Citrus Sinensis ID: 042321

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MGKFGYLNYDNSNNQTHANDDDFDELLESAIKNYQLNYHLKSTEVLDAGTVGKMRTHDAELQILGSPRWPASKFSLTYAFLPGTRGDAINPVARAFQTWAPNTQFQFAESQDYRNADIKISFESGDHGAGALSTAVVESWLMLQLLLESQSVCMELIFKELGIFINYNI
cccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHccccccccccccccccccccEEEEEcccccccHHHHHHHHHHHHccccccEEEEEcccccccEEEEEEcccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHcEEEcccc
cccEEEccccccccccEEccccccHHHHHHHHHHHHHccccccccccHHHHHHHcccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHHHHHcccccEEEEEcccccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEcc
mgkfgylnydnsnnqthanddDFDELLESAIKNYQLNYHLkstevldagtvgkmrthdaelqilgsprwpaskfsltyaflpgtrgdainpvARAFqtwapntqfqfaesqdyrnadikisfesgdhgagALSTAVVESWLMLQLLLESQSVCMELIFKELGIFINYNI
MGKFGYLNYDNSNNQTHANDDDFDELLESAIKNYQLNYHLKSTEVLDAGTVGKMRTHDAELQilgsprwpasKFSLTYAFLPGTRGDAINPVARAFQTWAPNTQFQFAESQDYRNADIKISFESGDHGAGALSTAVVESWLMLQLLLESQSVCMELIFKELGIFINYNI
MGKFGYLNYDNSNNQTHANDDDFDELLESAIKNYQLNYHLKSTEVLDAGTVGKMRTHDAELQILGSPRWPASKFSLTYAFLPGTRGDAINPVARAFQTWAPNTQFQFAESQDYRNADIKISFESGDHGAGALSTAVVESWLMLQLLLESQSVCMELIFKELGIFINYNI
***********************DELLESAIKNYQLNYHLKSTEVLDAGTVGKMRTHDAELQILGSPRWPASKFSLTYAFLPGTRGDAINPVARAFQTWAPNTQFQFAESQDYRNADIKISFESGDHGAGALSTAVVESWLMLQLLLESQSVCMELIFKELGIFINY**
MGKFGYL******************LLESAIKNYQLNYHLKSTEVLDAGTVGKMRTHDAELQILGSPRWPASKFSLTYAFLPGTRGDAINPVARAFQTWAPNTQFQFAESQDYRNADIKISFESGDHGAGALSTAVVESWLMLQLLLESQSVCMELIFKELGIFINYNI
MGKFGYLNYDNSNNQTHANDDDFDELLESAIKNYQLNYHLKSTEVLDAGTVGKMRTHDAELQILGSPRWPASKFSLTYAFLPGTRGDAINPVARAFQTWAPNTQFQFAESQDYRNADIKISFESGDHGAGALSTAVVESWLMLQLLLESQSVCMELIFKELGIFINYNI
MGKFGYLNYDNSNNQTHANDDDFDELLESAIKNYQLNYHLKSTEVLDAGTVGKMRTHDAELQILGSPRWPASKFSLTYAFLPGTRGDAINPVARAFQTWAPNTQFQFAESQDYRNADIKISFESGDHGAGALSTAVVESWLMLQLLLESQSVCMELIFKELGIFINYNI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKFGYLNYDNSNNQTHANDDDFDELLESAIKNYQLNYHLKSTEVLDAGTVGKMRTHDAELQILGSPRWPASKFSLTYAFLPGTRGDAINPVARAFQTWAPNTQFQFAESQDYRNADIKISFESGDHGAGALSTAVVESWLMLQLLLESQSVCMELIFKELGIFINYNI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query169 2.2.26 [Sep-21-2011]
P29136305 Metalloendoproteinase 1 O no no 0.644 0.357 0.366 6e-13
P91953 591 50 kDa hatching enzyme OS N/A no 0.698 0.199 0.294 2e-05
>sp|P29136|MEP1_SOYBN Metalloendoproteinase 1 OS=Glycine max PE=1 SV=2 Back     alignment and function desciption
 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 48/131 (36%), Positives = 62/131 (47%), Gaps = 22/131 (16%)

Query: 20  DDDFDELLESAIKNYQLNYHLKSTEVLDAGTVGKMRTHDAELQ--ILGS----------- 66
           DD+FD+ L SAIK YQ NY+L  T   D  T+ ++ T    +   I+ +           
Sbjct: 74  DDNFDDTLVSAIKTYQKNYNLNVTGKFDINTLKQIMTPRCGVPDIIINTNKTTSFGMISD 133

Query: 67  -------PRWPASKFSLTYAFLPGTRGDAI--NPVARAFQTWAPNTQFQFAESQDYRNAD 117
                  PRW A    LTYAF P  R D    + +ARAF  W P     F E+  Y  A+
Sbjct: 134 YTFFKDMPRWQAGTTQLTYAFSPEPRLDDTFKSAIARAFSKWTPVVNIAFQETTSYETAN 193

Query: 118 IKISFESGDHG 128
           IKI F S +HG
Sbjct: 194 IKILFASKNHG 204
Specificity similar to that of mammalian matrix metalloproteases. May act against cell wall components.
Glycine max (taxid: 3847)
EC: 3EC: .EC: 4EC: .EC: 2EC: 4EC: .EC: -
>sp|P91953|HE_HEMPU 50 kDa hatching enzyme OS=Hemicentrotus pulcherrimus PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
255552736 311 Metalloendoproteinase 1 precursor, putat 0.739 0.401 0.487 3e-32
296087729262 unnamed protein product [Vitis vinifera] 0.769 0.496 0.532 2e-31
147790365 319 hypothetical protein VITISV_011608 [Viti 0.757 0.401 0.459 2e-29
147807819 305 hypothetical protein VITISV_030256 [Viti 0.769 0.426 0.483 4e-29
225452582 315 PREDICTED: metalloendoproteinase 1-like 0.769 0.412 0.459 4e-29
359485078 319 PREDICTED: metalloendoproteinase 1-like 0.757 0.401 0.452 4e-28
449449419 319 PREDICTED: metalloendoproteinase 1-like 0.739 0.391 0.432 8e-27
449449417 316 PREDICTED: metalloendoproteinase 1-like 0.751 0.401 0.422 1e-26
449492743 457 PREDICTED: metalloendoproteinase 1-like 0.751 0.277 0.422 2e-26
449449409 313 PREDICTED: metalloendoproteinase 1-like 0.745 0.402 0.440 4e-26
>gi|255552736|ref|XP_002517411.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis] gi|223543422|gb|EEF44953.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  142 bits (359), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 78/160 (48%), Positives = 92/160 (57%), Gaps = 35/160 (21%)

