLVEEDEQNQLGLSCRIEYLELINCQGLVKLPQTSLSLINSLKEIGIYNCSSLVCFPEAALPSQLRIISIQYCNALKSLPVTWMHDTNTSLETLKVYGCNLLTYITSVQLPASLKHVEIEDCSNlrtlreegeihngsrrdtslleHLRIVNCQSLITLFSKNELPDSLEHLEVGICSKLKFLSCSGNLPQALKFICVFRCSKLESIAERLDNNTSLEVFKIGCCDNLKILPGGLHKLRHLQEVGIWSCGNLVSFPEGGLPSANLTKLQITWCDKLEALPEGMNSLRELNIGGLASMVCFPVEADGAMFPSNLQSLDIHDTKIWKSLMEWGEGGLNRFSSLQRLSIGGLHDVVSFSPQELGTTLPASLTHLWIYDFQNLECLSSVGQNLTSLVYLWLYACPKLKYFSDKGLPTSLLQLYIKDCPLIEEKCRKDQGQYwhllthipdvrlnrll

MSIIGEAVLSASIELLVNKLASEGLRFFARQEQILADLMKWKKMLMKINVVLDDADERQRTDKSVKLWLGELQNLAYDVEDLLDEFETEALGRKLLLGDGESDAANDDQPSSSTGTSIFRKLIPTCCTTFTPRSIKFDYTIMSKIKEINARFQDIVSQKDLLDFKENSVGRSRKVRQRRETTSLVNEAKVYGMGGLGKTTLAQLVYNDARLQDHFDLKAWTCVSEDFDITRITKSILNSIGTDQNVDSLDFDKLQVElkkqlsqkkfllvlDDVWNENYNDWIDLSRPFEAGAPGSKIVVTTRNQAVVAIMGTVPAYPLKELSDEDCLNVFTQHSLGTRDFNMHKSLEEIGKKIVIKCNGLPLAAKTLGGLLRGKTDQRDWEDVLNCKIWDLPEERCDILPALKVSYYYLSPRLKQCFTYCSLLPKDYEFKEEEIILLWIAVGFLDQEDNGRESEDLGHMFFKELHSRSLFQKSSNDTLRFVMHDLVNDLAQWAAGNIYLRMEDAPGGNKQQRFSKSLRHLSYIPGGHDGVKRFADFDDTEHLRTFLPVMLSNCWGGYLAYSILQRLLKLHRLKVFSLCGYQISELPNSVGDLRYLRYLNLSRTCIEILPDSINKLYNLHTLLLEDCDRLKKLCADMGNLIKLHHLNNSTTNSLEEMPRGIGKLTFLQTLCNFAVGKDSGSGLQDLKLLMYLRGTLKISKLENVKHVGDAKEAQldkkknlkvlllQWTCNTDTDGSRDLGTETRVLDMLRPHQNLEQFFISGYGGTKFPIWLGDSYFSNLVTLKFQNCHKCTSLPSIGKLLSLKHLEVCRMNRVKSLGSQFYGNGCPSPFPCLETLRFEDMQEWEDWIPHGFDQEAEVFPNLRELHLLRCSKLQGTFPERLPSLEILVIQSCEELLVSIRRLPALCKFEISGCKKVVWRSPTDLGSQNLVVCRDISEQVFlqgplklqlpkleelEIANIDELTYIWQNETRLLQDISSLKRLKIKSCPNLQSLVEEDEQNQLGLSCRIEYLELINCQGLVKLPQTSLSLINSLKEIGIYNCSSLVCFPEAALPSQLRIISIQYCNALKSLPVTWMHDTNTSLETLKVYGCNLLTYITSVQLPASLKHVEIEDCSNLRTLREEGEIHNGSRRDTSLLEHLRIVNCQSLITLFSKNELPDSLEHLEVGICSKLKFLSCSGNLPQALKFICVFRCSKLESIAERLDNNTSLEVFKIGCCDNLKILPGGLHKLRHLQEVGIWSCGNLVSFPEGGLPSANLTKLQITWCDKLEALPEGMNSLRELNIGGLASMVCFPVEADGAMFPSNLQSLDIHDTKIWKSLMEWGEGGLNRFSSLQRLSIGGLHDVVSFSPQELGTTLPASLTHLWIYDFQNLECLSSVGQNLTSLVYLWLYACPKLKYFSDKGLPTSLLQLYIKDCPLIEEKCRKDQGQYWHLLTHIPDVRLNRLL

***IGEAVLSASIELLVNKLASEGLRFFARQEQILADLMKWKKMLMKINVVLDDADERQRTDKSVKLWLGELQNLAYDVEDLLDEFETEALGRKLLL*******************SIFRKLIPTCCTTFTPRSIKFDYTIMSKIKEINARFQDIVSQKDLLDF*******************LVNEAKVYGMGGLGKTTLAQLVYNDARLQDHFDLKAWTCVSEDFDITRITKSILNSIGTDQNVDSLDFDKLQVELKKQLSQKKFLLVLDDVWNENYNDWIDLSRPFEAGAPGSKIVVTTRNQAVVAIMGTVPAYPLKELSDEDCLNVFTQHSLGTRDFNMHKSLEEIGKKIVIKCNGLPLAAKTLGGLLRGKTDQRDWEDVLNCKIWDLPEERCDILPALKVSYYYLSPRLKQCFTYCSLLPKDYEFKEEEIILLWIAVGFLDQ*********LGHMFFKELHSRSLFQKSSNDTLRFVMHDLVNDLAQWAAGNIYLRME**************LRHLSYIPGGHDGVKRFADFDDTEHLRTFLPVMLSNCWGGYLAYSILQRLLKLHRLKVFSLCGYQISELPNSVGDLRYLRYLNLSRTCIEILPDSINKLYNLHTLLLEDCDRLKKLCADMGNLIKLHHLNNSTTNSLEEMPRGIGKLTFLQTLCNFAVGKDSGSGLQDLKLLMYLRGTLKISKLENVKHVGDAKEAQLDKKKNLKVLLLQWTCNTDTDGSRDLGTETRVLDMLRPHQNLEQFFISGYGGTKFPIWLGDSYFSNLVTLKFQNCHKCTSLPSIGKLLSLKHLEVCRMNRVKSLGSQFYGNGCPSPFPCLETLRFEDMQEWEDWIPHGFDQEAEVFPNLRELHLLRCSKLQGTFPERLPSLEILVIQSCEELLVSIRRLPALCKFEISGCKKVVWRSPTDLGSQNLVVCRDISEQVFLQGPLKLQLPKLEELEIANIDELTYIWQNETRLLQDISSLKRLKIKSCPNLQSLVEEDEQNQLGLSCRIEYLELINCQGLVKLPQTSLSLINSLKEIGIYNCSSLVCFPEAALPSQLRIISIQYCNALKSLPVTWMHDTNTSLETLKVYGCNLLTYITSVQLPASLKHVEIEDCSNLRTLR***********DTSLLEHLRIVNCQSLITLFSKNELPDSLEHLEVGICSKLKFLSCSGNLPQALKFICVFRCSKLESIAERLDNNTSLEVFKIGCCDNLKILPGGLHKLRHLQEVGIWSCGNLVSFPEGGLPSANLTKLQITWCDKLEALPEGMNSLRELNIGGLASMVCFPVEADGAMFPSNLQSLDIHDTKIWKSLMEWGEGGLNRFSSLQRLSIGGLHDVVSFSPQELGTTLPASLTHLWIYDFQNLECLSSVGQNLTSLVYLWLYACPKLKYFSDKGLPTSLLQLYIKDCPLIEEKCRKDQGQYWHLLTHIPDVRL****

MSIIGEAVLSASIELLVNKLASEGLRFFARQEQILADLMKWKKMLMKINVVLDDADERQRTDKSVKLWLGELQNLAYDVEDLLDEFETEALGRK***********************IFRKLIPTCCTTFTPRSIKF*********EINARFQDIVSQKDLL***********************NEAKVYGMGGLGKTTLAQLVYNDARLQDHFDLKAWTCVSEDFDITRITKSILNSIGT*****SLDF*KLQVELKKQLSQKKFLLVLDDVWNENYNDWIDLSRPFEAGAPGSKIVVTTRNQAVVAIMGTVPAYPLKELSDEDCLNVFTQHSLGTR**NMHKSLEEIGKKIVIKCNGLPLAAKTLGGLLRGKTDQRDWEDVLNCKIWDLPEERCDILPALKVSYYYLSPRLKQCFTYCSLLPKDYEFKEEEIILLWIAVGFLDQEDN**ESEDLGHMFFKELHSRSLFQKSSNDTLRFVMHDLVNDLAQWAAGNIYLRMEDAPG**KQQRFSKSLRHLSYIPGGHDGVKRFADFDDTEHLRTFLPVMLSNCWGGYLAYSILQRLLKLHRLKVFSLCGYQISELPNSVGDLRYLRYLNLSRTCIEILPDSINKLYNLHTLLLEDCDRLKKLCADMGNLIKLHHLNNSTTNSLEEMPRGIGKLTFLQTLCNFAVGKDSGSGLQDLKLLMYLRGTLKISKLENVKHVGDAKEAQLDKKKNLKVLLLQWTCNTDT********ETRVLDMLRPHQNLEQFFISGYGGTKFPIWLGDSYFSNLVTLKFQNCHKCTSLPSIGKLLSLKHLEVCRMNRVKSLGSQFYGNGCPSPFPCLETLRFEDMQEWEDWIPHGFDQEAEVFPNLRELHLLRCSKLQGTFPERLPSLEILVIQSCEELLVSIRRLPALCKFEISGCKKVVWRSPTDLGSQNLVVCRDISEQVFLQGPLKLQLPKLEELEIANIDELTYIWQNETRLLQDISSLKRLKIKSCPNLQSLVEEDEQNQLGLSCRIEYLELINCQGLVKLPQTSLSLINSLKEIGIYNCSSLVCFPEAALPSQLRIISIQYCNALKSLPVTWMHDTNTSLETLKVYGCNLLTYITSVQLPASLKHVEIEDCSNLRTLREEGE**NGSRRDTSLLEHLRIVNCQSLITLFSK*ELPDSLEHLEVGICSKLKFLSCSGNLPQALKFICVFRCSKLESIAERLDNNTSLEVFKIGCCDNLKILPGGLHKLRHLQEVGIWSCGNLVSFPEGGLPSANLTKLQITWCDKLEALPEGMNSLRELNIGGLASMVCFPVEADGAMFPSNLQSLDIHDTKIWKSLMEWGEGGLNRFSSLQRLSIGGLHDVVSFSPQELGTTLPASLTHLWIYDFQNLECLSSVGQNLTSLVYLWLYACPKLKYFSDKGLPTSLLQLYIKDCPLIEEKCRKDQGQYWHLLTHIPDVRLNRLL

MSIIGEAVLSASIELLVNKLASEGLRFFARQEQILADLMKWKKMLMKINVVLDDADERQRTDKSVKLWLGELQNLAYDVEDLLDEFETEALGRKLLLGDGE**************TSIFRKLIPTCCTTFTPRSIKFDYTIMSKIKEINARFQDIVSQKDLLDFKENSV************TSLVNEAKVYGMGGLGKTTLAQLVYNDARLQDHFDLKAWTCVSEDFDITRITKSILNSIGTDQNVDSLDFDKLQVELKKQLSQKKFLLVLDDVWNENYNDWIDLSRPFEAGAPGSKIVVTTRNQAVVAIMGTVPAYPLKELSDEDCLNVFTQHSLGTRDFNMHKSLEEIGKKIVIKCNGLPLAAKTLGGLLRGKTDQRDWEDVLNCKIWDLPEERCDILPALKVSYYYLSPRLKQCFTYCSLLPKDYEFKEEEIILLWIAVGFLDQEDNGRESEDLGHMFFKELHSRSLFQKSSNDTLRFVMHDLVNDLAQWAAGNIYLRMEDAPGGNKQQRFSKSLRHLSYIPGGHDGVKRFADFDDTEHLRTFLPVMLSNCWGGYLAYSILQRLLKLHRLKVFSLCGYQISELPNSVGDLRYLRYLNLSRTCIEILPDSINKLYNLHTLLLEDCDRLKKLCADMGNLIKLHHLNNSTTNSLEEMPRGIGKLTFLQTLCNFAVGKDSGSGLQDLKLLMYLRGTLKISKLENVKHVGDAKEAQLDKKKNLKVLLLQWTCNTDTDGSRDLGTETRVLDMLRPHQNLEQFFISGYGGTKFPIWLGDSYFSNLVTLKFQNCHKCTSLPSIGKLLSLKHLEVCRMNRVKSLGSQFYGNGCPSPFPCLETLRFEDMQEWEDWIPHGFDQEAEVFPNLRELHLLRCSKLQGTFPERLPSLEILVIQSCEELLVSIRRLPALCKFEISGCKKVVWRSPTDLGSQNLVVCRDISEQVFLQGPLKLQLPKLEELEIANIDELTYIWQNETRLLQDISSLKRLKIKSCPNLQSLVEEDEQNQLGLSCRIEYLELINCQGLVKLPQTSLSLINSLKEIGIYNCSSLVCFPEAALPSQLRIISIQYCNALKSLPVTWMHDTNTSLETLKVYGCNLLTYITSVQLPASLKHVEIEDCSNLRTLREEGEIHNGSRRDTSLLEHLRIVNCQSLITLFSKNELPDSLEHLEVGICSKLKFLSCSGNLPQALKFICVFRCSKLESIAERLDNNTSLEVFKIGCCDNLKILPGGLHKLRHLQEVGIWSCGNLVSFPEGGLPSANLTKLQITWCDKLEALPEGMNSLRELNIGGLASMVCFPVEADGAMFPSNLQSLDIHDTKIWKSLMEWGEGGLNRFSSLQRLSIGGLHDVVSFSPQELGTTLPASLTHLWIYDFQNLECLSSVGQNLTSLVYLWLYACPKLKYFSDKGLPTSLLQLYIKDCPLIEEKCRKDQGQYWHLLTHIPDVRLNRLL

MSIIGEAVLSASIELLVNKLASEGLRFFARQEQILADLMKWKKMLMKINVVLDDADERQRTDKSVKLWLGELQNLAYDVEDLLDEFETEALGRKLLLG*************SSTGTSIFRKLIPTCCTTFTPRSIKFD*****************VS*KDLLDFKENSVGRSRKVRQRRETTSLVNEAKVYGMGGLGKTTLAQLVYNDARLQDHFDLKAWTCVSEDFDITRITKSILNSIGTDQNVDSLDFDKLQVELKKQLSQKKFLLVLDDVWNENYNDWIDLSRPFEAGAPGSKIVVTTRNQAVVAIMGTVPAYPLKELSDEDCLNVFTQHSLGTRDFNMHKSLEEIGKKIVIKCNGLPLAAKTLGGLLRGKTDQRDWEDVLNCKIWDLPEERCDILPALKVSYYYLSPRLKQCFTYCSLLPKDYEFKEEEIILLWIAVGFLDQEDNGRESEDLGHMFFKELHSRSLFQKSSNDTLRFVMHDLVNDLAQWAAGNIYLRMEDAPGGNKQQRFSKSLRHLSYIPGGHDGVKRFADFDDTEHLRTFLPVMLSNCWGGYLAYSILQRLLKLHRLKVFSLCGYQISELPNSVGDLRYLRYLNLSRTCIEILPDSINKLYNLHTLLLEDCDRLKKLCADMGNLIKLHHLNNSTTNSLEEMPRGIGKLTFLQTLCNFAVGKDSGSGLQDLKLLMYLRGTLKISKLENVKHVGDAKEAQLDKKKNLKVLLLQWTCNTDTDGSRDLGTETRVLDMLRPHQNLEQFFISGYGGTKFPIWLGDSYFSNLVTLKFQNCHKCTSLPSIGKLLSLKHLEVCRMNRVKSLGSQFYGNGCPSPFPCLETLRFEDMQEWEDWIPHGFDQEAEVFPNLRELHLLRCSKLQGTFPERLPSLEILVIQSCEELLVSIRRLPALCKFEISGCKKVVWRSPTDLGSQNLVVCRDISEQVFLQGPLKLQLPKLEELEIANIDELTYIWQNETRLLQDISSLKRLKIKSCPNLQSLVEEDEQNQLGLSCRIEYLELINCQGLVKLPQTSLSLINSLKEIGIYNCSSLVCFPEAALPSQLRIISIQYCNALKSLPVTWMHDTNTSLETLKVYGCNLLTYITSVQLPASLKHVEIEDCSNLRTLREEGEIHNGSRRDTSLLEHLRIVNCQSLITLFSKNELPDSLEHLEVGICSKLKFLSCSGNLPQALKFICVFRCSKLESIAERLDNNTSLEVFKIGCCDNLKILPGGLHKLRHLQEVGIWSCGNLVSFPEGGLPSANLTKLQITWCDKLEALPEGMNSLRELNIGGLASMVCFPVEADGAMFPSNLQSLDIHDTKIWKSLMEWGEGGLNRFSSLQRLSIGGLHDVVSFSPQELGTTLPASLTHLWIYDFQNLECLSSVGQNLTSLVYLWLYACPKLKYFSDKGLPTSLLQLYIKDCPLIEEKCRKDQGQYWHLLTHIPDVRLNRLL

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		1446	2.2.26 [Sep-21-2011]
Q9LRR4		1054	Putative disease resistan	yes	no	0.652	0.895	0.365	1e-168
Q9LRR5		1424	Putative disease resistan	no	no	0.891	0.905	0.309	1e-151
Q7XA40		992	Putative disease resistan	N/A	no	0.630	0.919	0.325	1e-126
Q7XA42		979	Putative disease resistan	N/A	no	0.619	0.915	0.313	1e-126
Q7XBQ9		970	Disease resistance protei	N/A	no	0.624	0.930	0.321	1e-124
Q7XA39		988	Putative disease resistan	N/A	no	0.630	0.923	0.307	1e-118
Q38834		852	Disease resistance RPP13-	no	no	0.502	0.853	0.270	2e-50
P0DI18		1049	Probable disease resistan	no	no	0.600	0.828	0.260	5e-49
P0DI17		1049	Probable disease resistan	no	no	0.600	0.828	0.260	5e-49
Q8W3K3		910	Putative disease resistan	no	no	0.547	0.869	0.267	3e-48

>sp\|Q9LRR4\|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1	Back alignment and function desciption

 Score =  595 bits (1533), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 381/1041 (36%), Positives = 581/1041 (55%), Gaps = 97/1041 (9%)

Query: 1   MSIIGEAVLSASIELLVNKLASEGLR-FFARQEQILADLMKWKKMLMKINVVLDDADERQ 59
           M+ IGE  L+A ++ L   L SE  R FF R+E     L +    L+ I  VL DA+E+Q
Sbjct: 1   MTGIGEMFLAAFLQALFQTLVSEPFRSFFKRRELNENLLERLSTALLTITAVLIDAEEKQ 60