Query: 4   FGYLNYDNSNNQTHANDDDFDELLESAIKNYQLNYHLKSTEVLDAGTVGKM---RTHDAE 60
           FGYL+Y    NQ+H+NDDDFD+LLE A+K YQ NYHL  T  LD+ TV KM   R   A+
Sbjct: 66  FGYLSY---KNQSHSNDDDFDDLLEYALKTYQFNYHLNVTGFLDSETVTKMMMPRCGVAD 122

Query: 61  LQ-----------------------------ILGSPRWPASKFSLTYAFLPGTRGDAINP 91
           +                                G+PRWPASK+ LTY FLPGT   A+ P
Sbjct: 123 IINGTTRMQSSNKNPHHHSSTSFHTVSHYEFFPGNPRWPASKYHLTYGFLPGTPNQAMEP 182

Query: 92  VARAFQTWAPNTQFQFAESQDYRNADIKISFESGDHGAGA 131
           VA+AFQTWA NT F+F   QDYR ADI I F  GDHG G+
Sbjct: 183 VAKAFQTWAANTHFRFTRVQDYRAADITIGFHRGDHGDGS 222

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296087729|emb|CBI34985.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147790365|emb|CAN59960.1| hypothetical protein VITISV_011608 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147807819|emb|CAN73128.1| hypothetical protein VITISV_030256 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225452582|ref|XP_002275556.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485078|ref|XP_003633209.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449449419|ref|XP_004142462.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus] gi|449492747|ref|XP_004159088.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449449417|ref|XP_004142461.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449492743|ref|XP_004159087.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449449409|ref|XP_004142457.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus] gi|449527361|ref|XP_004170680.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
TAIR|locus:2020548 378 MMP "matrix metalloproteinase" 0.390 0.174 0.411 7.6e-16
TAIR|locus:2032467 384 AT1G24140 [Arabidopsis thalian 0.390 0.171 0.397 5.9e-15
TAIR|locus:2025891 360 AT1G59970 [Arabidopsis thalian 0.467 0.219 0.439 1.2e-09
TAIR|locus:2130928 364 AT4G16640 [Arabidopsis thalian 0.378 0.175 0.361 1.2e-07
TAIR|locus:2055605 342 AT2G45040 [Arabidopsis thalian 0.390 0.192 0.410 2.5e-06
UNIPROTKB|F1MT97 469 LOC100848085 "Uncharacterized 0.704 0.253 0.318 0.00056
UNIPROTKB|H3BV48118 MMP2 "PEX" [Homo sapiens (taxi 0.360 0.516 0.338 0.00068
WB|WBGene00016283 579 C31B8.8 [Caenorhabditis elegan 0.733 0.214 0.284 0.00076
TAIR|locus:2020548 MMP "matrix metalloproteinase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 133 (51.9 bits), Expect = 7.6e-16, Sum P(2) = 7.6e-16
 Identities = 28/68 (41%), Positives = 38/68 (55%)

Query:    65 GSPRWPASKFSLTYAFLP-GTRGDAINPV-ARAFQTWAPNTQFQFAESQDYRNADIKISF 122
             G PRWP ++  LTYAF P     + +  V +RAF  W+  T   F  S+ +  +DI I F
Sbjct:   160 GEPRWPRNRRDLTYAFDPKNPLTEEVKSVFSRAFGRWSDVTALNFTLSESFSTSDITIGF 219

Query:   123 ESGDHGAG 130
              +GDHG G
Sbjct:   220 YTGDHGDG 227
GO:0004222 "metalloendopeptidase activity" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0008152 "metabolic process" evidence=IEA
GO:0008237 "metallopeptidase activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0031012 "extracellular matrix" evidence=IEA
GO:0031225 "anchored to membrane" evidence=TAS
TAIR|locus:2032467 AT1G24140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025891 AT1G59970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130928 AT4G16640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055605 AT2G45040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1MT97 LOC100848085 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|H3BV48 MMP2 "PEX" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00016283 C31B8.8 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.24LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
cd04278157 cd04278, ZnMc_MMP, Zinc-dependent metalloprotease, 2e-12
pfam00413159 pfam00413, Peptidase_M10, Matrixin 9e-10
smart00235139 smart00235, ZnMc, Zinc-dependent metalloprotease 3e-07
pfam0147157 pfam01471, PG_binding_1, Putative peptidoglycan bi 7e-04
>gnl|CDD|239805 cd04278, ZnMc_MMP, Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family Back     alignment and domain information 
 Score = 61.5 bits (150), Expect = 2e-12
 Identities = 26/65 (40%), Positives = 34/65 (52%), Gaps = 6/65 (9%)

Query: 68  RWPASKFSLTYAFLPGT----RGDAINPVARAFQTWAPNTQFQFAESQDYRNADIKISFE 123
           +W  SK +LTY  L       R D    +ARAF+ W+  T   F E    + ADI+ISF 
Sbjct: 1   KW--SKTNLTYRILNYPPDLPRDDVRRAIARAFRVWSDVTPLTFREVTSGQEADIRISFA 58

Query: 124 SGDHG 128
            G+HG
Sbjct: 59  RGNHG 63

MMPs are responsible for a great deal of pericellular proteolysis of extracellular matrix and cell surface molecules, playing crucial roles in morphogenesis, cell fate specification, cell migration, tissue repair, tumorigenesis, gain or loss of tissue-specific functions, and apoptosis. In many instances, they are anchored to cell membranes via trans-membrane domains, and their activity is controlled via TIMPs (tissue inhibitors of metalloproteinases). Length = 157
>gnl|CDD|215908 pfam00413, Peptidase_M10, Matrixin Back     alignment and domain information
>gnl|CDD|214576 smart00235, ZnMc, Zinc-dependent metalloprotease Back     alignment and domain information
>gnl|CDD|216518 pfam01471, PG_binding_1, Putative peptidoglycan binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 169
KOG1565 469 consensus Gelatinase A and related matrix metallop 100.0
cd04278157 ZnMc_MMP Zinc-dependent metalloprotease, matrix me 99.9
PF00413154 Peptidase_M10: Matrixin This Prosite motif covers 99.9
smart00235140 ZnMc Zinc-dependent metalloprotease. Neutral zinc 99.8
cd04327198 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MM 99.74
cd04268165 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_ 99.74
cd04279156 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MM 99.7
cd04277186 ZnMc_serralysin_like Zinc-dependent metalloproteas 99.63
cd04280180 ZnMc_astacin_like Zinc-dependent metalloprotease, 99.55
) family of metalloendopeptidases encompasses a range of proteins found in hydra to humans, in mature and developmental systems []. Their functions include activation of growth factors, degradation of polypeptides, and processing of extracellular proteins []. The proteins are synthesised with N-terminal signal and pro-enzyme sequences, and many contain multiple domains C-terminal to the protease domain. They are either secreted from cells, or are associated with the plasma membrane. The astacin molecule adopts a kidney shape, with a deep active-site cleft between its N- and C-terminal domains []. The zinc ion, which lies at the bottom of the cleft, exhibits a unique penta-coordinated mode of binding, involving 3 histidine residues, a tyrosine and a water molecule (which is also bound to the carboxylate side chain of Glu93) []. The N-terminal domain comprises 2 alpha-helices and a 5-stranded beta-sheet. The overall topology of this domain is shared by the archetypal zinc-endopeptidase thermolysin. Astacin protease domains also share common features with serralysins, matrix metalloendopeptidases, and snake venom proteases; they cleave peptide bonds in polypeptides such as insulin B chain and bradykinin, and in proteins such as casein and gelatin; and they have arylamidase activity [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3LQB_A 3EDH_A 3EDG_A 3EDI_A 1IAE_A 1IAB_A 1IAA_A 1AST_A 1IAC_A 1QJJ_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF01400">PF01400191 Astacin: Astacin (Peptidase family M12A) This Pros 99.45
cd04281200 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1 99.42
cd00203167 ZnMc Zinc-dependent metalloprotease. This super-fa 99.37
cd04282230 ZnMc_meprin Zinc-dependent metalloprotease, meprin 99.36
cd04276197 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MM 99.34
cd04283182 ZnMc_hatching_enzyme Zinc-dependent metalloproteas 99.23
KOG3714 411 consensus Meprin A metalloprotease [Posttranslatio 99.17
PF02031132 Peptidase_M7: Streptomyces extracellular neutral p 99.12
PF0147157 PG_binding_1: Putative peptidoglycan binding domai 99.09
PF12388211 Peptidase_M57: Dual-action HEIGH metallo-peptidase 98.69
COG5549236 Predicted Zn-dependent protease [Posttranslational 97.91
PF13583206 Reprolysin_4: Metallo-peptidase family M12B Reprol 97.78
PF13582124 Reprolysin_3: Metallo-peptidase family M12B Reprol 97.65
TIGR02869201 spore_SleB spore cortex-lytic enzyme. Members of t 97.39
PF13688196 Reprolysin_5: Metallo-peptidase family M12; PDB: 2 97.3
PF13574173 Reprolysin_2: Metallo-peptidase family M12B Reprol 97.29
PF05572154 Peptidase_M43: Pregnancy-associated plasma protein 97.24
cd04269194 ZnMc_adamalysin_II_like Zinc-dependent metalloprot 97.07
cd04267192 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADA 97.03
PF11350203 DUF3152: Protein of unknown function (DUF3152); In 96.97
PRK13267179 archaemetzincin-like protein; Reviewed 96.87
cd04275225 ZnMc_pappalysin_like Zinc-dependent metalloproteas 96.81
PF07998194 Peptidase_M54: Peptidase family M54; InterPro: IPR 96.78
cd04270244 ZnMc_TACE_like Zinc-dependent metalloprotease; TAC 96.71
COG1913181 Predicted Zn-dependent proteases [General function 96.71
cd04273207 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, A 96.7
cd04271228 ZnMc_ADAM_fungal Zinc-dependent metalloprotease, A 96.65
PF01421199 Reprolysin: Reprolysin (M12B) family zinc metallop 96.62
cd04272220 ZnMc_salivary_gland_MPs Zinc-dependent metalloprot 96.49
PRK10594 608 murein L,D-transpeptidase; Provisional 96.46
TIGR03296 286 M6dom_TIGR03296 M6 family metalloprotease domain. 96.18
COG2989 561 Uncharacterized protein conserved in bacteria [Fun 95.61
PF10462305 Peptidase_M66: Peptidase M66; InterPro: IPR019503 95.26
PF05548 314 Peptidase_M11: Gametolysin peptidase M11; InterPro 95.15
PF05547 645 Peptidase_M6: Immune inhibitor A peptidase M6; Int 94.51
PF04298 222 Zn_peptidase_2: Putative neutral zinc metallopepti 94.36
PF12044423 Metallopep: Putative peptidase family; InterPro: I 93.21
COG3409185 Putative peptidoglycan-binding domain-containing p 93.16
PF09471264 Peptidase_M64: IgA Peptidase M64; InterPro: IPR019 92.13
KOG3607 716 consensus Meltrins, fertilins and related Zn-depen 92.05
COG3824136 Predicted Zn-dependent protease [General function 92.05
PF01457 521 Peptidase_M8: Leishmanolysin This Prosite motif co 91.74
TIGR02290 587 M3_fam_3 oligoendopeptidase, pepF/M3 family. The M 91.26
PF0626297 DUF1025: Possibl zinc metallo-peptidase; InterPro: 90.44
PTZ00337 567 surface protease GP63; Provisional 90.0
KOG3658 764 consensus Tumor necrosis factor-alpha-converting e 88.68
KOG4525 614 consensus Jacalin-like lectin domain-containing pr 88.4
PF0937472 PG_binding_3: Predicted Peptidoglycan domain; Inte 87.95
PF14247 220 DUF4344: Domain of unknown function (DUF4344) 87.6
COG4783 484 Putative Zn-dependent protease, contains TPR repea 87.31
PTZ00257 622 Glycoprotein GP63 (leishmanolysin); Provisional 86.81
COG2738 226 Predicted Zn-dependent protease [General function 86.03
PF06114122 DUF955: Domain of unknown function (DUF955); Inter 85.35
COG2856 213 Predicted Zn peptidase [Amino acid transport and m 84.55
TIGR02289 549 M3_not_pepF oligoendopeptidase, M3 family. This fa 83.46
PF01435 226 Peptidase_M48: Peptidase family M48 This is family 82.66
cd06161 208 S2P-M50_SpoIVFB SpoIVFB Site-2 protease (S2P), a z 81.81
PRK03982 288 heat shock protein HtpX; Provisional 81.03
cd06459 427 M3B_Oligoendopeptidase_F Peptidase family M3B Olig 80.61
>KOG1565 consensus Gelatinase A and related matrix metalloproteases [Posttranslational modification, protein turnover, chaperones; Extracellular structures] Back     alignment and domain information 
Probab=100.00  E-value=3.3e-39  Score=281.55  Aligned_cols=161  Identities=29%  Similarity=0.374  Sum_probs=142.3