Query: 60  RTDKSVKLWLGELQNLAYDVEDLLDEFETEALGRKLLLGDGESDAANDDQPSSSTGTSIF 119
            T+  V+ W+ EL+++ Y  ED LD+  TEAL  +L +G   S +    Q         F
Sbjct: 61  ITNPVVEKWVNELRDVVYHAEDALDDIATEAL--RLNIGAESSSSNRLRQLRGRMSLGDF 118

Query: 120 RKLIPTCCTTFTPRSIKFDYTIMSKIKEINARFQDIVSQKDLLDFKENSVGRSRKVRQRR 179
                                + ++++++  R + + SQ+++L  KE +   +   +QR 
Sbjct: 119 LD--------------GNSEHLETRLEKVTIRLERLASQRNILGLKELT---AMIPKQRL 161

Query: 180 ETTSLVNEAKVYG-----------------------------MGGLGKTTLAQLVYNDAR 210
            TTSLV+E++V+G                             +GG+GKTTL+QL+YND  
Sbjct: 162 PTTSLVDESEVFGRDDDKDEIMRFLIPENGKDNGITVVAIVGIGGVGKTTLSQLLYNDQH 221

Query: 211 LQDHFDLKAWTCVSEDFDITRITKSILNSIGTDQNVDSLDFDKLQVELKKQLSQK--KFL 268
           ++ +F  K W  VSE+FD+ +ITK +  S+ T +  +  D D LQV+LK++L+     FL
Sbjct: 222 VRSYFGTKVWAHVSEEFDVFKITKKVYESV-TSRPCEFTDLDVLQVKLKERLTGTGLPFL 280

Query: 269 LVLDDVWNENYNDWIDLSRPFEAGAPGSKIVVTTRNQAVVAIMGTVPAYPLKELSDEDCL 328
           LVLDD+WNEN+ DW  L +PF   A GS+I+VTTR+Q V +IM  V  + L+ LSD DC 
Sbjct: 281 LVLDDLWNENFADWDLLRQPFIHAAQGSQILVTTRSQRVASIMCAVHVHNLQPLSDGDCW 340

Query: 329 NVFTQHSLGTRDFNMHKSLEEIGKKIVIKCNGLPLAAKTLGGLLRGKTDQRDWEDVLNCK 388
           ++F +   G ++  +++ + ++ ++IV KC GLPLA KTLGG+LR +    +WE VL+ +
Sbjct: 341 SLFMKTVFGNQEPCLNREIGDLAERIVHKCRGLPLAVKTLGGVLRFEGKVIEWERVLSSR 400

Query: 389 IWDLPEERCDILPALKVSYYYLSPRLKQCFTYCSLLPKDYEFKEEEIILLWIAVGFLDQE 448
           IWDLP ++ ++LP L+VSYYYL   LK+CF YCS+ PK + F++++++LLW+A GFL Q 
Sbjct: 401 IWDLPADKSNLLPVLRVSYYYLPAHLKRCFAYCSIFPKGHAFEKDKVVLLWMAEGFLQQT 460

Query: 449 DNGRESEDLGHMFFKELHSRSLFQKSSNDTLRFVMHDLVNDLAQWAAGNIYLRMEDAPGG 508
            + +  E+LG+ +F EL SRSL QK+     R++MHD +N+LAQ+A+G    + ED   G
Sbjct: 461 RSSKNLEELGNEYFSELESRSLLQKTKT---RYIMHDFINELAQFASGEFSSKFED---G 514

Query: 509 NKQQRFSKSLRHLSYIPGGHDGVKRFADFDDTEHLRTFLPVMLSNCWGG-YLAYSILQRL 567
            K Q  S+  R+LSY+   +     F    + + LRTFLP+ L+N      L   + ++L
Sbjct: 515 CKLQ-VSERTRYLSYLRDNYAEPMEFEALREVKFLRTFLPLSLTNSSRSCCLDQMVSEKL 573

Query: 568 L-KLHRLKVFSLCGYQISEL-PNSVGDLRYLRYLNLSRTCIEILPDSINKLYNLHTLLLE 625
           L  L RL+V SL  Y+I+ L P+   ++ + R+L+LSRT +E LP S+  +YNL TLLL 
Sbjct: 574 LPTLTRLRVLSLSHYKIARLPPDFFKNISHARFLDLSRTELEKLPKSLCYMYNLQTLLLS 633

Query: 626 DCDRLKKLCADMGNLIKLHHLNNSTTNSLEEMPRGIGKLTFLQTLCNFAVGKDSGSGLQD 685
            C  LK+L  D+ NLI L +L+   T  L +MPR  G+L  LQTL  F V    GS + +
Sbjct: 634 YCSSLKELPTDISNLINLRYLDLIGTK-LRQMPRRFGRLKSLQTLTTFFVSASDGSRISE 692

Query: 686 LKLLMYLRGTLKISKLENVKHVGDAKEAQLDKKKNLKVLLLQW-----TCNTDTDGSRDL 740
           L  L  L G LKI +L+ V  V DA EA L+ KK+L+ +   W     +   +T+  R  
Sbjct: 693 LGGLHDLHGKLKIVELQRVVDVADAAEANLNSKKHLREIDFVWRTGSSSSENNTNPHRT- 751

Query: 741 GTETRVLDMLRPHQNLEQFFISGYGGTKFPIWLGDSYFSNLVTLKFQNCHKCTSLPSIGK 800
             E  V + LRPH+++E+  I  Y G +FP WL D  FS +V ++ + C  CTSLPS+G+
Sbjct: 752 QNEAEVFEKLRPHRHIEKLAIERYKGRRFPDWLSDPSFSRIVCIRLRECQYCTSLPSLGQ 811

Query: 801 LLSLKHLEVCRMNRVKSLGSQFYGN------GCPSPFPCLETLRFEDMQEWEDWIPHGFD 854
           L  LK L +  M  ++S+G +FY +          PF  LETLRF+++ +W++W+     
Sbjct: 812 LPCLKELHISGMVGLQSIGRKFYFSDQQLRDQDQQPFRSLETLRFDNLPDWQEWLDVRVT 871

Query: 855 QEAEVFPNLRELHLLRCSKLQGTFPERLPSLEILVIQSCEELLVSIRRLPALCKFEISGC 914
           +  ++FP+L++L +LRC +L GT P  LPSL  L I  C  L       P   ++     
Sbjct: 872 R-GDLFPSLKKLFILRCPELTGTLPTFLPSLISLHIYKCGLLDFQ----PDHHEYSYRNL 926

Query: 915 KKVVWRSPTDLGSQNLVVCRDISEQVFLQGPLKLQLPKLEELEIANIDELTYIWQNETRL 974
           + +  +S  D                 ++ PL      L++LE+     L Y  +     
Sbjct: 927 QTLSIKSSCD---------------TLVKFPLN-HFANLDKLEVDQCTSL-YSLELSNEH 969

Query: 975 LQDISSLKRLKIKSCPNLQSL 995
           L+  ++L+ L+I  C NLQ L
Sbjct: 970 LRGPNALRNLRINDCQNLQLL 990

Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q9LRR5\|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1	Back alignment and function description

>sp\|Q7XA40\|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2	Back alignment and function description

>sp\|Q7XA42\|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2	Back alignment and function description

>sp\|Q7XBQ9\|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1	Back alignment and function description

>sp\|Q7XA39\|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1	Back alignment and function description

>sp\|Q38834\|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2	Back alignment and function description

>sp\|P0DI18\|DRL45_ARATH Probable disease resistance protein RDL6 OS=Arabidopsis thaliana GN=RDL6 PE=2 SV=1	Back alignment and function description

>sp\|P0DI17\|DRL11_ARATH Probable disease resistance protein RF9 OS=Arabidopsis thaliana GN=RF9 PE=2 SV=1	Back alignment and function description

>sp\|Q8W3K3\|DRL8_ARATH Putative disease resistance protein At1g58400 OS=Arabidopsis thaliana GN=At1g58400 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1446
359495024		1390	PREDICTED: putative disease resistance p	0.930	0.968	0.432	0.0
359495026		2204	PREDICTED: uncharacterized protein LOC10	0.919	0.602	0.431	0.0
147860511		1406	hypothetical protein VITISV_014536 [Viti	0.899	0.925	0.434	0.0
225449649		1418	PREDICTED: putative disease resistance p	0.947	0.966	0.429	0.0
284026888		1424	CC-NBS-LRR protein [Quercus suber]	0.937	0.951	0.405	0.0
225465831		1483	PREDICTED: putative disease resistance R	0.914	0.892	0.405	0.0
356554923		1399	PREDICTED: putative disease resistance R	0.916	0.947	0.393	0.0
359487225		1373	PREDICTED: putative disease resistance R	0.913	0.962	0.397	0.0
400131587		1388	FB_MR5 [Malus x robusta]	0.915	0.953	0.410	0.0
359487190		1426	PREDICTED: putative disease resistance p	0.929	0.942	0.391	0.0

>gi\|359495024\|ref\|XP_002267933.2\| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera]	Back alignment and taxonomy information

 Score = 1044 bits (2700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 631/1460 (43%), Positives = 884/1460 (60%), Gaps = 114/1460 (7%)

Query: 1    MSIIGEAVLSASIELLVNKLASEGLRFFARQEQILADLMKWKKMLMKINVVLDDADERQR 60
            M+ +GEA LSASI+ LV+ LA   LR FAR+EQ+ A+L KW+ +L+KI+ VL DA+E+Q 
Sbjct: 1    MAFVGEAFLSASIQKLVDMLACPDLRKFAREEQVHAELKKWEGILLKIHAVLHDAEEKQM 60

Query: 61   TDKSVKLWLGELQNLAYDVEDLLDEFETEALGRKLLLGDGESDAANDDQPSSSTGTSIFR 120
            T++ V++WL EL++LAYDVED+LD+F TEAL R L+         +D QPS+ST  S+  
Sbjct: 61   TNRFVQIWLAELRDLAYDVEDILDDFATEALRRNLI--------KDDPQPSTSTVRSLIS 112

Query: 121  KLIPTCCTTFTPRSIKFDYTIMSKIKEINARFQDIVSQKDLLDFKENSVGRSRKVRQR-R 179
             L     + F P ++ ++  + SKI+EI AR  +I +QK  LD +EN  GRS + R+R  
Sbjct: 113  SLS----SRFNPNALVYNLNMGSKIEEITARLHEISTQKGDLDLRENVEGRSHRKRKRVP 168

Query: 180  ETTSLVNEAKVYG------------------------------MGGLGKTTLAQLVYNDA 209
            ET SLV E++VYG                              MGG+GKTTLAQL YND 
Sbjct: 169  ETASLVVESRVYGRETDKEAILEVLLRDELIHDNEVCVIPIVGMGGVGKTTLAQLAYNDD 228

Query: 210  RLQDHFDLKAWTCVSEDFDITRITKSILNSIGTDQNVDSLDFDKLQVELKKQLSQKKFLL 269
            R+++HFDL+AW CVS+DFD+ RITK++L SI +    +  D + LQV++K++LS KKFLL
Sbjct: 229  RVKNHFDLRAWVCVSDDFDVLRITKTLLQSIAS-YTREINDLNLLQVKMKEKLSGKKFLL 287

Query: 270  VLDDVWNENYNDWIDLSRPFEAGAPGSKIVVTTRNQAVVAIMGTVPAYPLKELSDEDCLN 329
            VLDDVWNENY+ W  L  P  AG PGSK+++TTRN  V  +  TV  Y L+ELS++DC  
Sbjct: 288  VLDDVWNENYDKWDSLCTPLRAGGPGSKVIITTRNMGVATLTRTVSPYLLQELSNDDCRA 347

Query: 330  VFTQHSLGTRDFNMHKSLEEIGKKIVIKCNGLPLAAKTLGGLLRGKTDQRDWEDVLNCKI 389
            VF QH+LG R+F  H  L+ IG+++V +C GLPL AK LGG+LR + +   W+D+L  KI
Sbjct: 348  VFAQHALGARNFEAHPHLKIIGEEMVNRCRGLPLVAKALGGILRNELNHEAWDDILKSKI 407

Query: 390  WDLPEERCDILPALKVSYYYLSPRLKQCFTYCSLLPKDYEFKEEEIILLWIAVGFLDQED 449
            WDLPEE+  +LPALK+SY++L   LKQCF YC++ PK YEFK++E+ILLW+  GFL Q  
Sbjct: 408  WDLPEEKSGVLPALKLSYHHLPSHLKQCFAYCAIFPKGYEFKKDELILLWMGEGFLQQTK 467

Query: 450  NGRESEDLGHMFFKELHSRSLFQKSSNDTLRFVMHDLVNDLAQWAAGNIYLRMEDAPGGN 509
              +  EDLG  +F EL SRS FQ+SSN   RF+MHDL++DLAQ  AGN+ L +ED    N
Sbjct: 468  GKKRMEDLGSKYFSELLSRSFFQQSSNIMPRFMMHDLIHDLAQSIAGNVCLNLEDKLENN 527

Query: 510  KQQRFSKSLRHLSYIPGGHDGVKRFADFDDTEHLRTFLPVMLSNCWGGYLAYSILQR--- 566
             +  F K+ RHLS+I   ++  K+F   D  ++LRTFL + +S  +   L++   +    
Sbjct: 528  -ENIFQKA-RHLSFIRQANEIFKKFEVVDKGKYLRTFLALPISVSFMKSLSFITTKVTHD 585

Query: 567  -LLKLHRLKVFSLCGYQISELPNSVGDLRYLRYLNLSRTCIEILPDSINKLYNLHTLLLE 625
             L+++  L+V SL GY++S+LP+S+ +L +LRYLNL R+ I+ LP+S+  LYNL TL+L 
Sbjct: 586  LLMEMKCLRVLSLSGYKMSDLPSSIDNLSHLRYLNLCRSSIKRLPNSVGHLYNLQTLILR 645

Query: 626  DCDRLKKLCADMGNLIKLHHLNNSTTNSLEEMPRGIGKLTFLQTLCNFAVGKDSGSGLQD 685
            DC  L ++   MGNLI L HL+ + T+ LEEMP  +G LT LQTL  F VGK +GS +Q+
Sbjct: 646  DCWSLTEMPVGMGNLINLRHLDIAGTSQLEEMPPRMGSLTNLQTLSKFIVGKGNGSSIQE 705

Query: 686  LKLLMYLRGTLKISKLENVKHVGDAKEAQLDKKKNLKVLLLQWTCNTDTDGSRDLGTETR 745
            LK L+ L+G L I  L NV++  DA +A L  K +++ L + W+   D D SR+   E  
Sbjct: 706  LKHLLDLQGELSIQGLHNVRNTRDAMDACLKNKCHIEELTMGWS--GDFDDSRNELNEML 763

Query: 746  VLDMLRPHQNLEQFFISGYGGTKFPIWLGDSYFSNLVTLKFQNCHKCTSLPSIGKLLSLK 805
            VL++L+P +NL++  +  YGG KFP W+G+  FS + +L  +NC KCTSLP +G+L  LK
Sbjct: 764  VLELLQPQRNLKKLTVEFYGGPKFPSWIGNPSFSKMESLTLKNCGKCTSLPCLGRLSLLK 823

Query: 806  HLEVCRMNRVKSLGSQFYGN-GCPSPFPCLETLRFEDMQEWEDWIPHGFDQEAE-VFPNL 863
             L +  M +VK++G +F+G      PFPCLE+LRFEDM EWEDW      +E E +F  L
Sbjct: 824  ALRIQGMCKVKTIGDEFFGEVSLFQPFPCLESLRFEDMPEWEDWCFSDMVEECEGLFSCL 883

Query: 864  RELHLLRCSKLQGTFPERLPSLEILVIQSCEELLVSIRRLPALCKFEISGCKKVVWRSPT 923
            REL +  C KL G+ P  LPSL  L I  C +L  ++ RL  +C   +  C +VV R+  
Sbjct: 884  RELRIRECPKLTGSLPNCLPSLAELEIFECPKLKAALPRLAYVCSLNVVECNEVVLRNGV 943

Query: 924  DLGSQNLVVCRDISEQVFLQGPLKLQLPKLEELEIANIDELTYIWQNETRLLQDISSLKR 983
            DL S   +  + IS    L+      L  L++L I    E+T +W+N    L+ +  L+ 
Sbjct: 944  DLSSLTTLNIQRISRLTCLREGFTQLLAALQKLVIRGCGEMTSLWENRFG-LECLRGLES 1002

Query: 984  LKIKSCPNLQSLVEEDEQNQLGLSCRIEYLELINCQGLVKLPQTSLSLINSLKEIGIYNC 1043
            + I  C  L SL E+       L C +++L++ NC  L +LP   L  +  L+E+ + +C
Sbjct: 1003 IDIWQCHGLVSLEEQR------LPCNLKHLKIENCANLQRLP-NGLQRLTCLEELSLQSC 1055

Query: 1044 SSLVCFPEAALPSQLRIISIQYCNALKSLPVTWMHDTNTS-LETLKVYGCNLLTYITSVQ 1102
              L  FPE  LP  LR + +Q CN LK LP    H+ N+  LE L++  C  L      +
Sbjct: 1056 PKLESFPEMGLPPMLRSLVLQKCNTLKLLP----HNYNSGFLEYLEIEHCPCLISFPEGE 1111

Query: 1103 LPASLKHVEIEDCSNLRTLREEGEIHNGSRRDTSLLEHLRIVNCQSLITLFSKNELPDSL 1162
            LPASLK ++I+DC+NL+TL E    HN                     ++ S N     L
Sbjct: 1112 LPASLKQLKIKDCANLQTLPEGMTHHN---------------------SMVSNNSC--CL 1148

Query: 1163 EHLEVGICSKLKFLSCSGNLPQALKFICVFRCSKLESIAER-LDNNTSLEVFKIGCCDNL 1221
            E LE+  CS L  L  +G LP  LK + ++ C + + I+E+ L +NT+LE   I    N+
Sbjct: 1149 EVLEIRKCSSLPSLP-TGELPSTLKRLEIWDCRQFQPISEKMLHSNTALEHLSISNYPNM 1207

Query: 1222 KILPGGLHKLRHLQEVGIWSCGNLVSFPEGGLPSANLTKLQITWCDKLEALPEGMN---S 1278
            KILPG LH L +L    I+ C  LVSFPE GLP+ NL  L I  C+ L++LP  M    S
Sbjct: 1208 KILPGFLHSLTYLY---IYGCQGLVSFPERGLPTPNLRDLYINNCENLKSLPHQMQNLLS 1264

Query: 1279 LRELNIGGLASMVCFPVEADGAMFPSNLQSLDIHDTKIWK-SLMEWGEGGLNRFSSLQRL 1337
            L+ELNI     +  FP   +  + P NL SL I D    K  L EW   GL+R +SL  L
Sbjct: 1265 LQELNIRNCQGLESFP---ECGLAP-NLTSLSIRDCVNLKVPLSEW---GLHRLTSLSSL 1317