Q ss_pred             CCCccCCCCCCCCCCCCCCCcchhHHHHHHHHHHHHhcCCCccccCChHHhhhhhcC-----Ccccc-ccCCCCCCCCCc
Q 042321            1 MGKFGYLNYDNSNNQTHANDDDFDELLESAIKNYQLNYHLKSTEVLDAGTVGKMRTH-----DAELQ-ILGSPRWPASKF   74 (169)
Q Consensus         1 L~~fGYl~~~~~~~~~~~~~~~~~~~~~~ai~~~Q~~~gL~~TG~lD~~T~~~m~~p-----D~~~~-~~g~~kW~~~k~   74 (169)
                      |++|||+.+.+......     .++.+++||+.||++++|++||++|.+|++.|++|     |-+|+ +++.+||+  +.
T Consensus        37 l~~~~y~~~~~~~~~~~-----~~~~~~~al~~~q~~~~l~~tG~lD~~Tl~~m~~prCgvpd~~~~~~~~~~kW~--k~  109 (469)
T KOG1565|consen   37 LECYGYLPPTDLTATRA-----SQNVLEDALKMMQDFFGLPVTGKLDNATLALMNKPRCGVPDGRYRYFPGKPKWN--KE  109 (469)
T ss_pred             hhhcccCCCcccccccc-----CchhhHHHHHhhhhhcCccccCCcchhhhhhccCCCcCCCCCccccCcccCccc--cc
Confidence            67899999887543211     36889999999999999999999999999999999     65677 77889999  99


Q ss_pred             ceEEEeccCCch----hhHHHHHHHHHhhccCCCcceEeccCCCcccEEEEeecCCCCCCCCCCCC--------------
Q 042321           75 SLTYAFLPGTRG----DAINPVARAFQTWAPNTQFQFAESQDYRNADIKISFESGDHGAGALSTAV--------------  136 (169)
Q Consensus        75 ~LTy~~~~~~~~----~~~~~i~~Af~~Ws~vt~L~F~ev~~~~~ADI~I~F~~~~Hgd~~pfd~~--------------  136 (169)
                      +|||+|.+++++    +++.++++||++|++|++|+|.|+.....|||+|.|..+.|||++||||.              
T Consensus       110 ~lT~ri~n~~~~l~~~~vr~~~~~Af~~Ws~vtpl~f~e~~~~~~aDi~i~F~~~~h~d~~PFDG~~g~laHAf~Pg~~~  189 (469)
T KOG1565|consen  110 HLTYRIKNYTPYLPQAEVRCAKSEAFKLWSDVTPLTFQEVKEEGEADIRISFFPGDHGDGFPFDGPGGVLAHAFFPGPGI  189 (469)
T ss_pred             ccceeccccCCCCCHHHHHHHHHHHHhhcccCCCCccccCCCCCCCceeeeeeccCCCCCCcccCCCCceecccCCCCCC
Confidence            999999999755    79999999999999999999999998569999999999999999999953              


Q ss_pred             --------CCceee-cccccchHHHHHHhhhhhcCCCCccC
Q 042321          137 --------VESWLM-LQLLLESQSVCMELIFKELGIFINYN  168 (169)
Q Consensus       137 --------~e~w~~-~~~~~~~~~va~HEiGHaLGL~h~~~  168 (169)
                              +|.|+. ....+|++.||+|||||+|||+|+.+
T Consensus       190 ~G~~hfD~dE~Wt~~~~~g~~l~~Va~HEiGH~LGL~HS~~  230 (469)
T KOG1565|consen  190 GGDLHFDKDETWTYGDSNGVDLFLVAAHEIGHALGLGHSSD  230 (469)
T ss_pred             CCccccCcccceeccCCccchhHHHhhhhcccccccCCCCC
Confidence                    577876 45677899999999999999999965