Query: 1338 SIGGL-HDVVSFSPQELGTTLPASLTHLWIYDFQNLECLSSVGQNLTSLVYLWLYACPKL 1396
             I G+   + S S  E    LP +L+ L+I    +L CL+   +NL+SL  + +Y CPKL
Sbjct: 1318 YISGVCPSLASLSDDE--CLLPTTLSKLFISKLDSLVCLAL--KNLSSLERISIYRCPKL 1373

Query: 1397 KYFSDKGLPTSLLQLYIKDC 1416
            +     GLP +L +L I+DC
Sbjct: 1374 RSI---GLPETLSRLEIRDC 1390

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|359495026\|ref\|XP_003634900.1\| PREDICTED: uncharacterized protein LOC100854556 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147860511\|emb\|CAN79726.1\| hypothetical protein VITISV_014536 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225449649\|ref\|XP_002262753.1\| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|284026888\|gb\|ADB66335.1\| CC-NBS-LRR protein [Quercus suber]	Back alignment and taxonomy information

>gi\|225465831\|ref\|XP_002264750.1\| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356554923\|ref\|XP_003545790.1\| PREDICTED: putative disease resistance RPP13-like protein 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|359487225\|ref\|XP_002268551.2\| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|400131587\|emb\|CCH50986.1\| FB_MR5 [Malus x robusta]	Back alignment and taxonomy information

>gi\|359487190\|ref\|XP_003633530.1\| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1446
TAIR\|locus:2091672		1054	AT3G14470 [Arabidopsis thalian	0.607	0.833	0.369	8.8e-158
TAIR\|locus:2091662		1424	AT3G14460 [Arabidopsis thalian	0.607	0.617	0.340	1.7e-150
UNIPROTKB\|O48647		1802	O48647 "XA1" [Oryza sativa (ta	0.348	0.279	0.306	6.9e-73
TAIR\|locus:504956483		847	AT3G46730 [Arabidopsis thalian	0.405	0.693	0.284	2.4e-47
TAIR\|locus:2011982		857	AT1G50180 [Arabidopsis thalian	0.403	0.680	0.280	9.4e-44
TAIR\|locus:2075170		835	RPP13 "RECOGNITION OF PERONOSP	0.336	0.583	0.283	1.5e-43
TAIR\|locus:2078012		852	ZAR1 "HOPZ-ACTIVATED RESISTANC	0.493	0.838	0.269	1.8e-43
TAIR\|locus:2025916		906	AT1G59780 "AT1G59780" [Arabido	0.456	0.728	0.251	8e-42
TAIR\|locus:504956184		1017	AT1G58807 "AT1G58807" [Arabido	0.320	0.456	0.279	4.1e-41
TAIR\|locus:2827038		1017	AT1G59124 "AT1G59124" [Arabido	0.320	0.456	0.279	4.1e-41

TAIR\|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1439 (511.6 bits), Expect = 8.8e-158, Sum P(2) = 8.8e-158
 Identities = 341/923 (36%), Positives = 526/923 (56%)

Query:     1 MSIIGEAVLSASIELLVNKLASEGLRFFARQEQILADLM-KWKKMLMKINVVLDDADERQ 59
             M+ IGE  L+A ++ L   L SE  R F ++ ++  +L+ +    L+ I  VL DA+E+Q
Sbjct:     1 MTGIGEMFLAAFLQALFQTLVSEPFRSFFKRRELNENLLERLSTALLTITAVLIDAEEKQ 60

Query:    60 RTDKSVKLWLGELQNLAYDVEDLLDEFETEALGRKLLLGDGESDAAN---DDQPSSSTGT 116
              T+  V+ W+ EL+++ Y  ED LD+  TEAL  +L +G  ES ++N     +   S G 
Sbjct:    61 ITNPVVEKWVNELRDVVYHAEDALDDIATEAL--RLNIG-AESSSSNRLRQLRGRMSLGD 117

Query:   117 SIF--RKLIPTCCTTFTPR--SIKFDYTIMSKIKEINARFQ-------DIVSQKDLLDFK 165
              +    + + T     T R   +     I+  +KE+ A           +V + ++    
Sbjct:   118 FLDGNSEHLETRLEKVTIRLERLASQRNILG-LKELTAMIPKQRLPTTSLVDESEVFGRD 176

Query:   166 ENSVGRSRKVRQRRETTSLVNEAKVYGMGGLGKTTLAQLVYNDARLQDHFDLKAWTCVSE 225
             ++     R +       + +    + G+GG+GKTTL+QL+YND  ++ +F  K W  VSE
Sbjct:   177 DDKDEIMRFLIPENGKDNGITVVAIVGIGGVGKTTLSQLLYNDQHVRSYFGTKVWAHVSE 236

Query:   226 DFDITRITKSILNSIGTDQNVDSLDFDKLQVEXXXXXXXXXX--XXXXDDVWNENYNDWI 283
             +FD+ +ITK +  S+ T +  +  D D LQV+                DD+WNEN+ DW 
Sbjct:   237 EFDVFKITKKVYESV-TSRPCEFTDLDVLQVKLKERLTGTGLPFLLVLDDLWNENFADWD 295

Query:   284 DLSRPFEAGAPGSKIVVTTRNQAVVAIMGTVPAYPLKELSDEDCLNVFTQHSLGTRDFNM 343
              L +PF   A GS+I+VTTR+Q V +IM  V  + L+ LSD DC ++F +   G ++  +
Sbjct:   296 LLRQPFIHAAQGSQILVTTRSQRVASIMCAVHVHNLQPLSDGDCWSLFMKTVFGNQEPCL 355

Query:   344 HKSLEEIGKKIVIKCNGLPLAAKTLGGLLRGKTDQRDWEDVLNCKIWDLPEERCDILPAL 403
             ++ + ++ ++IV KC GLPLA KTLGG+LR +    +WE VL+ +IWDLP ++ ++LP L
Sbjct:   356 NREIGDLAERIVHKCRGLPLAVKTLGGVLRFEGKVIEWERVLSSRIWDLPADKSNLLPVL 415

Query:   404 KVSYYYLSPRLKQCFTYCSLLPKDYEFKEEEIILLWIAVGFLDQEDNGRESEDLGHMFFK 463
             +VSYYYL   LK+CF YCS+ PK + F++++++LLW+A GFL Q  + +  E+LG+ +F 
Sbjct:   416 RVSYYYLPAHLKRCFAYCSIFPKGHAFEKDKVVLLWMAEGFLQQTRSSKNLEELGNEYFS 475

Query:   464 ELHSRSLFQKSSNDTLRFVMHDLVNDLAQWAAGNIYLRMEDAPGGNKQQRFSKSLRHLSY 523
             EL SRSL QK+     R++MHD +N+LAQ+A+G    + ED   G K Q  S+  R+LSY
Sbjct:   476 ELESRSLLQKTKT---RYIMHDFINELAQFASGEFSSKFED---GCKLQ-VSERTRYLSY 528

Query:   524 IPGGHDGVKRFADFDDTEHLRTFLPVMLSNCWGGY-LAYSILQRLLK-LHRLKVFSLCGY 581
             +   +     F    + + LRTFLP+ L+N      L   + ++LL  L RL+V SL  Y
Sbjct:   529 LRDNYAEPMEFEALREVKFLRTFLPLSLTNSSRSCCLDQMVSEKLLPTLTRLRVLSLSHY 588

Query:   582 QISELP-NSVGDLRYLRYLNLSRTCIEILPDSINKLYNLHTLLLEDCDRLKKLCADMGNL 640
             +I+ LP +   ++ + R+L+LSRT +E LP S+  +YNL TLLL  C  LK+L  D+ NL
Sbjct:   589 KIARLPPDFFKNISHARFLDLSRTELEKLPKSLCYMYNLQTLLLSYCSSLKELPTDISNL 648

Query:   641 IKLHHLNNSTTNSLEEMPRGIGKLTFLQTLCNFAVGKDSGSGLQDLKLLMYLRGTLKISK 700
             I L +L+   T  L +MPR  G+L  LQTL  F V    GS + +L  L  L G LKI +
Sbjct:   649 INLRYLDLIGTK-LRQMPRRFGRLKSLQTLTTFFVSASDGSRISELGGLHDLHGKLKIVE 707

Query:   701 LENVKHVGDAKEAQXXXXXXXXXXXXQW-TCNTDTDGSRD---LGTETRVLDMLRPHQNL 756
             L+ V  V DA EA              W T ++ ++ + +      E  V + LRPH+++
Sbjct:   708 LQRVVDVADAAEANLNSKKHLREIDFVWRTGSSSSENNTNPHRTQNEAEVFEKLRPHRHI 767

Query:   757 EQFFISGYGGTKFPIWLGDSYFSNLVTLKFQNCHKCTSLPSIGKLLSLKHLEVCRMNRVK 816
             E+  I  Y G +FP WL D  FS +V ++ + C  CTSLPS+G+L  LK L +  M  ++
Sbjct:   768 EKLAIERYKGRRFPDWLSDPSFSRIVCIRLRECQYCTSLPSLGQLPCLKELHISGMVGLQ 827

Query:   817 SLGSQFYGNGCP------SPFPCLETLRFEDMQEWEDWIPHGFDQEAEVFPNLRELHLLR 870
             S+G +FY +          PF  LETLRF+++ +W++W+     +  ++FP+L++L +LR
Sbjct:   828 SIGRKFYFSDQQLRDQDQQPFRSLETLRFDNLPDWQEWLDVRVTR-GDLFPSLKKLFILR 886

Query:   871 CSKLQGTFPERLPSLEILVIQSC 893
             C +L GT P  LPSL  L I  C
Sbjct:   887 CPELTGTLPTFLPSLISLHIYKC 909

GO:0005576 "extracellular region" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0043531 "ADP binding" evidence=IEA

GO:0005515 "protein binding" evidence=IPI

GO:0009627 "systemic acquired resistance" evidence=RCA

GO:0009697 "salicylic acid biosynthetic process" evidence=RCA

TAIR\|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)]	Back alignment and assigned GO terms

TAIR\|locus:504956483 AT3G46730 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2011982 AT1G50180 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2075170 RPP13 "RECOGNITION OF PERONOSPORA PARASITICA 13" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2025916 AT1G59780 "AT1G59780" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:504956184 AT1G58807 "AT1G58807" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2827038 AT1G59124 "AT1G59124" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		1446
pfam00931		285	pfam00931, NB-ARC, NB-ARC domain	6e-69
PLN03210		1153	PLN03210, PLN03210, Resistant to P	2e-10
PLN03210		1153	PLN03210, PLN03210, Resistant to P	3e-07
PLN03210		1153	PLN03210, PLN03210, Resistant to P	8e-07
PLN03210		1153	PLN03210, PLN03210, Resistant to P	9e-05
PLN03210		1153	PLN03210, PLN03210, Resistant to P	2e-04
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	0.004

>gnl\|CDD\|216202 pfam00931, NB-ARC, NB-ARC domain	Back alignment and domain information

 Score =  233 bits (596), Expect = 6e-69
 Identities = 106/264 (40%), Positives = 156/264 (59%), Gaps = 7/264 (2%)

Query: 190 VYGMGGLGKTTLAQLVYNDARLQDHFDLKAWTCVSEDFDITRITKSILNSIG-TDQNVDS 248
           + GMGG+GKTTLA+ +YND  +  HFD  AW  VS+ +   R+ K IL  +G  D +   
Sbjct: 24  IVGMGGVGKTTLAKQIYNDDSVGGHFDSVAWVVVSKTYTEFRLQKDILQELGLDDSDWVE 83

Query: 249 LDFDKLQVELKKQLSQKKFLLVLDDVWNENYNDWIDLSRPFEAGAPGSKIVVTTRNQAVV 308
            +  +L V++K+ L +K+FLLVLDDVW +  NDW  +  PF  G  GS+++VTTR+++V 
Sbjct: 84  KNESELAVKIKEALLRKRFLLVLDDVWEK--NDWDKIGVPFPDGENGSRVIVTTRSESVA 141

Query: 309 -AIMGTVPAYPLKELSDEDCLNVFTQHSLGTRDFNMHKSLEEIGKKIVIKCNGLPLAAKT 367
             + GT   + ++ L  E+   +F+      ++      LEE+ K+IV KC GLPLA K 
Sbjct: 142 GRMGGTSKPHEVESLEPEESWELFSNKV-FEKELPPCPELEEVAKEIVEKCKGLPLALKV 200

Query: 368 LGGLLRGKTDQRDWEDVLNCKIWDLPEERCD--ILPALKVSYYYLSPRLKQCFTYCSLLP 425
           LGGLL  K+  ++WE VL     +L        +L  L +SY  L   LK+CF Y +L P
Sbjct: 201 LGGLLAFKSTVQEWEHVLEQLNNELAGRDGLNEVLSILSLSYDNLPMHLKRCFLYLALFP 260

Query: 426 KDYEFKEEEIILLWIAVGFLDQED 449
           +DY  ++E++I LWIA GF+   D
Sbjct: 261 EDYNIRKEQLIKLWIAEGFVIPSD 284

Length = 285

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1446
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	100.0
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.88
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.88
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.87
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.85
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.84
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.82
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.82
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.81
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.81
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.45
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.4
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.37
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.35
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.34
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.3
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.29
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.19
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.17
PRK04841		903	transcriptional regulator MalT; Provisional	99.14
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	98.91
PRK15386		426	type III secretion protein GogB; Provisional	98.8
PRK00411		394	cdc6 cell division control protein 6; Reviewed	98.76
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.71
PF05729		166	NACHT: NACHT domain	98.69
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.68
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.65
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	98.59
KOG4341		483	consensus F-box protein containing LRR [General fu	98.59
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.53
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.46
PRK06893		229	DNA replication initiation factor; Validated	98.45
PRK15386		426	type III secretion protein GogB; Provisional	98.43
KOG4341		483	consensus F-box protein containing LRR [General fu	98.4
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	98.36
COG3903		414	Predicted ATPase [General function prediction only	98.36
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.35
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	98.33
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.31
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	98.25
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.24
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.23
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	98.17
PLN03150		623	hypothetical protein; Provisional	98.17
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	98.15
COG2256		436	MGS1 ATPase related to the helicase subunit of the	98.13
cd01128		249	rho_factor Transcription termination factor rho is	98.13
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.11
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.09
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.07
PTZ00112		1164	origin recognition complex 1 protein; Provisional	98.07
PLN03150		623	hypothetical protein; Provisional	98.05
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.05
PF13173		128	AAA_14: AAA domain	98.03
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	98.0
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	97.99
PRK09376		416	rho transcription termination factor Rho; Provisio	97.98
PRK08727		233	hypothetical protein; Validated	97.88
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.87
PRK09087		226	hypothetical protein; Validated	97.86
PRK13342		413	recombination factor protein RarA; Reviewed	97.81
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.8
PRK05564		313	DNA polymerase III subunit delta'; Validated	97.76
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.74
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	97.72
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	97.68
PRK08084		235	DNA replication initiation factor; Provisional	97.67
TIGR00767		415	rho transcription termination factor Rho. Members	97.67
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.67
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	97.66
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	97.63
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	97.63
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.58
PRK05642		234	DNA replication initiation factor; Validated	97.56
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	97.55
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.54
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	97.49
KOG2028		554	consensus ATPase related to the helicase subunit o	97.48
COG3899		849	Predicted ATPase [General function prediction only	97.45
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.45
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	97.44
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	97.43
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	97.41
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	97.4
PRK08903		227	DnaA regulatory inactivator Hda; Validated	97.39
PRK14087		450	dnaA chromosomal replication initiation protein; P	97.38
PLN03025		319	replication factor C subunit; Provisional	97.38
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	97.36
PRK04195		482	replication factor C large subunit; Provisional	97.35
CHL00181		287	cbbX CbbX; Provisional	97.35
PRK13341		725	recombination factor protein RarA/unknown domain f	97.35
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	97.33
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	97.32
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	97.29
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	97.29
PRK12402		337	replication factor C small subunit 2; Reviewed	97.28
PRK06620		214	hypothetical protein; Validated	97.27
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	97.24
PRK14088		440	dnaA chromosomal replication initiation protein; P	97.24
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	97.23
PRK07940		394	DNA polymerase III subunit delta'; Validated	97.23
PRK12422		445	chromosomal replication initiation protein; Provis	97.22
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	97.2
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	97.2
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.16
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	97.15
PRK07471		365	DNA polymerase III subunit delta'; Validated	97.12
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	97.12
COG0593		408	DnaA ATPase involved in DNA replication initiation	97.09
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	97.07
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	97.07
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	97.06
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	97.05
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	97.05
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	97.04
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	97.03
PRK14086		617	dnaA chromosomal replication initiation protein; P	97.03
PRK00149		450	dnaA chromosomal replication initiation protein; R	97.01
PRK09112		351	DNA polymerase III subunit delta'; Validated	97.0
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	96.98
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	96.97
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	96.96
PRK08116		268	hypothetical protein; Validated	96.96
PRK05707		328	DNA polymerase III subunit delta'; Validated	96.95
PRK00440		319	rfc replication factor C small subunit; Reviewed	96.92
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	96.87
PF04665		241	Pox_A32: Poxvirus A32 protein; InterPro: IPR006758	96.85
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	96.84
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	96.84
PF00004		132	AAA: ATPase family associated with various cellula	96.83
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.81
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	96.77
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	96.77
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	96.76
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	96.73
smart00382		148	AAA ATPases associated with a variety of cellular	96.69
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	96.68
PRK08118		167	topology modulation protein; Reviewed	96.66
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	96.63
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.62
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	96.61
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	96.61
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	96.59
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	96.58
KOG2982		418	consensus Uncharacterized conserved protein [Funct	96.58
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	96.58
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	96.58
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	96.57
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	96.51
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	96.5
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	96.48
KOG2543		438	consensus Origin recognition complex, subunit 5 [R	96.33
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	96.31
PRK08181		269	transposase; Validated	96.29
PRK03992		389	proteasome-activating nucleotidase; Provisional	96.26
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	96.25
PF14516		331	AAA_35: AAA-like domain	96.19
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	96.17
KOG2982		418	consensus Uncharacterized conserved protein [Funct	96.16
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	96.14
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	96.13
PRK12608		380	transcription termination factor Rho; Provisional	96.1
PHA02544		316	44 clamp loader, small subunit; Provisional	96.03
PF13191		185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	96.02
PRK08769		319	DNA polymerase III subunit delta'; Validated	95.99
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.94
COG1373		398	Predicted ATPase (AAA+ superfamily) [General funct	95.93
PRK09183		259	transposase/IS protein; Provisional	95.92
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	95.91
PRK07952		244	DNA replication protein DnaC; Validated	95.91
PRK06921		266	hypothetical protein; Provisional	95.83
PRK06526		254	transposase; Provisional	95.81
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	95.77
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	95.74
PRK06090		319	DNA polymerase III subunit delta'; Validated	95.72
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	95.71
PTZ00202		550	tuzin; Provisional	95.7
cd00561		159	CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B	95.68
PRK09361		225	radB DNA repair and recombination protein RadB; Pr	95.67
PRK08939		306	primosomal protein DnaI; Reviewed	95.65
PRK07261		171	topology modulation protein; Provisional	95.65
PRK04296		190	thymidine kinase; Provisional	95.64
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	95.62
PRK07399		314	DNA polymerase III subunit delta'; Validated	95.62
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	95.61
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	95.58
PRK06835		329	DNA replication protein DnaC; Validated	95.54
PRK12377		248	putative replication protein; Provisional	95.5
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.49
cd01123		235	Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r	95.46
PF08423		256	Rad51: Rad51; InterPro: IPR013632 This domain is f	95.46
KOG2227		529	consensus Pre-initiation complex, subunit CDC6, AA	95.45
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	95.44
PRK06871		325	DNA polymerase III subunit delta'; Validated	95.42
TIGR02237		209	recomb_radB DNA repair and recombination protein R	95.38
cd01133		274	F1-ATPase_beta F1 ATP synthase beta subunit, nucle	95.37
PRK10536		262	hypothetical protein; Provisional	95.34
CHL00176		638	ftsH cell division protein; Validated	95.22
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	95.21
cd00983		325	recA RecA is a bacterial enzyme which has roles in	95.19
COG3267		269	ExeA Type II secretory pathway, component ExeA (pr	95.13
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	95.06
PRK08058		329	DNA polymerase III subunit delta'; Validated	95.02
PRK09354		349	recA recombinase A; Provisional	95.01
PRK06964		342	DNA polymerase III subunit delta'; Validated	95.0
cd01393		226	recA_like RecA is a bacterial enzyme which has rol	94.99
COG0468		279	RecA RecA/RadA recombinase [DNA replication, recom	94.97
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	94.95
PRK07993		334	DNA polymerase III subunit delta'; Validated	94.95
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	94.87
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	94.79
KOG2123		388	consensus Uncharacterized conserved protein [Funct	94.75
PRK05541		176	adenylylsulfate kinase; Provisional	94.75
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	94.74
KOG0473		326	consensus Leucine-rich repeat protein [Function un	94.73
PRK04132		846	replication factor C small subunit; Provisional	94.63
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	94.49
TIGR02238		313	recomb_DMC1 meiotic recombinase Dmc1. This model d	94.49
KOG2123		388	consensus Uncharacterized conserved protein [Funct	94.43
cd01394		218	radB RadB. The archaeal protein radB shares simila	94.36
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	94.34
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	94.32
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	94.32
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	94.24
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	94.24
PF00154		322	RecA: recA bacterial DNA recombination protein; In	94.22
COG1484		254	DnaC DNA replication protein [DNA replication, rec	94.19
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	94.19
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	94.16
PRK04301		317	radA DNA repair and recombination protein RadA; Va	94.13
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	94.08
PRK13695		174	putative NTPase; Provisional	93.98
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	93.97
TIGR00602		637	rad24 checkpoint protein rad24. This family is bas	93.96
PHA00729		226	NTP-binding motif containing protein	93.94
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	93.92
PRK08699		325	DNA polymerase III subunit delta'; Validated	93.92
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	93.88
COG1618		179	Predicted nucleotide kinase [Nucleotide transport	93.8
KOG2004		906	consensus Mitochondrial ATP-dependent protease PIM	93.59
PLN03187		344	meiotic recombination protein DMC1 homolog; Provis	93.57
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	93.56
PLN03186		342	DNA repair protein RAD51 homolog; Provisional	93.55
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	93.49
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	93.47
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	93.42
KOG0728		404	consensus 26S proteasome regulatory complex, ATPas	93.28
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	93.28
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	93.27
PRK08233		182	hypothetical protein; Provisional	93.26
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	93.2
TIGR02239		316	recomb_RAD51 DNA repair protein RAD51. This eukary	93.16
COG0572		218	Udk Uridine kinase [Nucleotide transport and metab	93.15
PRK05986		191	cob(I)alamin adenolsyltransferase/cobinamide ATP-d	93.07
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	93.05
TIGR00708		173	cobA cob(I)alamin adenosyltransferase. Alternate n	93.01
PF05659		147	RPW8: Arabidopsis broad-spectrum mildew resistance	92.96
TIGR02236		310	recomb_radA DNA repair and recombination protein R	92.92
PRK06762		166	hypothetical protein; Provisional	92.9
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	92.87
KOG1969		877	consensus DNA replication checkpoint protein CHL12	92.83
CHL00195		489	ycf46 Ycf46; Provisional	92.81
COG2842		297	Uncharacterized ATPase, putative transposase [Gene	92.81
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	92.8
COG4608		268	AppF ABC-type oligopeptide transport system, ATPas	92.7
PRK06067		234	flagellar accessory protein FlaH; Validated	92.69
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	92.67
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	92.64
COG0563		178	Adk Adenylate kinase and related kinases [Nucleoti	92.62
PF00485		194	PRK: Phosphoribulokinase / Uridine kinase family;	92.6
cd03214		180	ABC_Iron-Siderophores_B12_Hemin ABC transporters,	92.54
PTZ00301		210	uridine kinase; Provisional	92.53
cd03238		176	ABC_UvrA The excision repair protein UvrA; Nucleot	92.47
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	92.45
cd01125		239	repA Hexameric Replicative Helicase RepA. RepA is	92.45
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	92.42
PF08433		270	KTI12: Chromatin associated protein KTI12 ; InterP	92.34
PF13238		129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	92.34
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	92.33
PTZ00088		229	adenylate kinase 1; Provisional	92.31
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	92.3
KOG1514		767	consensus Origin recognition complex, subunit 1, a	92.28
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	92.27
PF13671		143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	92.18
CHL00095		821	clpC Clp protease ATP binding subunit	92.15
TIGR03575		340	selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti	92.13
cd01122		271	GP4d_helicase GP4d_helicase is a homohexameric 5'-	92.11
PRK10865		857	protein disaggregation chaperone; Provisional	92.08
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	92.08
cd02025		220	PanK Pantothenate kinase (PanK) catalyzes the phos	92.0
cd03247		178	ABCC_cytochrome_bd The CYD subfamily implicated in	91.98
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	91.94
PF00006		215	ATP-synt_ab: ATP synthase alpha/beta family, nucle	91.92
COG2812		515	DnaX DNA polymerase III, gamma/tau subunits [DNA r	91.91
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	91.89
cd03115		173	SRP The signal recognition particle (SRP) mediates	91.87
TIGR00064		272	ftsY signal recognition particle-docking protein F	91.83
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	91.81
cd03222		177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	91.68
PRK00771		437	signal recognition particle protein Srp54; Provisi	91.67
COG1136		226	SalX ABC-type antimicrobial peptide transport syst	91.67
COG2884		223	FtsE Predicted ATPase involved in cell division [C	91.66
KOG0473		326	consensus Leucine-rich repeat protein [Function un	91.63
PTZ00035		337	Rad51 protein; Provisional	91.62
cd03228		171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	91.51
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	91.51
COG1121		254	ZnuC ABC-type Mn/Zn transport systems, ATPase comp	91.48
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	91.45
PRK10867		433	signal recognition particle protein; Provisional	91.4
cd03216		163	ABC_Carb_Monos_I This family represents the domain	91.31
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	91.23
TIGR02858		270	spore_III_AA stage III sporulation protein AA. Mem	91.18
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	91.17
PHA02244		383	ATPase-like protein	91.14
cd03223		166	ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass	91.08
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	91.05
cd02028		179	UMPK_like Uridine monophosphate kinase_like (UMPK_	91.04
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	91.02
KOG2035		351	consensus Replication factor C, subunit RFC3 [Cell	91.01
cd02019		69	NK Nucleoside/nucleotide kinase (NK) is a protein	91.01
TIGR00959		428	ffh signal recognition particle protein. This mode	91.01
cd02024		187	NRK1 Nicotinamide riboside kinase (NRK) is an enzy	90.94
PRK06217		183	hypothetical protein; Validated	90.9
PF07726		131	AAA_3: ATPase family associated with various cellu	90.86
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	90.84
cd03230		173	ABC_DR_subfamily_A This family of ATP-binding prot	90.84
KOG3864		221	consensus Uncharacterized conserved protein [Funct	90.78
CHL00095		821	clpC Clp protease ATP binding subunit	90.78
PRK06002		450	fliI flagellum-specific ATP synthase; Validated	90.75
cd02027		149	APSK Adenosine 5'-phosphosulfate kinase (APSK) cat	90.65
cd01135		276	V_A-ATPase_B V/A-type ATP synthase (non-catalytic)	90.59
PRK14974		336	cell division protein FtsY; Provisional	90.56
PRK07132		299	DNA polymerase III subunit delta'; Validated	90.56
KOG1532		366	consensus GTPase XAB1, interacts with DNA repair p	90.55
PTZ00185		574	ATPase alpha subunit; Provisional	90.4
TIGR03877		237	thermo_KaiC_1 KaiC domain protein, Ph0284 family.	90.39
PF03969		362	AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654	90.38
KOG0924		1042	consensus mRNA splicing factor ATP-dependent RNA h	90.37
PRK09280		463	F0F1 ATP synthase subunit beta; Validated	90.35
PRK09519		790	recA DNA recombination protein RecA; Reviewed	90.24
PRK03839		180	putative kinase; Provisional	90.22
PRK00625		173	shikimate kinase; Provisional	90.2
COG1102		179	Cmk Cytidylate kinase [Nucleotide transport and me	90.14
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	90.14
PF00910		107	RNA_helicase: RNA helicase; InterPro: IPR000605 He	90.12
PF07724		171	AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR	90.05
cd03246		173	ABCC_Protease_Secretion This family represents the	90.04
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	90.01
PRK12597		461	F0F1 ATP synthase subunit beta; Provisional	90.0
COG4088		261	Predicted nucleotide kinase [Nucleotide transport	89.98
KOG2228		408	consensus Origin recognition complex, subunit 4 [R	89.97
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	89.96
cd02021		150	GntK Gluconate kinase (GntK) catalyzes the phospho	89.95
PF12061		402	DUF3542: Protein of unknown function (DUF3542); In	89.8
cd03229		178	ABC_Class3 This class is comprised of all BPD (Bin	89.74
COG0396		251	sufC Cysteine desulfurase activator ATPase [Posttr	89.73
PF14532		138	Sigma54_activ_2: Sigma-54 interaction domain; PDB:	89.71
TIGR03574		249	selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem	89.63
PRK08972		444	fliI flagellum-specific ATP synthase; Validated	89.54
COG1428		216	Deoxynucleoside kinases [Nucleotide transport and	89.53
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	89.46
PRK08149		428	ATP synthase SpaL; Validated	89.39
cd02034		116	CooC The accessory protein CooC, which contains a	89.37
KOG3347		176	consensus Predicted nucleotide kinase/nuclear prot	89.34
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	89.29
PRK07004		460	replicative DNA helicase; Provisional	89.28
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	89.21
cd03283		199	ABC_MutS-like MutS-like homolog in eukaryotes. The	89.19
PF01583		156	APS_kinase: Adenylylsulphate kinase; InterPro: IPR	89.15
KOG0743		457	consensus AAA+-type ATPase [Posttranslational modi	89.13
PF07693		325	KAP_NTPase: KAP family P-loop domain; InterPro: IP	89.11
PRK05480		209	uridine/cytidine kinase; Provisional	89.1
TIGR00235		207	udk uridine kinase. Model contains a number of lon	89.09
KOG0731		774	consensus AAA+-type ATPase containing the peptidas	89.09
TIGR03600		421	phage_DnaB phage replicative helicase, DnaB family	89.07
TIGR01313		163	therm_gnt_kin carbohydrate kinase, thermoresistant	89.04
cd01878		204	HflX HflX subfamily. A distinct conserved domain w	88.93
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	88.91
PRK10865		857	protein disaggregation chaperone; Provisional	88.82
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	88.8
TIGR00554		290	panK_bact pantothenate kinase, bacterial type. Sho	88.79
cd00267		157	ABC_ATPase ABC (ATP-binding cassette) transporter	88.76
PRK04328		249	hypothetical protein; Provisional	88.74
PF13481		193	AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.	88.73
PRK00889		175	adenylylsulfate kinase; Provisional	88.69
PRK06547		172	hypothetical protein; Provisional	88.56
COG2607		287	Predicted ATPase (AAA+ superfamily) [General funct	88.48
cd03281		213	ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS	88.44
TIGR01040		466	V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th	88.41
cd03282		204	ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS	88.36
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	88.21
COG3640		255	CooC CO dehydrogenase maturation factor [Cell divi	88.21
PRK13947		171	shikimate kinase; Provisional	88.19
cd01134		369	V_A-ATPase_A V/A-type ATP synthase catalytic subun	88.16
PRK06696		223	uridine kinase; Validated	88.16
PRK00279		215	adk adenylate kinase; Reviewed	88.14
TIGR03305		449	alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit	88.13
PRK10733		644	hflB ATP-dependent metalloprotease; Reviewed	88.13
PRK05439		311	pantothenate kinase; Provisional	88.0
KOG0734		752	consensus AAA+-type ATPase containing the peptidas	88.0
PRK05973		237	replicative DNA helicase; Provisional	87.91
PRK08927		442	fliI flagellum-specific ATP synthase; Validated	87.91
PRK04040		188	adenylate kinase; Provisional	87.89
PF00158		168	Sigma54_activat: Sigma-54 interaction domain; Inte	87.77
cd02023		198	UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.	87.75
smart00370		26	LRR Leucine-rich repeats, outliers.	87.73
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	87.73
cd00544		169	CobU Adenosylcobinamide kinase / adenosylcobinamid	87.69
COG1936		180	Predicted nucleotide kinase (related to CMP and AM	87.68
PRK07667		193	uridine kinase; Provisional	87.66
cd01132		274	F1_ATPase_alpha F1 ATP synthase alpha, central dom	87.52
COG0703		172	AroK Shikimate kinase [Amino acid transport and me	87.52
COG1066		456	Sms Predicted ATP-dependent serine protease [Postt	87.48
PRK13949		169	shikimate kinase; Provisional	87.38
PRK09099		441	type III secretion system ATPase; Provisional	87.33
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	87.25
TIGR01359		183	UMP_CMP_kin_fam UMP-CMP kinase family. This subfam	87.22
PRK05922		434	type III secretion system ATPase; Validated	87.14
PRK12678		672	transcription termination factor Rho; Provisional	87.13
PRK13543		214	cytochrome c biogenesis protein CcmA; Provisional	87.03
PF12775		272	AAA_7: P-loop containing dynein motor region D3; P	87.03
TIGR03498		418	FliI_clade3 flagellar protein export ATPase FliI.	86.97
PRK09270		229	nucleoside triphosphate hydrolase domain-containin	86.93
cd01136		326	ATPase_flagellum-secretory_path_III Flagellum-spec	86.85
PRK06904		472	replicative DNA helicase; Validated	86.8
PRK11823		446	DNA repair protein RadA; Provisional	86.77
cd02029		277	PRK_like Phosphoribulokinase-like (PRK-like) is a	86.71
COG0541		451	Ffh Signal recognition particle GTPase [Intracellu	86.64
PRK06793		432	fliI flagellum-specific ATP synthase; Validated	86.48
cd03217		200	ABC_FeS_Assembly ABC-type transport system involve	86.47
PF10443		431	RNA12: RNA12 protein; InterPro: IPR018850 Mitochon	86.46
KOG0736		953	consensus Peroxisome assembly factor 2 containing	86.44
PRK07594		433	type III secretion system ATPase SsaN; Validated	86.44
PRK08533		230	flagellar accessory protein FlaH; Reviewed	86.42
PRK00131		175	aroK shikimate kinase; Reviewed	86.37
TIGR01069		771	mutS2 MutS2 family protein. Function of MutS2 is u	86.36
TIGR01041		458	ATP_syn_B_arch ATP synthase archaeal, B subunit. A	86.33
TIGR02322		179	phosphon_PhnN phosphonate metabolism protein/1,5-b	86.29
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	86.27
TIGR01360		188	aden_kin_iso1 adenylate kinase, isozyme 1 subfamil	86.26
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	86.1
PRK15453		290	phosphoribulokinase; Provisional	86.09
cd00464		154	SK Shikimate kinase (SK) is the fifth enzyme in th	85.97
PRK06936		439	type III secretion system ATPase; Provisional	85.94
PRK10875		615	recD exonuclease V subunit alpha; Provisional	85.93
PF03029		238	ATP_bind_1: Conserved hypothetical ATP binding pro	85.92
cd03243		202	ABC_MutS_homologs The MutS protein initiates DNA m	85.87
cd00071		137	GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.	85.83
TIGR01039		461	atpD ATP synthase, F1 beta subunit. The sequences	85.81
COG0467		260	RAD55 RecA-superfamily ATPases implicated in signa	85.78
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	85.71
PF08477		119	Miro: Miro-like protein; InterPro: IPR013684 Mitoc	85.7
COG4181		228	Predicted ABC-type transport system involved in ly	85.68
TIGR03324		497	alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a	85.58
TIGR00416		454	sms DNA repair protein RadA. The gene protuct code	85.46
cd02020		147	CMPK Cytidine monophosphate kinase (CMPK) catalyze	85.46
TIGR02902		531	spore_lonB ATP-dependent protease LonB. Members of	85.33
KOG0729		435	consensus 26S proteasome regulatory complex, ATPas	85.32
TIGR01447		586	recD exodeoxyribonuclease V, alpha subunit. This f	85.29
PRK13948		182	shikimate kinase; Provisional	85.28
PRK05636		505	replicative DNA helicase; Provisional	85.23
COG1124		252	DppF ABC-type dipeptide/oligopeptide/nickel transp	85.18
cd00227		175	CPT Chloramphenicol (Cm) phosphotransferase (CPT).	85.16
PRK13946		184	shikimate kinase; Provisional	85.13
cd00984		242	DnaB_C DnaB helicase C terminal domain. The hexame	85.09
COG0003		322	ArsA Predicted ATPase involved in chromosome parti	85.06
KOG1051		898	consensus Chaperone HSP104 and related ATP-depende	85.02
KOG0736		953	consensus Peroxisome assembly factor 2 containing	84.99
PRK10078		186	ribose 1,5-bisphosphokinase; Provisional	84.79
PRK05057		172	aroK shikimate kinase I; Reviewed	84.73
KOG4252		246	consensus GTP-binding protein [Signal transduction	84.66
PRK14530		215	adenylate kinase; Provisional	84.62
PRK05800		170	cobU adenosylcobinamide kinase/adenosylcobinamide-	84.51
PLN02796		347	D-glycerate 3-kinase	84.51
TIGR03263		180	guanyl_kin guanylate kinase. Members of this famil	84.42
PRK08472		434	fliI flagellum-specific ATP synthase; Validated	84.39
cd00820		107	PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC	84.34
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	84.34
smart00534		185	MUTSac ATPase domain of DNA mismatch repair MUTS f	84.3
TIGR01420		343	pilT_fam pilus retraction protein PilT. This model	84.24
PRK07721		438	fliI flagellum-specific ATP synthase; Validated	84.15
COG4639		168	Predicted kinase [General function prediction only	84.08
TIGR03496		411	FliI_clade1 flagellar protein export ATPase FliI.	84.07
COG1875		436	NYN ribonuclease and ATPase of PhoH family domains	84.04
COG2019		189	AdkA Archaeal adenylate kinase [Nucleotide transpo	84.0
PF00625		183	Guanylate_kin: Guanylate kinase; InterPro: IPR0081	83.98
KOG3864		221	consensus Uncharacterized conserved protein [Funct	83.94
PRK10751		173	molybdopterin-guanine dinucleotide biosynthesis pr	83.94
PF13479		213	AAA_24: AAA domain	83.93
PRK07196		434	fliI flagellum-specific ATP synthase; Validated	83.75
PF03796		259	DnaB_C: DnaB-like helicase C terminal domain; Inte	83.59
cd01672		200	TMPK Thymidine monophosphate kinase (TMPK), also k	83.52
TIGR00390		441	hslU ATP-dependent protease HslVU, ATPase subunit.	83.52
PRK05688		451	fliI flagellum-specific ATP synthase; Validated	83.5
PRK05022		509	anaerobic nitric oxide reductase transcription reg	83.47
COG1126		240	GlnQ ABC-type polar amino acid transport system, A	83.44