>cd04278 ZnMc_MMP Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family Back     alignment and domain information
>PF00413 Peptidase_M10: Matrixin This Prosite motif covers only the active site Back     alignment and domain information
>smart00235 ZnMc Zinc-dependent metalloprotease Back     alignment and domain information
>cd04327 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MMP_like sub-family 3 Back     alignment and domain information
>cd04268 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like subfamily Back     alignment and domain information
>cd04279 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MMP_like sub-family 1 Back     alignment and domain information
>cd04277 ZnMc_serralysin_like Zinc-dependent metalloprotease, serralysin_like subfamily Back     alignment and domain information
>cd04280 ZnMc_astacin_like Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site Back     alignment and domain information
>PF01400 Astacin: Astacin (Peptidase family M12A) This Prosite motif covers only the active site Back     alignment and domain information
>cd04281 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1/TLD-like subfamily Back     alignment and domain information
>cd00203 ZnMc Zinc-dependent metalloprotease Back     alignment and domain information
>cd04282 ZnMc_meprin Zinc-dependent metalloprotease, meprin_like subfamily Back     alignment and domain information
>cd04276 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MMP_like sub-family 2 Back     alignment and domain information
>cd04283 ZnMc_hatching_enzyme Zinc-dependent metalloprotease, hatching enzyme-like subfamily Back     alignment and domain information
>KOG3714 consensus Meprin A metalloprotease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02031 Peptidase_M7: Streptomyces extracellular neutral proteinase (M7) family; InterPro: IPR000013 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF01471 PG_binding_1: Putative peptidoglycan binding domain; InterPro: IPR002477 This entry represents peptidoglycan binding domain (PGBD), as well as related domains that share the same structure Back     alignment and domain information
>PF12388 Peptidase_M57: Dual-action HEIGH metallo-peptidase; InterPro: IPR024653 This entry represents the metallopeptidases M10, M27 and M57 Back     alignment and domain information
>COG5549 Predicted Zn-dependent protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13583 Reprolysin_4: Metallo-peptidase family M12B Reprolysin-like Back     alignment and domain information
>PF13582 Reprolysin_3: Metallo-peptidase family M12B Reprolysin-like; PDB: 3P24_C Back     alignment and domain information
>TIGR02869 spore_SleB spore cortex-lytic enzyme Back     alignment and domain information
>PF13688 Reprolysin_5: Metallo-peptidase family M12; PDB: 2FV5_B 3EWJ_A 3KME_A 3L0T_B 1BKC_E 3G42_D 2I47_D 2FV9_B 3LEA_A 1ZXC_B Back     alignment and domain information
>PF13574 Reprolysin_2: Metallo-peptidase family M12B Reprolysin-like; PDB: 1KAP_P 1JIW_P 1AKL_A 1OM7_A 1OM8_A 1O0T_A 1OM6_A 1H71_P 1O0Q_A 1OMJ_A Back     alignment and domain information
>PF05572 Peptidase_M43: Pregnancy-associated plasma protein-A; InterPro: IPR008754 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd04269 ZnMc_adamalysin_II_like Zinc-dependent metalloprotease; adamalysin_II_like subfamily Back     alignment and domain information
>cd04267 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADAM_like or reprolysin_like subgroup Back     alignment and domain information
>PF11350 DUF3152: Protein of unknown function (DUF3152); InterPro: IPR022603 This entry represents Actinobacteria proteins of unknown function Back     alignment and domain information
>PRK13267 archaemetzincin-like protein; Reviewed Back     alignment and domain information
>cd04275 ZnMc_pappalysin_like Zinc-dependent metalloprotease, pappalysin_like subfamily Back     alignment and domain information
>PF07998 Peptidase_M54: Peptidase family M54; InterPro: IPR012962 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd04270 ZnMc_TACE_like Zinc-dependent metalloprotease; TACE_like subfamily Back     alignment and domain information
>COG1913 Predicted Zn-dependent proteases [General function prediction only] Back     alignment and domain information
>cd04273 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, ADAMTS_like subgroup Back     alignment and domain information
>cd04271 ZnMc_ADAM_fungal Zinc-dependent metalloprotease, ADAM_fungal subgroup Back     alignment and domain information
>PF01421 Reprolysin: Reprolysin (M12B) family zinc metalloprotease This Prosite motif covers only the active site Back     alignment and domain information
>cd04272 ZnMc_salivary_gland_MPs Zinc-dependent metalloprotease, salivary_gland_MPs Back     alignment and domain information
>PRK10594 murein L,D-transpeptidase; Provisional Back     alignment and domain information
>TIGR03296 M6dom_TIGR03296 M6 family metalloprotease domain Back     alignment and domain information
>COG2989 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10462 Peptidase_M66: Peptidase M66; InterPro: IPR019503 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF05548 Peptidase_M11: Gametolysin peptidase M11; InterPro: IPR008752 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF05547 Peptidase_M6: Immune inhibitor A peptidase M6; InterPro: IPR008757 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF04298 Zn_peptidase_2: Putative neutral zinc metallopeptidase; InterPro: IPR007395 Members of this family of bacterial proteins are described as hypothetical proteins or zinc-dependent proteases Back     alignment and domain information
>PF12044 Metallopep: Putative peptidase family; InterPro: IPR021917 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG3409 Putative peptidoglycan-binding domain-containing protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF09471 Peptidase_M64: IgA Peptidase M64; InterPro: IPR019026 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3607 consensus Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3824 Predicted Zn-dependent protease [General function prediction only] Back     alignment and domain information
>PF01457 Peptidase_M8: Leishmanolysin This Prosite motif covers only the active site Back     alignment and domain information
>TIGR02290 M3_fam_3 oligoendopeptidase, pepF/M3 family Back     alignment and domain information
>PF06262 DUF1025: Possibl zinc metallo-peptidase; InterPro: IPR010428 This is a family of bacterial protein with undetermined function Back     alignment and domain information
>PTZ00337 surface protease GP63; Provisional Back     alignment and domain information
>KOG3658 consensus Tumor necrosis factor-alpha-converting enzyme (TACE/ADAM17) and related metalloproteases [Extracellular structures] Back     alignment and domain information
>KOG4525 consensus Jacalin-like lectin domain-containing protein [General function prediction only] Back     alignment and domain information
>PF09374 PG_binding_3: Predicted Peptidoglycan domain; InterPro: IPR018537 This family contains a potential peptidoglycan binding domain Back     alignment and domain information
>PF14247 DUF4344: Domain of unknown function (DUF4344) Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PTZ00257 Glycoprotein GP63 (leishmanolysin); Provisional Back     alignment and domain information
>COG2738 Predicted Zn-dependent protease [General function prediction only] Back     alignment and domain information
>PF06114 DUF955: Domain of unknown function (DUF955); InterPro: IPR010359 This is a family of bacterial and viral proteins with undetermined function Back     alignment and domain information
>COG2856 Predicted Zn peptidase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02289 M3_not_pepF oligoendopeptidase, M3 family Back     alignment and domain information
>PF01435 Peptidase_M48: Peptidase family M48 This is family M48 in the peptidase classification Back     alignment and domain information
>cd06161 S2P-M50_SpoIVFB SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation Back     alignment and domain information
>PRK03982 heat shock protein HtpX; Provisional Back     alignment and domain information
>cd06459 M3B_Oligoendopeptidase_F Peptidase family M3B Oligopeptidase F (PepF; Pz-peptidase B; EC 3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
1slm_A255 Stromelysin-1; hydrolase, metalloprotease, fibrobl 8e-20
1su3_A 450 Interstitial collagenase; prodomain, hemopexin dom 8e-19
1l6j_A 425 Matrix metalloproteinase-9; twisted beta sheet fla 1e-17
1ck7_A 631 Protein (gelatinase A); hydrolase (metalloprotease 4e-15
1eak_A 421 72 kDa type IV collagenase; hydrolase-hydrolase in 3e-14
3ba0_A 365 Macrophage metalloelastase; FULL-length MMP-12, he 6e-11
1rm8_A169 MMP-16, matrix metalloproteinase-16, MT3-MMP; memb 1e-10
1i76_A163 MMP-8;, neutrophil collagenase; hydrolase, complex 2e-10
2xs4_A167 Karilysin protease; hydrolase, bacterial MMP, viru 2e-10
2jsd_A160 Matrix metalloproteinase-20; MMP-NNGH, structural 2e-10
1hy7_A173 Stromelysin-1, MMP-3; mixed alpha beta structure, 2e-10
1cge_A168 Fibroblast collagenase; hydrolase (metalloprotease 3e-10
830c_A168 MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 1e-09
3ayu_A167 72 kDa type IV collagenase; protease, hydrolase-hy 1e-09
1y93_A159 Macrophage metalloelastase; matrix metalloproteina 2e-09
2y6d_A174 Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapie 3e-09
2ovx_A159 Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) 4e-09
3ma2_D181 Matrix metalloproteinase-14; protein - protein com 4e-09
1hv5_A165 Stromelysin 3; inhibition, phosphinic inhibitor, h 2e-08
>1slm_A Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 Length = 255 Back     alignment and structure
 Score = 82.2 bits (202), Expect = 8e-20
 Identities = 27/135 (20%), Positives = 44/135 (32%), Gaps = 14/135 (10%)