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=4.4e-81  Score=772.20  Aligned_cols=669  Identities=31%  Similarity=0.452  Sum_probs=503.1

Q ss_pred             HHHHHHhhHHHHHHHHHHHHHHHHHHHHhhhhhccCChHHHHHHHHHHHHHHhhHhhHHHHHHHHHhhhhccCCCCCCCc
Q 042296           26 RFFARQEQILADLMKWKKMLMKINVVLDDADERQRTDKSVKLWLGELQNLAYDVEDLLDEFETEALGRKLLLGDGESDAA  105 (1446)
Q Consensus        26 ~~~~~~~~~~~~~~~l~~~l~~i~~~l~~a~~~~~~~~~~~~wl~~lr~~~yd~eD~ld~~~~~~~~~~~~~~~~~~~~~  105 (1446)
                      .++....+.++.+..|+++|..++.++++|+.++.....+..|...++|++|++||+++.|......++..+.       
T Consensus        18 ~~~~~~~~~~~~i~~Lk~~L~~l~~~l~d~~a~~~~~~~~~~~~e~~~~~~~~~e~~~~~~~v~~~~~~~~~~-------   90 (889)
T KOG4658|consen   18 RESECLDGKDNYILELKENLKALQSALEDLDAKRDDLERRVNWEEDVGDLVYLAEDIIWLFLVEEIERKANDL-------   90 (889)
T ss_pred             HHHHHHhchHHHHHHHHHHHHHHHHHHHHHHhhcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHH-------
Confidence            3455556788899999999999999999999999888899999999999999999999999988766543211       


Q ss_pred             CCCCCCCCcccccccccccccccccCcccchhhHHHHHHHHHHHHHHHHHHhcccccCcccccccccccccccc--cc--
Q 042296          106 NDDQPSSSTGTSIFRKLIPTCCTTFTPRSIKFDYTIMSKIKEINARFQDIVSQKDLLDFKENSVGRSRKVRQRR--ET--  181 (1446)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~--  181 (1446)
                         .    .......+.  .|...+........+.+++++-++...++....+...-..... ..........+  .+  
T Consensus        91 ---l----~~~~~~~~~--~c~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~~-~~~~~~~e~~~~~~~~~  160 (889)
T KOG4658|consen   91 ---L----STRSVERQR--LCLCGFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEVVGES-LDPREKVETRPIQSESD  160 (889)
T ss_pred             ---h----hhhHHHHHH--HhhhhhHhHhhhhhHhHHHHHHHHHHHHHHhccccceeccccc-ccchhhcccCCCCcccc
Confidence               0    000011111  1221221222223344555555555555554433211110000 00000000000  00  


Q ss_pred             ---------------ccccccceeEccCCchHHHHHHHHHcccc-hhccCCceEEEEeCCCCCHHHHHHHHHHHhcCCCC
Q 042296          182 ---------------TSLVNEAKVYGMGGLGKTTLAQLVYNDAR-LQDHFDLKAWTCVSEDFDITRITKSILNSIGTDQN  245 (1446)
Q Consensus       182 ---------------~~~~~~~~i~G~gG~GKTtLa~~v~~~~~-~~~~F~~~~wv~vs~~~~~~~~~~~i~~~l~~~~~  245 (1446)
                                     ......++|+||||+||||||+.++|+.. ++.+||.++||.||+.++...++++|+..++....
T Consensus       161 VG~e~~~~kl~~~L~~d~~~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~~l~~~~~  240 (889)
T KOG4658|consen  161 VGLETMLEKLWNRLMEDDVGIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILERLGLLDE  240 (889)
T ss_pred             ccHHHHHHHHHHHhccCCCCEEEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHHHHHHhccCCc
Confidence                           01114678999999999999999999987 99999999999999999999999999999987543


Q ss_pred             C-CCCCHHHHHHHHHHHcCCceEEEEEECCCCCChhhHHHhcccccCCCCCcEEEEEccChHHHHh-hCCCCceecCCCC
Q 042296          246 V-DSLDFDKLQVELKKQLSQKKFLLVLDDVWNENYNDWIDLSRPFEAGAPGSKIVVTTRNQAVVAI-MGTVPAYPLKELS  323 (1446)
Q Consensus       246 ~-~~~~~~~~~~~l~~~l~~~~~LlVlDdv~~~~~~~~~~~~~~l~~~~~gs~iivTtR~~~v~~~-~~~~~~~~l~~L~  323 (1446)
                      . ...+.++++..+.+.|++|||+|||||||++  .+|+.+..++|....||||++|||++.|+.. +++...+++++|+
T Consensus       241 ~~~~~~~~~~~~~i~~~L~~krfllvLDDIW~~--~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~  318 (889)
T KOG4658|consen  241 EWEDKEEDELASKLLNLLEGKRFLLVLDDIWEE--VDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLT  318 (889)
T ss_pred             ccchhhHHHHHHHHHHHhccCceEEEEeccccc--ccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccccccccC
Confidence            2 2334578999999999999999999999998  7899999999999899999999999999998 7888899999999


Q ss_pred             hHhHHHHHHhhccCCCCCCCChhHHHHHHHHHHHhCCchhHHHHHHhhhcCCCChhHHHHHHhccccC----CCCccccc
Q 042296          324 DEDCLNVFTQHSLGTRDFNMHKSLEEIGKKIVIKCNGLPLAAKTLGGLLRGKTDQRDWEDVLNCKIWD----LPEERCDI  399 (1446)
Q Consensus       324 ~~~~~~lf~~~a~~~~~~~~~~~~~~~~~~i~~~c~glPlai~~~~~~L~~~~~~~~w~~~l~~~~~~----~~~~~~~~  399 (1446)
                      .+|||.||++.||.... ...+.++++|++|+++|+|+|||++++|+.|+.+.+..+|+++.+...+.    .+++.+.+
T Consensus       319 ~~eaW~LF~~~v~~~~~-~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i  397 (889)
T KOG4658|consen  319 PEEAWDLFQKKVGPNTL-GSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESI  397 (889)
T ss_pred             ccccHHHHHHhhccccc-cccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhh
Confidence            99999999999987642 33445899999999999999999999999999999999999999866544    33345789


Q ss_pred             chhhhhhhccCCHHHHHHHhhhccCCCCceeChHHHHHHHHhCCCCCCCCCCCCHHHHHHHHHHHHHhcCcccccc--CC
Q 042296          400 LPALKVSYYYLSPRLKQCFTYCSLLPKDYEFKEEEIILLWIAVGFLDQEDNGRESEDLGHMFFKELHSRSLFQKSS--ND  477 (1446)
Q Consensus       400 ~~~l~~sy~~L~~~~k~cf~~~~~fp~~~~i~~~~li~~w~a~g~i~~~~~~~~~~~~~~~~~~~L~~~~ll~~~~--~~  477 (1446)
                      ++++++||+.||++.|.||+|||+||+||.|+++.|+.+|+||||+.+.+++..++++|+.|+.+|++++|++...  +.
T Consensus       398 ~~iLklSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~  477 (889)
T KOG4658|consen  398 LPILKLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGR  477 (889)
T ss_pred             HHhhhccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccc
Confidence            9999999999999999999999999999999999999999999999987778899999999999999999999865  35


Q ss_pred             CCceEehhhHHHHHHHhhc-----cceEEeecCCCC--cccccccccceEEEeecCCCccccccccccCCCCcceecccc
Q 042296          478 TLRFVMHDLVNDLAQWAAG-----NIYLRMEDAPGG--NKQQRFSKSLRHLSYIPGGHDGVKRFADFDDTEHLRTFLPVM  550 (1446)
Q Consensus       478 ~~~~~mH~lv~~~~~~~~~-----~~~~~~~~~~~~--~~~~~~~~~~r~ls~~~~~~~~~~~~~~~~~~~~Lr~L~~~~  550 (1446)
                      ..+|+|||+|||+|.++|+     .+..++....+.  ......+..+|+++++.+....   ...-..+++|++|+...
T Consensus       478 ~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~---~~~~~~~~~L~tLll~~  554 (889)
T KOG4658|consen  478 KETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEH---IAGSSENPKLRTLLLQR  554 (889)
T ss_pred             eeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhh---ccCCCCCCccceEEEee
Confidence            5689999999999999999     454444432111  1122334678999988765432   33445677899998887


Q ss_pred             cccCCCCcchhHHHHhhh-cCceeEEEEeCCCC-ccccCccccCCCCCceeeccCccccccCcccccccccceeeccCcc
Q 042296          551 LSNCWGGYLAYSILQRLL-KLHRLKVFSLCGYQ-ISELPNSVGDLRYLRYLNLSRTCIEILPDSINKLYNLHTLLLEDCD  628 (1446)
Q Consensus       551 ~~~~~~~~~~~~~~~~~~-~l~~Lr~L~L~~~~-i~~lp~~i~~L~~Lr~L~L~~~~i~~lp~~i~~L~~L~~L~L~~~~  628 (1446)
                      +..     ....++..+| .++.||||||++|. +.++|++|++|.+||||+|+++.|+.+|.++++|+.|.+||+..+.
T Consensus       555 n~~-----~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~  629 (889)
T KOG4658|consen  555 NSD-----WLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTG  629 (889)
T ss_pred             cch-----hhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhheecccccc
Confidence            542     1345566667 89999999999876 8899999999999999999999999999999999999999999987


Q ss_pred             ccccccccccCcccceeecccCCCcccccCCcccccccccccCceEecCCCCCChhhhhhhhccc---CeeEEeeccCCC
Q 042296          629 RLKKLCADMGNLIKLHHLNNSTTNSLEEMPRGIGKLTFLQTLCNFAVGKDSGSGLQDLKLLMYLR---GTLKISKLENVK  705 (1446)
Q Consensus       629 ~~~~lp~~i~~L~~L~~L~l~~~~~~~~~p~~i~~L~~L~~L~~~~~~~~~~~~~~~L~~L~~L~---~~L~i~~l~~~~  705 (1446)
                      ....+|..+..|.+||+|.+.... ...-...++.+.+|++|..+.....+...+..+..+..|.   ..+.+..     
T Consensus       630 ~l~~~~~i~~~L~~Lr~L~l~~s~-~~~~~~~l~el~~Le~L~~ls~~~~s~~~~e~l~~~~~L~~~~~~l~~~~-----  703 (889)
T KOG4658|consen  630 RLESIPGILLELQSLRVLRLPRSA-LSNDKLLLKELENLEHLENLSITISSVLLLEDLLGMTRLRSLLQSLSIEG-----  703 (889)
T ss_pred             ccccccchhhhcccccEEEeeccc-cccchhhHHhhhcccchhhheeecchhHhHhhhhhhHHHHHHhHhhhhcc-----
Confidence            777777777789999999987654 2222234566666676665555443332223333333332   1111110     


Q ss_pred             CcchhhhhhccCCCCCceEEEEe
Q 042296          706 HVGDAKEAQLDKKKNLKVLLLQW  728 (1446)
Q Consensus       706 ~~~~~~~~~l~~~~~L~~L~l~~  728 (1446)
                      .........+..+.+|+.|.+..
T Consensus       704 ~~~~~~~~~~~~l~~L~~L~i~~  726 (889)
T KOG4658|consen  704 CSKRTLISSLGSLGNLEELSILD  726 (889)
T ss_pred             cccceeecccccccCcceEEEEc
Confidence            11122333455566677776654

>PLN03210 Resistant to P	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>COG3903 Predicted ATPase [General function prediction only]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PRK09376 rho transcription termination factor Rho; Provisional	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>TIGR00767 rho transcription termination factor Rho	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>COG3899 Predicted ATPase [General function prediction only]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08118 topology modulation protein; Reviewed	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair]	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF14516 AAA_35: AAA-like domain	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK12608 transcription termination factor Rho; Provisional	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>PTZ00202 tuzin; Provisional	Back alignment and domain information

>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP	Back alignment and domain information

>PRK09361 radB DNA repair and recombination protein RadB; Provisional	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>PRK07261 topology modulation protein; Provisional	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B	Back alignment and domain information

>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51	Back alignment and domain information

>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK09354 recA recombinase A; Provisional	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK05541 adenylylsulfate kinase; Provisional	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>cd01394 radB RadB	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response []	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK04301 radA DNA repair and recombination protein RadA; Validated	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>PRK13695 putative NTPase; Provisional	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>TIGR00602 rad24 checkpoint protein rad24	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03187 meiotic recombination protein DMC1 homolog; Provisional	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>PLN03186 DNA repair protein RAD51 homolog; Provisional	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK08233 hypothetical protein; Provisional	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02239 recomb_RAD51 DNA repair protein RAD51	Back alignment and domain information

>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>TIGR00708 cobA cob(I)alamin adenosyltransferase	Back alignment and domain information

>PF05659 RPW8: Arabidopsis broad-spectrum mildew resistance protein RPW8; InterPro: IPR008808 This entry represents the RPW8 domain found in several broad-spectrum mildew resistance proteins from Arabidopsis thaliana and other dicots	Back alignment and domain information

>TIGR02236 recomb_radA DNA repair and recombination protein RadA	Back alignment and domain information

>PRK06762 hypothetical protein; Provisional	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>COG2842 Uncharacterized ATPase, putative transposase [General function prediction only]	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2	Back alignment and domain information

>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea	Back alignment and domain information

>PTZ00301 uridine kinase; Provisional	Back alignment and domain information

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>cd01125 repA Hexameric Replicative Helicase RepA	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II []	Back alignment and domain information

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00088 adenylate kinase 1; Provisional	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair]	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic	Back alignment and domain information

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway	Back alignment and domain information

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane	Back alignment and domain information

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PTZ00035 Rad51 protein; Provisional	Back alignment and domain information

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>TIGR02858 spore_III_AA stage III sporulation protein AA	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+)	Back alignment and domain information

>PRK06217 hypothetical protein; Validated	Back alignment and domain information

>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>PRK06002 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS)	Back alignment and domain information

>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PRK07132 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair]	Back alignment and domain information

>PTZ00185 ATPase alpha subunit; Provisional	Back alignment and domain information

>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family	Back alignment and domain information

>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP	Back alignment and domain information

>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK09280 F0F1 ATP synthase subunit beta; Validated	Back alignment and domain information

>PRK09519 recA DNA recombination protein RecA; Reviewed	Back alignment and domain information

>PRK03839 putative kinase; Provisional	Back alignment and domain information

>PRK00625 shikimate kinase; Provisional	Back alignment and domain information

>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5)	Back alignment and domain information

>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>PRK12597 F0F1 ATP synthase subunit beta; Provisional	Back alignment and domain information

>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair]	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate	Back alignment and domain information

>PF12061 DUF3542: Protein of unknown function (DUF3542); InterPro: IPR021929 R1 is a gene for resistance to late blight, the most destructive disease in potato cultivation worldwide	Back alignment and domain information

>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment	Back alignment and domain information

>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H	Back alignment and domain information

>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal	Back alignment and domain information

>PRK08972 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK08149 ATP synthase SpaL; Validated	Back alignment and domain information

>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH)	Back alignment and domain information

>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK07004 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes	Back alignment and domain information

>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals	Back alignment and domain information

>PRK05480 uridine/cytidine kinase; Provisional	Back alignment and domain information

>TIGR00235 udk uridine kinase	Back alignment and domain information

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily	Back alignment and domain information

>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family	Back alignment and domain information

>cd01878 HflX HflX subfamily	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>TIGR00554 panK_bact pantothenate kinase, bacterial type	Back alignment and domain information

>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>PRK04328 hypothetical protein; Provisional	Back alignment and domain information

>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C	Back alignment and domain information

>PRK00889 adenylylsulfate kinase; Provisional	Back alignment and domain information

>PRK06547 hypothetical protein; Provisional	Back alignment and domain information

>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes	Back alignment and domain information

>TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit	Back alignment and domain information

>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK13947 shikimate kinase; Provisional	Back alignment and domain information

>cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A	Back alignment and domain information

>PRK06696 uridine kinase; Validated	Back alignment and domain information

>PRK00279 adk adenylate kinase; Reviewed	Back alignment and domain information

>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta	Back alignment and domain information

>PRK10733 hflB ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>PRK05439 pantothenate kinase; Provisional	Back alignment and domain information

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05973 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK08927 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>PRK04040 adenylate kinase; Provisional	Back alignment and domain information

>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor	Back alignment and domain information

>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU)	Back alignment and domain information

>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK07667 uridine kinase; Provisional	Back alignment and domain information

>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain	Back alignment and domain information

>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism]	Back alignment and domain information

>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13949 shikimate kinase; Provisional	Back alignment and domain information

>PRK09099 type III secretion system ATPase; Provisional	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family	Back alignment and domain information

>PRK05922 type III secretion system ATPase; Validated	Back alignment and domain information

>PRK12678 transcription termination factor Rho; Provisional	Back alignment and domain information

>PRK13543 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A	Back alignment and domain information

>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI	Back alignment and domain information

>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed	Back alignment and domain information

>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein	Back alignment and domain information

>PRK06904 replicative DNA helicase; Validated	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes	Back alignment and domain information

>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK06793 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component	Back alignment and domain information

>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ]	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK07594 type III secretion system ATPase SsaN; Validated	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>PRK00131 aroK shikimate kinase; Reviewed	Back alignment and domain information

>TIGR01069 mutS2 MutS2 family protein	Back alignment and domain information

>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit	Back alignment and domain information

>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>PRK15453 phosphoribulokinase; Provisional	Back alignment and domain information

>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants	Back alignment and domain information

>PRK06936 type III secretion system ATPase; Provisional	Back alignment and domain information

>PRK10875 recD exonuclease V subunit alpha; Provisional	Back alignment and domain information

>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity	Back alignment and domain information

>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch	Back alignment and domain information

>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2	Back alignment and domain information

>TIGR01039 atpD ATP synthase, F1 beta subunit	Back alignment and domain information

>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases	Back alignment and domain information

>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha	Back alignment and domain information

>TIGR00416 sms DNA repair protein RadA	Back alignment and domain information

>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor	Back alignment and domain information

>TIGR02902 spore_lonB ATP-dependent protease LonB	Back alignment and domain information

>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01447 recD exodeoxyribonuclease V, alpha subunit	Back alignment and domain information

>PRK13948 shikimate kinase; Provisional	Back alignment and domain information

>PRK05636 replicative DNA helicase; Provisional	Back alignment and domain information

>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT)	Back alignment and domain information

>PRK13946 shikimate kinase; Provisional	Back alignment and domain information

>cd00984 DnaB_C DnaB helicase C terminal domain	Back alignment and domain information

>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10078 ribose 1,5-bisphosphokinase; Provisional	Back alignment and domain information

>PRK05057 aroK shikimate kinase I; Reviewed	Back alignment and domain information

>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms]	Back alignment and domain information

>PRK14530 adenylate kinase; Provisional	Back alignment and domain information

>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated	Back alignment and domain information

>PLN02796 D-glycerate 3-kinase	Back alignment and domain information

>TIGR03263 guanyl_kin guanylate kinase	Back alignment and domain information

>PRK08472 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family	Back alignment and domain information

>TIGR01420 pilT_fam pilus retraction protein PilT	Back alignment and domain information

>PRK07721 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>COG4639 Predicted kinase [General function prediction only]	Back alignment and domain information

>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI	Back alignment and domain information

>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only]	Back alignment and domain information

>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional	Back alignment and domain information

>PF13479 AAA_24: AAA domain	Back alignment and domain information

>PRK07196 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork	Back alignment and domain information

>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor	Back alignment and domain information

>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>PRK05688 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional	Back alignment and domain information

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		1446
1z6t_A		591	Structure Of The Apoptotic Protease-activating Fact		1e-04
3iza_B		1263	Structure Of An Apoptosome-Procaspase-9 Card Comple		2e-04

>pdb|1Z6T|A Chain A, Structure Of The Apoptotic Protease-activating Factor 1 Bound To Adp Length = 591

Back alignment and structure

Iteration: 1

Score = 46.2 bits (108), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 54/232 (23%), Positives = 99/232 (42%), Gaps = 43/232 (18%) Query: 272 DDVWNENYNDWIDLSRPFEAGAPGSKIVVTTRNQAVV-AIMGTVPAYPLKE-LSDEDCLN 329 DDVW+ W+ +A +I++TTR+++V ++MG P++ L E L Sbjct: 243 DDVWDS----WV-----LKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLE 293 Query: 330 VFTQHSLGTRDFNMHKS-LEEIGKKIVIKCNGLPLAAKTLGGLLRG----------KTDQ 378 + + NM K+ L E I+ +C G PL +G LLR + Sbjct: 294 ILSLF------VNMKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQN 347 Query: 379 RDWEDVLNCKIWDLPEERCDILPALKVSYYYLSPRLKQCFTYCSLLPKDYEFKEEEIILL 438 + ++ + +D E D A+ +S L +K +T S+L KD + + + +L Sbjct: 348 KQFKRIRKSSSYDY--EALD--EAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCIL 403 Query: 439 WIAVGFLDQEDNGRESEDLGHMFFKELHSRSLFQKSSNDTLRFVMHDLVNDL 490 W E+E++ + + ++ LF + + R+ +HDL D Sbjct: 404 W-----------DMETEEVEDILQEFVNKSLLFCDRNGKSFRYYLHDLQVDF 444

PyMOL of 1z6t

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		1446
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	1e-113
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	3e-89
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-59
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-20
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-12
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-05
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	6e-22
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	7e-19
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	8e-19
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	4e-16
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-15
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-15
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-11
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	4e-11
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-10
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	5e-09
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	5e-07
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-15
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	5e-14
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-12
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	7e-11
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-04
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	7e-13
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	8e-13
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	5e-10
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-09
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-04
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	4e-04
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-12
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	9e-08
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-04
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-11
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	9e-10
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-06
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	7e-06
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-05
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-11
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	8e-10
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	4e-07
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	4e-09
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	8e-09
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	8e-09
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-08
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-06
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	5e-06
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	9e-06
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-05
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-05
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	4e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-08
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	6e-06
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	7e-06
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-04
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-04
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-08
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-06
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	5e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-08
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	4e-04
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-08
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	3e-08
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	3e-06
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	4e-06
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-05
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	4e-05
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	9e-08
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	3e-07
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	8e-05
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	4e-04
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	4e-04
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	1e-07
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	6e-04
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-07
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-07
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-06
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-04
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-04
3qfl_A		115	MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-	2e-07
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	3e-07
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	3e-07
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-06
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	6e-07
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-06
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-05
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-04
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	8e-07
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-06
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	8e-04
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	3e-06
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-06
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	4e-06
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	6e-04
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	5e-06
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	3e-05
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	1e-04
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	1e-04
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	6e-06
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	1e-05
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	8e-05
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	2e-04
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	1e-05
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	2e-05
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	8e-04
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-05
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	5e-04
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	3e-05
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	3e-05
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	8e-04
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	7e-05
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	4e-04
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	7e-05
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	9e-05
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-04
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-04
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-04
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-04
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-04
3e6j_A		229	Variable lymphocyte receptor diversity region; var	3e-04
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	7e-04

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591	Back alignment and structure

 Score =  367 bits (944), Expect = e-113
 Identities = 94/609 (15%), Positives = 195/609 (32%), Gaps = 103/609 (16%)

Query: 56  DERQRTDKSVKLWLGELQNLAYDVEDLLDEFETEALGRKLLLGDGESDAANDDQPSSSTG 115
           D + R +  ++      +++      ++D   ++              +  +   +  T 
Sbjct: 2   DAKAR-NCLLQHREALEKDI--KTSYIMDHMISDGFLT---------ISEEEKVRNEPTQ 49

Query: 116 TSIFRKLIPTCCTTFTPRSIKFDYTIM-SKIKEINARFQDIVSQKDLLDFKENSVGRSRK 174
                 LI           + F   ++    K++ A   D +        K++  G +  
Sbjct: 50  QQRAAMLIKMILKKDNDSYVSFYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSGITSY 109

Query: 175 VRQRRETTSLVNEAKVY---------------------------GMGGLGKTTLAQLVYN 207
           VR       +     V+                           GM G GK+ LA     
Sbjct: 110 VRTVLCEGGVPQRPVVFVTRKKLVNAIQQKLSKLKGEPGWVTIHGMAGCGKSVLAAEAVR 169

Query: 208 DARLQDHF--DLKAWTCVSEDFDITRITK--SILNSIG---TDQNVDSLDFDKLQVELKK 260
           D  L +        W  V +      + K  ++   +    +      L+ ++ +  L+ 
Sbjct: 170 DHSLLEGCFPGGVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRI 229

Query: 261 QLSQK--KFLLVLDDVWNENYNDWIDLSRPFEAGAPGSKIVVTTRNQAVV-AIMGTVPAY 317
            + +K  + LL+LDDVW+                    +I++TTR+++V  ++MG     
Sbjct: 230 LMLRKHPRSLLILDDVWDSWVLKA---------FDSQCQILLTTRDKSVTDSVMGPKYVV 280

Query: 318 PL-KELSDEDCLNVFTQHSLGTRDFNMHKSLEEIGKKIVIKCNGLPLAAKTLGGLLRGKT 376
           P+   L  E  L + +              L E    I+ +C G PL    +G LLR   
Sbjct: 281 PVESSLGKEKGLEILSLFV-----NMKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFP 335

Query: 377 DQ-RDWEDVLNCKIWDLPE-----ERCDILPALKVSYYYLSPRLKQCFTYCSLLPKDYEF 430
           ++   +   L  K +         +   +  A+ +S   L   +K  +T  S+L KD + 
Sbjct: 336 NRWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKV 395

Query: 431 KEEEIILLWIAVGFLDQEDNGRESEDLGHMFFKELHSRSLFQKSSND-TLRFVMHDLVND 489
             + + +LW                +      +E  ++SL     N  + R+ +HDL  D
Sbjct: 396 PTKVLCILWDM------------ETEEVEDILQEFVNKSLLFCDRNGKSFRYYLHDLQVD 443

Query: 490 LAQWAAGNIYLRMEDAPGGNKQQRFSKSLRHLSYIPGGHDGVKRFADFDD-TEHL----- 543
                      +++D      ++  ++  R+        D       ++    H+     
Sbjct: 444 FLT---EKNCSQLQD----LHKKIITQFQRYHQPHTLSPDQEDCMYWYNFLAYHMASAKM 496

Query: 544 -RTFLPVMLSNCWGGYLAYSILQRLLKLHRLKVFSLCGYQISELPNSVGDLRYLRYLNLS 602
            +    +M S  W           L+    L    +    I +  +      +  +L+L+
Sbjct: 497 HKELCALMFSLDW-----IKAKTELVGPAHLIHEFVEYRHILDEKDCAVSENFQEFLSLN 551