Query: 3   KFGYLNYDNSNNQTHANDDDFDELLESAIKNYQLNYHLKSTEVLDAGTVGKMRT------ 56
            +  L  D        +       +   I+  Q    L+ T  LD+ T+  MR       
Sbjct: 23  NYYDLKKDVKQFVRRKDSGP----VVKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVP 78

Query: 57  -HDAELQILGSPRWPASKFSLTYAFLPG--TRGDAINPVARAFQTWAPNTQFQFAESQDY 113
                    G P+W  +  +           +    + V +A + W   T   F+   + 
Sbjct: 79  DVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYE- 137

Query: 114 RNADIKISFESGDHG 128
             ADI ISF   +HG
Sbjct: 138 GEADIMISFAVREHG 152
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Length = 450 Back     alignment and structure
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Length = 425 Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Length = 631 Back     alignment and structure
>1eak_A 72 kDa type IV collagenase; hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase A, hydrolase- hydrolase inhib complex; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Length = 421 Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Length = 365 Back     alignment and structure
>1rm8_A MMP-16, matrix metalloproteinase-16, MT3-MMP; membrane type - matrix metalloproteinase, batimastat, hydroxamate inhibitor, protease, hydrolase; HET: BAT; 1.80A {Homo sapiens} SCOP: d.92.1.11 Length = 169 Back     alignment and structure
>1i76_A MMP-8;, neutrophil collagenase; hydrolase, complex (metalloprotease/inhibitor); HET: BSI; 1.20A {Homo sapiens} SCOP: d.92.1.11 PDB: 1i73_A* 1jao_A* 1jap_A 1jaq_A* 1jj9_A* 1mmb_A* 1zp5_A* 1zs0_A* 1zvx_A* 3dng_A* 3dpe_A* 3dpf_A* 1kbc_A* 1jan_A* 1bzs_A* 1mnc_A* 2oy2_A 1a86_A* 1jh1_A* 1a85_A ... Length = 163 Back     alignment and structure
>2xs4_A Karilysin protease; hydrolase, bacterial MMP, virulence factor, metalloprotease, dependent, peptidase; 1.70A {Tannerella forsythia} PDB: 2xs3_A Length = 167 Back     alignment and structure
>2jsd_A Matrix metalloproteinase-20; MMP-NNGH, structural genomics, structural proteomics in europe, spine, spine-2, spine2-complexes, hydrolase; HET: NGH; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>1hy7_A Stromelysin-1, MMP-3; mixed alpha beta structure, zinc protease, inhibited, hydrol; HET: MBS; 1.50A {Homo sapiens} SCOP: d.92.1.11 PDB: 1biw_A* 1bm6_A* 1bqo_A* 1b3d_A* 1cqr_A 1d5j_A* 1d7x_A* 1d8f_A* 1d8m_A* 1g05_A* 1g49_A* 1c3i_A* 1sln_A* 1uea_A 2srt_A* 1ums_A* 1umt_A* 2d1o_A* 3oho_A* 1ciz_A* ... Length = 173 Back     alignment and structure
>1cge_A Fibroblast collagenase; hydrolase (metalloprotease); 1.90A {Homo sapiens} SCOP: d.92.1.11 PDB: 2j0t_A 1ayk_A 1hfc_A* 2ayk_A 2tcl_A* 3ayk_A* 4ayk_A* 1cgl_A* 1cgf_A 966c_A* 3shi_A Length = 168 Back     alignment and structure
>830c_A MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 1.60A {Homo sapiens} SCOP: d.92.1.11 PDB: 456c_A* 1you_A* 4a7b_A* 3tvc_A* 1eub_A* 1xuc_A* 1xud_A* 1xur_A* 2yig_A* 3elm_A* 3i7g_A* 3i7i_A* 3zxh_A* 2ow9_A* 2ozr_A* 3kek_A* 3kej_A* 3kec_A* 2d1n_A* 1fls_A* ... Length = 168 Back     alignment and structure
>3ayu_A 72 kDa type IV collagenase; protease, hydrolase-hydrolase inhibitor complex; 2.00A {Homo sapiens} PDB: 1qib_A 1hov_A* Length = 167 Back     alignment and structure
>1y93_A Macrophage metalloelastase; matrix metalloproteinase, MMP12, complex (elastase inhibitor), acetohydroxamic acid, hydrola; 1.03A {Homo sapiens} SCOP: d.92.1.11 PDB: 1rmz_A 1ycm_A* 1z3j_A* 2hu6_A* 2oxu_A 2oxw_A 2oxz_A 3lik_A* 3lil_A* 3lir_A* 3ljg_A* 1os9_A 1os2_A 3f17_A* 3ehy_A* 3ehx_A* 3f15_A* 3f16_A* 3f18_A* 3f19_A* ... Length = 159 Back     alignment and structure
>2y6d_A Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapiens} PDB: 2ddy_A* 1mmq_A* 1mmp_A* 1mmr_A* 2y6c_A* Length = 174 Back     alignment and structure
>2ovx_A Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) type IV collagenase) (92 kDa gelatinase)...; S1-prime pocket, hydrolase-hydrola inhibitor complex; HET: 4MR; 2.00A {Homo sapiens} SCOP: d.92.1.11 PDB: 2ovz_A* 2ow0_A* 2ow1_A* 2ow2_A* 1gkd_A* 1gkc_A* Length = 159 Back     alignment and structure
>3ma2_D Matrix metalloproteinase-14; protein - protein complex, cleavage on PAIR of basic residue disulfide bond, membrane, metal-binding; 2.05A {Homo sapiens} PDB: 1bqq_M 1buv_M Length = 181 Back     alignment and structure
>1hv5_A Stromelysin 3; inhibition, phosphinic inhibitor, hydrolase; HET: CPS RXP; 2.60A {Mus musculus} SCOP: d.92.1.11 Length = 165 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
1slm_A255 Stromelysin-1; hydrolase, metalloprotease, fibrobl 100.0
1eak_A 421 72 kDa type IV collagenase; hydrolase-hydrolase in 100.0