Query: 603 RTCIEILPD 611
              +   P 
Sbjct: 552 GHLLGRQPF 560

PyMOL of 1z6t

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Length = 115	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		1446
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.98
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	99.98
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.98
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	99.97
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.96
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.96
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.96
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.96
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.95
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.95
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.95
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.95
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.95
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.94
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.93
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.93
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.92
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.92
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.92
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.91
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.91
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.89
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.88
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.87
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.87
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.86
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.85
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.84
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.83
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.83
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.82
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.82
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.81
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.8
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.8
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.8
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.79
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.77
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.76
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.76
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.75
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.69
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.69
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.69
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.69
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.67
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.67
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.66
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.66
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.64
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.64
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.63
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.63
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.63
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.63
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.61
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.59
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.57
3qfl_A		115	MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-	99.57
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.57
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.57
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.57
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.56
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.54
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.54
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.54
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.53
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.53
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.52
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.52
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.52
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.51
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.5
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.5
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.49
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.48
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.47
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.44
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.43
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.43
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.4
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.39
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.38
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.38
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.37
1w5s_A		412	Origin recognition complex subunit 2 ORC2; replica	99.35
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.34
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.32
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.31
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.31
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.3
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.29
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.29
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.28
2qen_A		350	Walker-type ATPase; unknown function; HET: ADP; 2.	99.26
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.25
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.24
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.23
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.23
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.21
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.2
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.18
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.18
2fna_A		357	Conserved hypothetical protein; structural genomic	99.17
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.17
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.13
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.13
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.13
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.12
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.11
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.05
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.04
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.04
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.03
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.01
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.01
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.99
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	98.99
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	98.98
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	98.98
2qby_B		384	CDC6 homolog 3, cell division control protein 6 ho	98.97
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	98.96
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.95
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	98.95
2v1u_A		387	Cell division control protein 6 homolog; DNA repli	98.95
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	98.92
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	98.91
1fnn_A		389	CDC6P, cell division control protein 6; ORC1, AAA	98.9
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	98.9
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	98.87
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.85
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.84
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.79
2qby_A		386	CDC6 homolog 1, cell division control protein 6 ho	98.79
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.77
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.76
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.74
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	98.72
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.72
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.7
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	98.7
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.67
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.62
1njg_A		250	DNA polymerase III subunit gamma; rossman-like fol	98.6
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.5
2chg_A		226	Replication factor C small subunit; DNA-binding pr	98.46
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.27
1hqc_A		324	RUVB; extended AAA-ATPase domain, complex with nuc	98.22
1sxj_B		323	Activator 1 37 kDa subunit; clamp loader, processi	98.2
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.16
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.12
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.09
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	97.89
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	97.81
2z4s_A		440	Chromosomal replication initiator protein DNAA; AA	97.8
1iqp_A		327	RFCS; clamp loader, extended AAA-ATPase domain, co	97.76
3te6_A		318	Regulatory protein SIR3; heterochromatin, gene sil	97.72
3bos_A		242	Putative DNA replication factor; P-loop containing	97.65
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.64
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.61
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.59
1jr3_A		373	DNA polymerase III subunit gamma; processivity, pr	97.56
2chq_A		319	Replication factor C small subunit; DNA-binding pr	97.53
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.51
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.51
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.45
1a5t_A		334	Delta prime, HOLB; zinc finger, DNA replication; 2	97.38
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	97.27
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.25
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	97.24
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	97.23
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.22
1l8q_A		324	Chromosomal replication initiator protein DNAA; AA	97.14
3pfi_A		338	Holliday junction ATP-dependent DNA helicase RUVB;	97.09
1sxj_D		353	Activator 1 41 kDa subunit; clamp loader, processi	97.07
2w58_A		202	DNAI, primosome component (helicase loader); ATP-b	97.04
3ec2_A		180	DNA replication protein DNAC; helicase loader, rep	96.99
1sxj_E		354	Activator 1 40 kDa subunit; clamp loader, processi	96.94
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	96.93
3pvs_A		447	Replication-associated recombination protein A; ma	96.92
3syl_A		309	Protein CBBX; photosynthesis, rubisco activase, AA	96.92
2qz4_A		262	Paraplegin; AAA+, SPG7, protease, ADP, structural	96.91
1d2n_A		272	N-ethylmaleimide-sensitive fusion protein; hexamer	96.91
3h4m_A		285	Proteasome-activating nucleotidase; ATPase, PAN, A	96.89
1sxj_A		516	Activator 1 95 kDa subunit; clamp loader, processi	96.83
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	96.8
2qp9_X		355	Vacuolar protein sorting-associated protein 4; ATP	96.72
1xwi_A		322	SKD1 protein; VPS4B, AAA ATPase, protein transport	96.7
1jbk_A		195	CLPB protein; beta barrel, chaperone; 1.80A {Esche	96.67
3uk6_A		368	RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding	96.62
2kjq_A		149	DNAA-related protein; solution structure, NESG, st	96.58
3eie_A		322	Vacuolar protein sorting-associated protein 4; AAA	96.52
2gno_A		305	DNA polymerase III, gamma subunit-related protein;	96.49
1sxj_C		340	Activator 1 40 kDa subunit; clamp loader, processi	96.32
3n70_A		145	Transport activator; sigma-54, ntpase, PSI, MCSG,	96.26
2zan_A		444	Vacuolar protein sorting-associating protein 4B; S	96.19
3u61_B		324	DNA polymerase accessory protein 44; AAA+, ATP hyd	96.06
3cf0_A		301	Transitional endoplasmic reticulum ATPase; AAA, P9	95.95
3b9p_A		297	CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc	95.93
3d8b_A		357	Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s	95.93
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	95.75
2cvh_A		220	DNA repair and recombination protein RADB; filamen	95.74
2vhj_A		331	Ntpase P4, P4; non- hydrolysable ATP analogue, hyd	95.72
4b4t_J		405	26S protease regulatory subunit 8 homolog; hydrola	95.71
3co5_A		143	Putative two-component system transcriptional RES	95.59
3vfd_A		389	Spastin; ATPase, microtubule severing, hydrolase;	95.12
2qgz_A		308	Helicase loader, putative primosome component; str	95.05
4fcw_A		311	Chaperone protein CLPB; AAA domain; HET: ADP; 2.35	95.0
1g5t_A		196	COB(I)alamin adenosyltransferase; P-loop protein,	94.99
3io5_A		333	Recombination and repair protein; storage dimer, i	94.98
4b4t_K		428	26S protease regulatory subunit 6B homolog; hydrol	94.87
3hr8_A		356	Protein RECA; alpha and beta proteins (A/B, A+B),	94.82
1lv7_A		257	FTSH; alpha/beta domain, four helix bundle, hydrol	94.73
2bjv_A		265	PSP operon transcriptional activator; AAA, transcr	94.7
1xp8_A		366	RECA protein, recombinase A; recombination, radior	94.63
4b4t_H		467	26S protease regulatory subunit 7 homolog; hydrola	94.62
2p65_A		187	Hypothetical protein PF08_0063; CLPB, malaria, str	94.61
2r62_A		268	Cell division protease FTSH homolog; ATPase domain	94.46
1in4_A		334	RUVB, holliday junction DNA helicase RUVB; AAA+-cl	94.38
3hu3_A		489	Transitional endoplasmic reticulum ATPase; VCP, tr	94.35
2ce7_A		476	Cell division protein FTSH; metalloprotease; HET:	94.2
4b4t_L		437	26S protease subunit RPT4; hydrolase, AAA-atpases,	94.14
1ojl_A		304	Transcriptional regulatory protein ZRAR; response	94.12
2b8t_A		223	Thymidine kinase; deoxyribonucleoside kinase, zinc	94.07
4b4t_I		437	26S protease regulatory subunit 4 homolog; hydrola	93.89
2zr9_A		349	Protein RECA, recombinase A; recombination, RECA m	93.85
3pxi_A		758	Negative regulator of genetic competence CLPC/MEC;	93.82
1ofh_A		310	ATP-dependent HSL protease ATP-binding subunit HSL	93.78
1v5w_A		343	DMC1, meiotic recombination protein DMC1/LIM15 hom	93.69
1u94_A		356	RECA protein, recombinase A; homologous recombinat	93.66
2z43_A		324	DNA repair and recombination protein RADA; archaea	93.5
1n0w_A		243	DNA repair protein RAD51 homolog 1; DNA repair, ho	93.46
3m6a_A		543	ATP-dependent protease LA 1; alpha, beta, ATP-bind	93.43
2c9o_A		456	RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-	93.34
2x8a_A		274	Nuclear valosin-containing protein-like; nuclear p	93.32
2i1q_A		322	DNA repair and recombination protein RADA; ATPase,	92.91
2w0m_A		235	SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus	92.7
1qvr_A		854	CLPB protein; coiled coil, AAA ATPase, chaperone;	92.59
3pxg_A		468	Negative regulator of genetic competence CLPC/MEC;	92.43
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	92.29
3dm5_A		443	SRP54, signal recognition 54 kDa protein; protein-	92.28
1jr3_D		343	DNA polymerase III, delta subunit; processivity, p	91.84
2dhr_A		499	FTSH; AAA+ protein, hexameric Zn metalloprotease,	91.7
1r6b_X		758	CLPA protein; AAA+, N-terminal domain, CLPS, cryst	91.59
3t15_A		293	Ribulose bisphosphate carboxylase/oxygenase activ	91.56
2r44_A		331	Uncharacterized protein; putative ATPase, structur	91.45
3cf2_A		806	TER ATPase, transitional endoplasmic reticulum ATP	91.39
2px0_A		296	Flagellar biosynthesis protein FLHF; SRP GTPase, f	91.36
3bh0_A		315	DNAB-like replicative helicase; ATPase, replicatio	90.77
3lda_A		400	DNA repair protein RAD51; DNA binding protein, ATP	89.84
1r6b_X		758	CLPA protein; AAA+, N-terminal domain, CLPS, cryst	89.71
1qvr_A		854	CLPB protein; coiled coil, AAA ATPase, chaperone;	89.3
4a74_A		231	DNA repair and recombination protein RADA; hydrola	89.19
4b4t_M		434	26S protease regulatory subunit 6A; hydrolase, AAA	89.11
1sky_E		473	F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp	89.08
1qhx_A		178	CPT, protein (chloramphenicol phosphotransferase);	89.0
3pxi_A		758	Negative regulator of genetic competence CLPC/MEC;	88.9
4a1f_A		338	DNAB helicase, replicative DNA helicase; hydrolase	88.83
3ice_A		422	Transcription termination factor RHO; transcriptio	88.72
1pzn_A		349	RAD51, DNA repair and recombination protein RAD51,	88.7
3kb2_A		173	SPBC2 prophage-derived uncharacterized protein YOR	88.64
3lw7_A		179	Adenylate kinase related protein (ADKA-like); AMP,	88.5
1odf_A		290	YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser	88.31
1ex7_A		186	Guanylate kinase; substrate-induced FIT, domain mo	88.24
3vaa_A		199	Shikimate kinase, SK; structural genomics, center	87.97
1zp6_A		191	Hypothetical protein ATU3015; alpha-beta protein.,	87.82
1kag_A		173	SKI, shikimate kinase I; transferase, structural g	87.8
1ly1_A		181	Polynucleotide kinase; PNK, phosphatase, transfera	87.3
3trf_A		185	Shikimate kinase, SK; amino acid biosynthesis, tra	87.26
2ffh_A		425	Protein (FFH); SRP54, signal recognition particle,	87.18
3cmu_A		2050	Protein RECA, recombinase A; homologous recombinat	87.11
1fx0_B		498	ATP synthase beta chain; latent ATPase, thermal st	87.08
2ck3_D		482	ATP synthase subunit beta\, mitochondrial; hydrola	86.89
1kgd_A		180	CASK, peripheral plasma membrane CASK; maguk, guan	86.88
1vma_A		306	Cell division protein FTSY; TM0570, structural gen	86.82
1ypw_A		806	Transitional endoplasmic reticulum ATPase; AAA, P9	86.56
3t61_A		202	Gluconokinase; PSI-biology, structural genomics, p	86.49
2orw_A		184	Thymidine kinase; TMTK, TP4A, transferase; HET: 4T	86.49
1via_A		175	Shikimate kinase; structural genomics, transferase	86.34
3iij_A		180	Coilin-interacting nuclear ATPase protein; alpha a	86.19
3uie_A		200	Adenylyl-sulfate kinase 1, chloroplastic; rossmann	85.93
1zuh_A		168	Shikimate kinase; alpha-beta protein, transferase;	85.88
1kht_A		192	Adenylate kinase; phosphotransferase, signaling pr	85.82
1ye8_A		178	Protein THEP1, hypothetical UPF0334 kinase-like pr	85.64
2jaq_A		205	Deoxyguanosine kinase; transferase, deoxyribonucle	85.62
1nks_A		194	Adenylate kinase; thermophilic, transferase; HET:	85.61
1y63_A		184	LMAJ004144AAA protein; structural genomics, protei	85.53
1knq_A		175	Gluconate kinase; ALFA/beta structure, transferase	85.52
4eun_A		200	Thermoresistant glucokinase; putative sugar kinase	85.49
2iyv_A		184	Shikimate kinase, SK; transferase, aromatic amino	85.33
2qor_A		204	Guanylate kinase; phosphotransferase, purine metab	85.3
4gp7_A		171	Metallophosphoesterase; polynucleotide kinase phos	85.2
1j8m_F		297	SRP54, signal recognition 54 kDa protein; signalin	85.19
2rhm_A		193	Putative kinase; P-loop containing nucleoside trip	85.09
3a00_A		186	Guanylate kinase, GMP kinase; domain movement, dim	85.07
1xjc_A		169	MOBB protein homolog; structural genomics, midwest	85.06
2bdt_A		189	BH3686; alpha-beta protein, structural genomics, P	84.96
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	84.92
2if2_A		204	Dephospho-COA kinase; alpha-beta protein, structur	84.92
3c8u_A		208	Fructokinase; YP_612366.1, putative fructose trans	84.68
3tr0_A		205	Guanylate kinase, GMP kinase; purines, pyrimidines	84.66
3cm0_A		186	Adenylate kinase; ATP-binding, cytoplasm, nucleoti	84.57
2pt5_A		168	Shikimate kinase, SK; aromatic amino acid biosynth	84.51
1e6c_A		173	Shikimate kinase; phosphoryl transfer, ADP, shikim	84.49
2z0h_A		197	DTMP kinase, thymidylate kinase; ATP-binding, nucl	84.26
2ze6_A		253	Isopentenyl transferase; crown GALL tumor, cytokin	84.24
1lvg_A		198	Guanylate kinase, GMP kinase; transferase; HET: AD	84.2
1jjv_A		206	Dephospho-COA kinase; P-loop nucleotide-binding fo	84.18
1ls1_A		295	Signal recognition particle protein; FFH, SRP54, S	84.17
2yvu_A		186	Probable adenylyl-sulfate kinase; transferase, str	84.07
2qt1_A		207	Nicotinamide riboside kinase 1; non-protein kinase	84.06
3l0o_A		427	Transcription termination factor RHO; helicase, RH	83.87
3fwy_A		314	Light-independent protochlorophyllide reductase I	83.87
1tev_A		196	UMP-CMP kinase; ploop, NMP binding region, LID reg	83.85
2j41_A		207	Guanylate kinase; GMP, GMK, transferase, ATP-bindi	83.73
2cdn_A		201	Adenylate kinase; phosphoryl transfer, associative	83.6
2grj_A		192	Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp	83.59
3tau_A		208	Guanylate kinase, GMP kinase; structural genomics,	83.58
2c95_A		196	Adenylate kinase 1; transferase, AP4A, nucleotide	83.52
1cke_A		227	CK, MSSA, protein (cytidine monophosphate kinase);	83.5
3a4m_A		260	L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m	83.5
2bwj_A		199	Adenylate kinase 5; phosphoryl transfer reaction,	83.43
3asz_A		211	Uridine kinase; cytidine phosphorylation, transfer	83.18
2xxa_A		433	Signal recognition particle protein; protein trans	83.15
3jvv_A		356	Twitching mobility protein; hexameric P-loop ATPas	83.13
2qe7_A		502	ATP synthase subunit alpha; blockage of ATP hydrol	83.0
2pbr_A		195	DTMP kinase, thymidylate kinase; transferase, nucl	82.92
2bbw_A		246	Adenylate kinase 4, AK4; nucleotide kinase, nucleo	82.84
2plr_A		213	DTMP kinase, probable thymidylate kinase; TMP-bind	82.8
3kl4_A		433	SRP54, signal recognition 54 kDa protein; signal r	82.75
1nn5_A		215	Similar to deoxythymidylate kinase (thymidylate K;	82.74
1z6g_A		218	Guanylate kinase; structural genomics, SGC, struct	82.61
2vli_A		183	Antibiotic resistance protein; transferase, tunica	82.52
3mfy_A		588	V-type ATP synthase alpha chain; A-type ATP syntha	82.51
1ukz_A		203	Uridylate kinase; transferase; HET: ADP AMP; 1.90A	82.5
3fb4_A		216	Adenylate kinase; psychrophIle, phosphotransferase	82.38
3hjn_A		197	DTMP kinase, thymidylate kinase; ATP-binding, nucl	82.27
1aky_A		220	Adenylate kinase; ATP:AMP phosphotransferase, myok	82.27
1htw_A		158	HI0065; nucleotide-binding fold, structural genomi	82.22
1znw_A		207	Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans	82.21
1q57_A		503	DNA primase/helicase; dntpase, DNA replication, tr	82.15
3ney_A		197	55 kDa erythrocyte membrane protein; structural ge	82.15
3dl0_A		216	Adenylate kinase; phosphotransferase, zinc coordin	82.15
3nwj_A		250	ATSK2; P loop, shikimate, nucleoside monophosphate	82.12
1qf9_A		194	UMP/CMP kinase, protein (uridylmonophosphate/cytid	82.05
3gqb_B		464	V-type ATP synthase beta chain; A3B3, V-ATPase, AT	82.02
1ixz_A		254	ATP-dependent metalloprotease FTSH; AAA domain fol	82.0
1zd8_A		227	GTP:AMP phosphotransferase mitochondrial; ATP:AMP	82.0
1rz3_A		201	Hypothetical protein rbstp0775; MCSG, structural g	81.88
3cmw_A		1706	Protein RECA, recombinase A; homologous recombinat	81.88
3cmw_A		1706	Protein RECA, recombinase A; homologous recombinat	81.68
2i3b_A		189	HCR-ntpase, human cancer-related ntpase; AAA, ross	81.65
3aez_A		312	Pantothenate kinase; transferase, homodimer, COA b	81.43
2wwf_A		212	Thymidilate kinase, putative; transferase, malaria	81.39
1uf9_A		203	TT1252 protein; P-loop, nucleotide binding domain,	81.36
1zak_A		222	Adenylate kinase; ATP:AMP-phosphotransferase, tran	81.24
2f1r_A		171	Molybdopterin-guanine dinucleotide biosynthesis pr	81.14
4e22_A		252	Cytidylate kinase; P-loop, CMP/ATP binding, transf	81.1
3llm_A		235	ATP-dependent RNA helicase A; alpha-beta-alpha, st	81.07
2r6a_A		454	DNAB helicase, replicative helicase; replication,	81.03
3vr4_D		465	V-type sodium ATPase subunit D; V-ATPase, rotary m	80.96
1tue_A		212	Replication protein E1; helicase, replication, E1E	80.87
3e70_C		328	DPA, signal recognition particle receptor; FTSY, S	80.8
2v54_A		204	DTMP kinase, thymidylate kinase; nucleotide biosyn	80.75
2pez_A		179	Bifunctional 3'-phosphoadenosine 5'- phosphosulfat	80.7
2jeo_A		245	Uridine-cytidine kinase 1; UCK, transferase, ATP-b	80.6
2q6t_A		444	DNAB replication FORK helicase; hydrolase; 2.90A {	80.5
1uj2_A		252	Uridine-cytidine kinase 2; alpha/beta mononucleoti	80.44
1e4v_A		214	Adenylate kinase; transferase(phosphotransferase);	80.17
1fx0_A		507	ATP synthase alpha chain; latent ATPase, thermal s	80.16
1s96_A		219	Guanylate kinase, GMP kinase; E.coli, dimer, SAD,	80.04

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

Probab=100.00  E-value=8.8e-47  Score=489.10  Aligned_cols=271  Identities=11%  Similarity=0.006  Sum_probs=178.1

Q ss_pred             cCCceeecccCcccccccCCCCccccceeeeccCCCchhhhhhhcCCCCccEEEeccccCccccCccCCCCCcccEEEEe
Q 042296         1161 SLEHLEVGICSKLKFLSCSGNLPQALKFICVFRCSKLESIAERLDNNTSLEVFKIGCCDNLKILPGGLHKLRHLQEVGIW 1240 (1446)
Q Consensus      1161 ~L~~L~l~~c~~L~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~l~~L~~L~l~~~~~~~~lp~~~~~l~~L~~L~l~ 1240 (1446)
                      +|+.|++++|.....+|.....+++|+.|++++|...+.+|..+..+++|+.|++++|...+.+|..++++++|++|+++
T Consensus       467 ~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls  546 (768)
T 3rgz_A          467 TLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLN  546 (768)
T ss_dssp             TCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECC
T ss_pred             CceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECC
Confidence            34444444443333444444456778888888888777888888888888888888888888888888888888888888


Q ss_pred             ccCCCcccCCCCCCcccccceecccccCcccc----------------------ccc---CCccceEeeCCCCCcccccc
Q 042296         1241 SCGNLVSFPEGGLPSANLTKLQITWCDKLEAL----------------------PEG---MNSLRELNIGGLASMVCFPV 1295 (1446)
Q Consensus      1241 ~c~~l~~lp~~~~~~~~L~~L~l~~c~~l~~l----------------------p~~---l~~L~~L~l~~c~~l~~~~~ 1295 (1446)
                      +|+..+.+|..++....+..+.+.....+..+                      +..   +..+..+++..+..-+.+|.
T Consensus       547 ~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~  626 (768)
T 3rgz_A          547 TNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSP  626 (768)
T ss_dssp             SSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCC
T ss_pred             CCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCch
Confidence            88777788877776655555544432211111                      111   11122222222111122222


Q ss_pred             cCcCCCCCCCcceEEEccCCCcchhhhcccCccCCCCCcceeeecCcCCccccCcccccCCCcccccceecccccCCccC
Q 042296         1296 EADGAMFPSNLQSLDIHDTKIWKSLMEWGEGGLNRFSSLQRLSIGGLHDVVSFSPQELGTTLPASLTHLWIYDFQNLECL 1375 (1446)
Q Consensus      1296 ~~~~~~~~~~L~~L~l~~~~~~~~l~~~~~~~l~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~~L~~L~~~~~~~l~~l 1375 (1446)
                      .   +...++|+.|++++|...+.++.    .+.++++|+.|++++|.-...+|..-   .-.++|++|++++|+..+.+
T Consensus       627 ~---~~~l~~L~~LdLs~N~l~g~ip~----~l~~l~~L~~L~Ls~N~l~g~ip~~l---~~L~~L~~LdLs~N~l~g~i  696 (768)
T 3rgz_A          627 T---FDNNGSMMFLDMSYNMLSGYIPK----EIGSMPYLFILNLGHNDISGSIPDEV---GDLRGLNILDLSSNKLDGRI  696 (768)
T ss_dssp             S---CSSSBCCCEEECCSSCCBSCCCG----GGGGCTTCCEEECCSSCCCSCCCGGG---GGCTTCCEEECCSSCCEECC
T ss_pred             h---hhccccccEEECcCCcccccCCH----HHhccccCCEEeCcCCccCCCCChHH---hCCCCCCEEECCCCcccCcC
Confidence            2   22456899999999997666554    38899999999999987666776532   22468999999999888899


Q ss_pred             ccCCCCCCCcceeecccCCCccccCCCCCCCccceEeccCCchhH----HhhccCCCCccccccccCeee
Q 042296         1376 SSVGQNLTSLVYLWLYACPKLKYFSDKGLPTSLLQLYIKDCPLIE----EKCRKDQGQYWHLLTHIPDVR 1441 (1446)
Q Consensus      1376 ~~~~~~l~~L~~L~l~~c~~l~~l~~~~~~~sL~~L~i~~c~~L~----~~~~~~~g~~~~~~~~~~~~~ 1441 (1446)
                      |..+.++++|++|++++|+--..+|..+...++....+.++|.|.    ..|..+.+++|++|+|+|.+.
T Consensus       697 p~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~~C~~~~~~~~~~~~~~~~~~  766 (768)
T 3rgz_A          697 PQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQRSHHHH  766 (768)
T ss_dssp             CGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSCCCCSCC--------------
T ss_pred             ChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCcCCCCCccCCCCCCCCccccC
Confidence            999999999999999998877889988777777777777766432    279999999999999999864

PyMOL of 3rgz

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A*	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C*	Back alignment and structure

>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A*	Back alignment and structure

>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B*	Back alignment and structure

>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E*	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A*	Back alignment and structure

>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp}	Back alignment and structure

>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426}	Back alignment and structure

>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A*	Back alignment and structure

>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli}	Back alignment and structure

>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A*	Back alignment and structure

>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens}	Back alignment and structure

>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A*	Back alignment and structure

>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii}	Back alignment and structure

>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A*	Back alignment and structure

>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens}	Back alignment and structure

>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D*	Back alignment and structure

>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B}	Back alignment and structure

>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C	Back alignment and structure

>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli}	Back alignment and structure

>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A	Back alignment and structure

>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B*	Back alignment and structure

>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus}	Back alignment and structure

>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster}	Back alignment and structure

>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens}	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A*	Back alignment and structure

>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A*	Back alignment and structure

>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae}	Back alignment and structure

>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens}	Back alignment and structure

>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3}	Back alignment and structure

>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A*	Back alignment and structure

>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A*	Back alignment and structure

>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4}	Back alignment and structure

>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima}	Back alignment and structure

>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A*	Back alignment and structure

>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1	Back alignment and structure

>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum}	Back alignment and structure

>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A*	Back alignment and structure

>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A*	Back alignment and structure

>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A*	Back alignment and structure

>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E*	Back alignment and structure

>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium}	Back alignment and structure

>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A*	Back alignment and structure

>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ...	Back alignment and structure

>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis}	Back alignment and structure

>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A*	Back alignment and structure

>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A	Back alignment and structure

>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A	Back alignment and structure

>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A*	Back alignment and structure

>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11	Back alignment and structure

>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A	Back alignment and structure

>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A*	Back alignment and structure

>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens}	Back alignment and structure

>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A*	Back alignment and structure

>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2}	Back alignment and structure

>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20	Back alignment and structure

>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis}	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus}	Back alignment and structure

>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A*	Back alignment and structure

>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus}	Back alignment and structure

>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X*	Back alignment and structure

>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A	Back alignment and structure

>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406}	Back alignment and structure

>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A*	Back alignment and structure

>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A*	Back alignment and structure

>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1}	Back alignment and structure

>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A*	Back alignment and structure

>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X*	Back alignment and structure

>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20	Back alignment and structure

>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A*	Back alignment and structure

>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11	Back alignment and structure

>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A*	Back alignment and structure

>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis}	Back alignment and structure

>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori}	Back alignment and structure

>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A	Back alignment and structure

>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11	Back alignment and structure

>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A*	Back alignment and structure

>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A	Back alignment and structure

>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6	Back alignment and structure

>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A	Back alignment and structure

>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25	Back alignment and structure

>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2	Back alignment and structure

>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1	Back alignment and structure

>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii}	Back alignment and structure

>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A	Back alignment and structure

>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli}	Back alignment and structure

>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B*	Back alignment and structure

>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ...	Back alignment and structure

>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1	Back alignment and structure

>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10	Back alignment and structure

>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti}	Back alignment and structure

>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A*	Back alignment and structure

>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2	Back alignment and structure

>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A	Back alignment and structure

>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A*	Back alignment and structure

>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A*	Back alignment and structure

>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A	Back alignment and structure

>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11	Back alignment and structure

>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A*	Back alignment and structure

>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1	Back alignment and structure

>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1	Back alignment and structure

>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A*	Back alignment and structure

>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP}	Back alignment and structure

>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A*	Back alignment and structure

>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax}	Back alignment and structure

>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A*	Back alignment and structure

>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F	Back alignment and structure

>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus}	Back alignment and structure

>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10	Back alignment and structure

>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus}	Back alignment and structure

>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP}	Back alignment and structure

>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii}	Back alignment and structure

>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus}	Back alignment and structure

>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus}	Back alignment and structure

>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A*	Back alignment and structure

>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A	Back alignment and structure

>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1	Back alignment and structure

>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1	Back alignment and structure

>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A*	Back alignment and structure

>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix}	Back alignment and structure

>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A*	Back alignment and structure

>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima}	Back alignment and structure

>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2}	Back alignment and structure

>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1	Back alignment and structure

>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus}	Back alignment and structure

>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A	Back alignment and structure

>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima}	Back alignment and structure

>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A	Back alignment and structure

>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A*	Back alignment and structure

>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A*	Back alignment and structure

>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens}	Back alignment and structure

>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A*	Back alignment and structure

>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9	Back alignment and structure

>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A*	Back alignment and structure

>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B	Back alignment and structure

>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus}	Back alignment and structure

>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A	Back alignment and structure

>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii}	Back alignment and structure

>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A	Back alignment and structure

>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A*	Back alignment and structure

>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum}	Back alignment and structure

>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans}	Back alignment and structure

>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A	Back alignment and structure

>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A*	Back alignment and structure

>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus}	Back alignment and structure

>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima}	Back alignment and structure

>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A*	Back alignment and structure

>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A	Back alignment and structure

>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A	Back alignment and structure

>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2	Back alignment and structure

>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0	Back alignment and structure

>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A*	Back alignment and structure

>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana}	Back alignment and structure

>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A*	Back alignment and structure

>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D*	Back alignment and structure

>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A*	Back alignment and structure

>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A*	Back alignment and structure

>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6	Back alignment and structure

>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A*	Back alignment and structure

>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A*	Back alignment and structure

>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11	Back alignment and structure

>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A*	Back alignment and structure

>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A*	Back alignment and structure

>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1	Back alignment and structure

>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1	Back alignment and structure

>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus}	Back alignment and structure

>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis}	Back alignment and structure

>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens}	Back alignment and structure

>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A	Back alignment and structure

>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D*	Back alignment and structure

>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20	Back alignment and structure

>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B*	Back alignment and structure

>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A*	Back alignment and structure

>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A*	Back alignment and structure

>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A*	Back alignment and structure

>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus}	Back alignment and structure

>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A*	Back alignment and structure

>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A*	Back alignment and structure

>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A*	Back alignment and structure

>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		1446
d2a5yb3		277	c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor	7e-43
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	5e-04
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	6e-04

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score =  156 bits (394), Expect = 7e-43
 Identities = 35/243 (14%), Positives = 71/243 (29%), Gaps = 27/243 (11%)

Query: 190 VYGMGGLGKTTLAQLVYNDARL--QDHFDLKAWTCVSEDFDITRITKSILNSI------- 240
           ++G  G GK+ +A    + +      ++D   W   S     +         +       
Sbjct: 49  LHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDD 108

Query: 241 --GTDQNVDSLDFDKLQVELKKQLSQKKFLLVLDDVWNENYNDWIDLSRPFEAGAPGSKI 298
                           ++     + +   L V DDV  E    W              + 
Sbjct: 109 LLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQ--------ELRLRC 160

Query: 299 VVTTRNQAV-VAIMGTVPAYPLKELSDEDCLNVFTQHSLGTRDFNMHKSLEEIGKKIVIK 357
           +VTTR+  +  A   T     +  L  ++C +    + +        +   ++  K +  
Sbjct: 161 LVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEE---DVLNKTIEL 217

Query: 358 CNGLPLAAKTLGGLLRGKTDQRDWEDVLNCKIWDLPEERCDILPALKVSYYYLSPRLKQC 417
            +G P            KT +     + N K+         +      SY  L+  L++C
Sbjct: 218 SSGNPATLMMFFKSCEPKTFE-KMAQLNN-KLESRGLV--GVECITPYSYKSLAMALQRC 273

Query: 418 FTY 420
              
Sbjct: 274 VEV 276

PyMOL of d2a5yb3

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		1446
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	100.0
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.72
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.65
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.64
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.64
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.64
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.48
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.46
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.45
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.43
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.4
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.39
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.32
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.29
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.27
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.22
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.21
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.17
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.13
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.13
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.09
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.06
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.06
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.02
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.98
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	98.98
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.97
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	98.9
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	98.69
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.62
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.6
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.56
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.51
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.45
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.18
d2fnaa2		283	Archaeal ATPase SSO1545 {Sulfolobus solfataricus [	98.14
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	97.79
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	97.7
d1a5ta2		207	delta prime subunit of DNA polymerase III, N-domai	97.69
d1fnna2		276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	97.64
d1sxjc2		227	Replication factor C3 {Baker's yeast (Saccharomyce	97.6
d1sxjb2		224	Replication factor C4 {Baker's yeast (Saccharomyce	97.59
d1sxje2		252	Replication factor C5 {Baker's yeast (Saccharomyce	97.57
d1njfa_		239	delta prime subunit of DNA polymerase III, N-domai	97.56
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.51
d1sxjd2		237	Replication factor C2 {Baker's yeast (Saccharomyce	97.45
d1iqpa2		231	Replication factor C {Archaeon Pyrococcus furiosus	97.29
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.29
d1l8qa2		213	Chromosomal replication initiation factor DnaA {Aq	97.26
d1w5sa2		287	CDC6-like protein APE0152, N-terminal domain {Aero	96.95
d1sxja2		253	Replication factor C1 {Baker's yeast (Saccharomyce	96.67
d1r6bx2		268	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	96.56
d1in4a2		238	Holliday junction helicase RuvB {Thermotoga mariti	96.31
d1ixsb2		239	Holliday junction helicase RuvB {Thermus thermophi	96.31
d1ixza_		247	AAA domain of cell division protein FtsH {Thermus	96.3
d1lv7a_		256	AAA domain of cell division protein FtsH {Escheric	96.28
d1e32a2		258	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	96.11
d1r7ra3		265	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	95.61
d1jbka_		195	ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	95.55
d1d2na_		246	Hexamerization domain of N-ethylmalemide-sensitive	95.5
d1mo6a1		269	RecA protein, ATPase-domain {Mycobacterium tubercu	95.42
d2gnoa2		198	gamma subunit of DNA polymerase III, N-domain {The	95.19
d1xp8a1		268	RecA protein, ATPase-domain {Deinococcus radiodura	95.17
d1u94a1		263	RecA protein, ATPase-domain {Escherichia coli [Tax	95.02
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	93.91
d1kaga_		169	Shikimate kinase (AroK) {Escherichia coli [TaxId:	93.86
d2qy9a2		211	GTPase domain of the signal recognition particle r	93.74
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	93.54
d1qvra2		387	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	93.34
d1m8pa3		183	ATP sulfurylase C-terminal domain {Fungus (Penicil	93.29
d1lw7a2		192	Transcriptional regulator NadR, ribosylnicotinamid	93.23
d2iyva1		165	Shikimate kinase (AroK) {Mycobacterium tuberculosi	93.14
d1np6a_		170	Molybdopterin-guanine dinucleotide biosynthesis pr	92.91
d1rkba_		173	Adenylate kinase {Human (Homo sapiens), isoenzyme	92.89
d1ly1a_		152	Polynucleotide kinase, kinase domain {Bacteriophag	92.81
d1viaa_		161	Shikimate kinase (AroK) {Campylobacter jejuni [Tax	92.78
d2i3ba1		189	Cancer-related NTPase, C1orf57 {Human (Homo sapien	92.75
d2bdta1		176	Hypothetical protein BH3686 {Bacillus halodurans [	92.25
d1x6va3		195	Adenosine-5'phosphosulfate kinase (APS kinase) {Hu	92.21
d1e6ca_		170	Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax	92.07
d1vmaa2		213	GTPase domain of the signal recognition particle r	91.61
d1okkd2		207	GTPase domain of the signal recognition particle r	91.59
d1tf7a2		242	Circadian clock protein KaiC {Synechococcus sp. st	91.47
d1xjca_		165	Molybdopterin-guanine dinucleotide biosynthesis pr	91.44
d1y63a_		174	Probable kinase LmjF30.1890 {Leishmania major [Tax	91.26
d1ls1a2		207	GTPase domain of the signal sequence recognition p	91.09
d1rz3a_		198	Hypothetical protein rbstp0775 {Bacillus stearothe	91.09
d1qhxa_		178	Chloramphenicol phosphotransferase {Streptomyces v	90.52
d2jdid3		276	Central domain of beta subunit of F1 ATP synthase	90.37
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	90.37
d1j8yf2		211	GTPase domain of the signal sequence recognition p	90.26
d1bifa1		213	6-phosphofructo-2-kinase/fructose-2,6-bisphosphata	90.05
d1zp6a1		176	Hypothetical protein Atu3015 {Agrobacterium tumefa	89.94
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	89.89
d1khta_		190	Adenylate kinase {Archaeon Methanococcus voltae [T	89.8
d1yj5a2		172	5' polynucleotide kinase-3' phosphatase, C-termina	89.78
d1knqa_		171	Gluconate kinase {Escherichia coli [TaxId: 562]}	89.52
d1ye8a1		178	Hypothetical kinase-like protein Aq_1292 {Aquifex	89.42
d1nksa_		194	Adenylate kinase {Archaeon Sulfolobus acidocaldari	89.38
d1qf9a_		194	UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4	89.22
d1ukza_		196	Uridylate kinase {Baker's yeast (Saccharomyces cer	89.15
d1w44a_		321	NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]}	88.93
d1qvra3		315	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	88.88
d1sq5a_		308	Pantothenate kinase PanK {Escherichia coli [TaxId:	88.53
d2ak3a1		189	Adenylate kinase {Cow (Bos taurus), mitochondrial	88.45
d1zina1		182	Adenylate kinase {Bacillus stearothermophilus [Tax	88.28
d1xpua3		289	Transcription termination factor Rho, ATPase domai	87.98
d1lvga_		190	Guanylate kinase {Mouse (Mus musculus) [TaxId: 100	87.92
d1uj2a_		213	Uridine-cytidine kinase 2 {Human (Homo sapiens) [T	87.82
d1fx0a3		276	Central domain of alpha subunit of F1 ATP synthase	87.72
d1gvnb_		273	Plasmid maintenance system epsilon/zeta, toxin zet	87.71
d1zaka1		189	Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	87.61
d2cdna1		181	Adenylate kinase {Mycobacterium tuberculosis [TaxI	87.54
d1s3ga1		182	Adenylate kinase {Bacillus globisporus [TaxId: 145	87.22
d1gkya_		186	Guanylate kinase {Baker's yeast (Saccharomyces cer	87.16
d1cp2a_		269	Nitrogenase iron protein {Clostridium pasteurianum	87.07
d1teva_		194	UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]	86.77
d1r6bx3		315	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	86.7
d1akya1		180	Adenylate kinase {Baker's yeast (Saccharomyces cer	86.39
d1odfa_		286	Hypothetical protein Ygr205W {Baker's yeast (Sacch	85.89
d1ak2a1		190	Adenylate kinase {Cow (Bos taurus), mitochondrial	85.74
d1ckea_		225	CMP kinase {Escherichia coli [TaxId: 562]}	85.48
d1e4va1		179	Adenylate kinase {Escherichia coli [TaxId: 562]}	85.36
d1uf9a_		191	Dephospho-CoA kinase {Thermus thermophilus [TaxId:	85.05
d1m7ga_		208	Adenosine-5'phosphosulfate kinase (APS kinase) {Fu	84.46
d1ny5a2		247	Transcriptional activator sigm54 (NtrC1), C-termin	84.28
d1q3ta_		223	CMP kinase {Streptococcus pneumoniae [TaxId: 1313]	84.24
d1ofha_		309	HslU {Haemophilus influenzae [TaxId: 727]}	84.21
d2afhe1		289	Nitrogenase iron protein {Azotobacter vinelandii [	84.0
d1szpa2		251	DNA repair protein Rad51, catalytic domain {Baker'	83.29
d3adka_		194	Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	83.05
d1kgda_		178	Guanylate kinase-like domain of Cask {Human (Homo	82.81
d1znwa1		182	Guanylate kinase {Mycobacterium tuberculosis [TaxI	82.4
d1hyqa_		232	Cell division regulator MinD {Archaeon Archaeoglob	81.89
d1ihua1		296	Arsenite-translocating ATPase ArsA {Escherichia co	81.39
d1w36d1		359	Exodeoxyribonuclease V alpha chain (RecD) {Escheri	81.23
d1sgwa_		200	Putative ABC transporter PF0895 {Pyrococcus furios	81.23
d1nlfa_		274	Hexameric replicative helicase repA {Escherichia c	81.06
d1ihua2		279	Arsenite-translocating ATPase ArsA {Escherichia co	80.94
d1r8sa_		160	ADP-ribosylation factor {Human (Homo sapiens), ARF	80.69
d1g2912		240	Maltose transport protein MalK, N-terminal domain	80.64
d2vp4a1		197	Deoxyribonucleoside kinase {Fruit fly (Drosophila	80.29
d2jdia3		285	Central domain of alpha subunit of F1 ATP synthase	80.22
d3dhwc1		240	Methionine import ATP-binding protein MetN {Escher	80.22

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=100.00  E-value=1.1e-33  Score=311.02  Aligned_cols=220  Identities=15%  Similarity=0.100  Sum_probs=172.6

Q ss_pred             cceeEccCCchHHHHHHHHHcccc--hhccCCceEEEEeCCCCCHHHHHHHHHHH---hcCCCC------CCCCCHHHHH
Q 042296          187 EAKVYGMGGLGKTTLAQLVYNDAR--LQDHFDLKAWTCVSEDFDITRITKSILNS---IGTDQN------VDSLDFDKLQ  255 (1446)
Q Consensus       187 ~~~i~G~gG~GKTtLa~~v~~~~~--~~~~F~~~~wv~vs~~~~~~~~~~~i~~~---l~~~~~------~~~~~~~~~~  255 (1446)
                      .++|+||||+||||||+++|++.+  .+.+|++++||++++.++...+...+...   ++....      ..........
T Consensus        46 ~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  125 (277)
T d2a5yb3          46 FLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKR  125 (277)
T ss_dssp             EEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCCHHHHHHHHHHHHHHhcchhhcCCccchhhhhHHHHH
Confidence            578999999999999999998643  67789999999999999877766655443   332211      1122234445


Q ss_pred             HHHHHHcCCceEEEEEECCCCCChhhHHHhcccccCCCCCcEEEEEccChHHHHhhCCC-CceecCCCChHhHHHHHHhh
Q 042296          256 VELKKQLSQKKFLLVLDDVWNENYNDWIDLSRPFEAGAPGSKIVVTTRNQAVVAIMGTV-PAYPLKELSDEDCLNVFTQH  334 (1446)
Q Consensus       256 ~~l~~~l~~~~~LlVlDdv~~~~~~~~~~~~~~l~~~~~gs~iivTtR~~~v~~~~~~~-~~~~l~~L~~~~~~~lf~~~  334 (1446)
                      ..+...+.++|+|+||||||+.  .+|..+.      ..|||||||||++.++..+... ..|+|++|+.+|||+||.++
T Consensus       126 ~~~~~~L~~kr~LlVLDDv~~~--~~~~~~~------~~~srilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~  197 (277)
T d2a5yb3         126 MICNALIDRPNTLFVFDDVVQE--ETIRWAQ------ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAY  197 (277)
T ss_dssp             HHHHHHTTSTTEEEEEEEECCH--HHHHHHH------HTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHT
T ss_pred             HHHHHHhccCCeeEecchhhHH--hhhhhhc------ccCceEEEEeehHHHHHhcCCCCceEECCCCCHHHHHHHHHHH
Confidence            5678889999999999999987  5554332      2589999999999999876544 67999999999999999999


Q ss_pred             ccCCCCCCCChhHHHHHHHHHHHhCCchhHHHHHHhhhcCCCChhHHHHHHhccccCCCCcccccchhhhhhhccCCHHH
Q 042296          335 SLGTRDFNMHKSLEEIGKKIVIKCNGLPLAAKTLGGLLRGKTDQRDWEDVLNCKIWDLPEERCDILPALKVSYYYLSPRL  414 (1446)
Q Consensus       335 a~~~~~~~~~~~~~~~~~~i~~~c~glPlai~~~~~~L~~~~~~~~w~~~l~~~~~~~~~~~~~~~~~l~~sy~~L~~~~  414 (1446)
                      +|...   ..+..++++++|+++|+|+||||+++|+.|+.+ +.+.|.+..+....   .....+.+++.+||++||+++
T Consensus       198 ~~~~~---~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k-~~~~~~~~~~~L~~---~~~~~v~~il~~sY~~L~~~l  270 (277)
T d2a5yb3         198 GMPMP---VGEKEEDVLNKTIELSSGNPATLMMFFKSCEPK-TFEKMAQLNNKLES---RGLVGVECITPYSYKSLAMAL  270 (277)
T ss_dssp             SCCCC-----CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS-SHHHHHHHHHHHHH---HCSSTTCCCSSSSSSSHHHHH
T ss_pred             hCCcc---CchhhHHHHHHHHHHhCCCHHHHHHHHHHhccC-CHHHHHHHHHHHhc---CcHHHHHHHHHHHHhcccHHH
Confidence            87643   334568899999999999999999999999877 57788776653321   123579999999999999999


Q ss_pred             HHHHhhh
Q 042296          415 KQCFTYC  421 (1446)
Q Consensus       415 k~cf~~~  421 (1446)
                      |+||.++
T Consensus       271 k~c~~~l  277 (277)
T d2a5yb3         271 QRCVEVL  277 (277)
T ss_dssp             HHHHHTS
T ss_pred             HHHHHhC
Confidence            9999874

PyMOL of d2a5yb3

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]}	Back information, alignment and structure

>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]}	Back information, alignment and structure

>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}	Back information, alignment and structure

>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}	Back information, alignment and structure

>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]}	Back information, alignment and structure

>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]}	Back information, alignment and structure

>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]}	Back information, alignment and structure

>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]}	Back information, alignment and structure

>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]}	Back information, alignment and structure

>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]}	Back information, alignment and structure

>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]}	Back information, alignment and structure

>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]}	Back information, alignment and structure

>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]}	Back information, alignment and structure

>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}	Back information, alignment and structure

>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]}	Back information, alignment and structure

>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}	Back information, alignment and structure