1l6j_A 425 Matrix metalloproteinase-9; twisted beta sheet fla 100.0
1ck7_A 631 Protein (gelatinase A); hydrolase (metalloprotease 100.0
1su3_A 450 Interstitial collagenase; prodomain, hemopexin dom 100.0
830c_A168 MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 99.97
3ma2_D181 Matrix metalloproteinase-14; protein - protein com 99.97
2ovx_A159 Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) 99.96
1kap_P 479 Alkaline protease; calcium binding protein, zinc m 99.96
2xs4_A167 Karilysin protease; hydrolase, bacterial MMP, viru 99.96
3ayu_A167 72 kDa type IV collagenase; protease, hydrolase-hy 99.96
2y6d_A174 Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapie 99.95
1hy7_A173 Stromelysin-1, MMP-3; mixed alpha beta structure, 99.95
1i76_A163 MMP-8;, neutrophil collagenase; hydrolase, complex 99.95
1cge_A168 Fibroblast collagenase; hydrolase (metalloprotease 99.95
1k7i_A 479 PROC, secreted protease C; metalloprotease, hydrol 99.95
1hv5_A165 Stromelysin 3; inhibition, phosphinic inhibitor, h 99.95
1y93_A159 Macrophage metalloelastase; matrix metalloproteina 99.95
1rm8_A169 MMP-16, matrix metalloproteinase-16, MT3-MMP; memb 99.94
2jsd_A160 Matrix metalloproteinase-20; MMP-NNGH, structural 99.94
3ba0_A 365 Macrophage metalloelastase; FULL-length MMP-12, he 99.92
1sat_A 471 Serratia protease; parallel beta helix, parallel b 99.91
1g9k_A 463 Serralysin; beta jelly roll, hydrolase; 1.96A {Pse 99.91
1c7k_A132 NCNP, zinc endoprotease; alpha and beta protein, m 99.76
3edh_A201 Bone morphogenetic protein 1; vicinal disulfide, a 99.66
3lq0_A235 Proastacin; metallopeptidase, zymogen activation, 99.6
3lqb_A199 Hatching enzyme, LOC792177 protein; hydrolase, met 99.53
4gwm_A 592 Meprin A subunit beta; mulidomain structure, hydro 99.02
1lbu_A213 Muramoyl-pentapeptide carboxypeptidase; hydrolase, 97.79
3bkh_A268 Phikz144, lytic transglycosylase; bacteriophage, e 97.35
4fet_B222 Spore cortex-lytic enzyme prepeptide; transglycosy 97.21
2w15_A202 Zinc metalloproteinase BAP1; hydrolase inhibitor c 97.0
1kuf_A203 Atrolysin E, metalloproteinase; alpha/beta protein 96.94
1bud_A197 Protein (acutolysin A); metalloproteinase, snake v 96.94
1atl_A202 Atrolysin C; metalloendopeptidase, hydrolase-hydro 96.93
4axq_A163 Archaemetzincin; metalloprotease, protease, hydrol 96.92
1yp1_A202 FII; FII hydrolase; 1.90A {Deinagkistrodon acutus} 96.92
1qua_A197 Acutolysin-C, hemorrhagin III; metalloprotease, he 96.91
2cki_A262 Ulilysin; metalloprotease, hydrolase; HET: ARG; 1. 96.88
3b8z_A217 Protein adamts-5; alpha/beta, hydrolase; HET: 294; 96.74
1r55_A214 ADAM 33; metalloprotease, inhibitor, asthma, hydro 96.68
2ddf_A257 ADAM 17; hydrolase; HET: INN CIT; 1.70A {Homo sapi 96.67
3lmc_A210 Peptidase, zinc-dependent; structural genomics, PS 96.54
2v4b_A 300 Adamts-1; zymogen, protease, hydrolase, metallopro 96.53
4dd8_A208 Disintegrin and metalloproteinase domain-containi 96.52
2rjp_A 316 Adamts-4; metalloprotease domain, aggrecanase, cle 96.44
2i47_A288 ADAM 17; TACE-inhibitor complex, hydrolase; HET: I 96.42
2x7m_A195 Archaemetzincin; metalloprotease, protease, hydrol 96.4
2rjq_A 378 Adamts-5; metalloprotease domain, aggrecanase, cle 96.38
2e3x_A 427 Coagulation factor X-activating enzyme light CHAI; 96.3
2ero_A 427 VAP-1, vascular apoptosis-inducing protein 1; meta 96.29
2dw0_A 419 Catrocollastatin; apoptotic toxin, SVMP, metallopr 96.28
3d2y_A261 N-acetylmuramoyl-L-alanine amidase AMID; zinc amid 96.0
3k7n_A 397 K-like; SVMP, hydrolase; HET: NAG FUC FUL; 2.30A { 95.92
3k7l_A 422 Atragin; SVMP, metalloprotease, hydrolase; HET: NA 95.88
3g5c_A 510 ADAM 22; alpha/beta fold, cross-linked domain, cel 95.14
3p24_A397 BFT-3; metzincins, metalloendopeptidase, hydrolase 94.87
1lml_A 478 Leishmanolysin; metalloprotease, glycoprotein; 1.8 93.69
3p1v_A407 Metallo-endopeptidase; structural genomics, joint 93.4
2ikb_A167 Hypothetical protein NMB1012; structural genomics, 91.04
3ujz_A 869 Metalloprotease STCE; mucin-type glycoprotein, hyd 90.12
3e11_A114 Predicted zincin-like metalloprotease; DUF1025 fam 89.11
2nr7_A195 Secretion activator protein, putative; APCC85792, 87.98
3cqb_A107 Probable protease HTPX homolog; heat shock protein 87.58
2ejq_A130 Hypothetical protein TTHA0227; NPPSFA, national pr 84.7
3c37_A 253 Peptidase, M48 family; Q74D82, GSR143A, structural 81.89
>1slm_A Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 Back     alignment and structure
Probab=100.00  E-value=1.2e-45  Score=300.16  Aligned_cols=161  Identities=25%  Similarity=0.296  Sum_probs=134.1

Q ss_pred             CCCccCCCCCCCCCCCCCCCcchhHHHHHHHHHHHHhcCCCccccCChHHhhhhhcC-----Cc-ccc-ccCCCCCCCCC
Q 042321            1 MGKFGYLNYDNSNNQTHANDDDFDELLESAIKNYQLNYHLKSTEVLDAGTVGKMRTH-----DA-ELQ-ILGSPRWPASK   73 (169)
Q Consensus         1 L~~fGYl~~~~~~~~~~~~~~~~~~~~~~ai~~~Q~~~gL~~TG~lD~~T~~~m~~p-----D~-~~~-~~g~~kW~~~k   73 (169)
                      |+|||||++.....    ....+++++++||+.||+|+|||+||+||++|+++|++|     |+ +|. ++++.||+  +
T Consensus        21 L~~~gyl~~~~~~~----~~~~~~~~~~~ai~~~Q~~~~l~~tG~ld~~t~~~m~~pRCgv~d~~~~~~~~~~~kW~--~   94 (255)
T 1slm_A           21 LENYYDLKKDVKQF----VRRKDSGPVVKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWR--K   94 (255)
T ss_dssp             HHHHSCCCCC-------------CHHHHHHHHHHHHHTTCCCCSSCCHHHHHHTTSCBCSSCSSSCCSSCCCCSSCS--C
T ss_pred             HHHcCCCCCccccc----ccccchHHHHHHHHHHHHHcCCCCccccCHHHHHHhcCCCCCcccccceeeccCCCcCC--C
Confidence            67999998754322    112246899999999999999999999999999999999     65 566 67778999  9


Q ss_pred             cceEEEeccCCch----hhHHHHHHHHHhhccCCCcceEeccCCCcccEEEEeecCCCCCCCCCCCCC------------
Q 042321           74 FSLTYAFLPGTRG----DAINPVARAFQTWAPNTQFQFAESQDYRNADIKISFESGDHGAGALSTAVV------------  137 (169)
Q Consensus        74 ~~LTy~~~~~~~~----~~~~~i~~Af~~Ws~vt~L~F~ev~~~~~ADI~I~F~~~~Hgd~~pfd~~~------------  137 (169)
                      ++|||+|.+++++    +++++|++||+.|+++++|+|+|+.. ..|||+|.|.++.|||++||||..            
T Consensus        95 ~~ltY~i~~~~~~l~~~~~~~~i~~A~~~W~~vt~l~F~e~~~-~~adI~I~f~~~~hgd~~~fdG~~g~lahA~~P~~~  173 (255)
T 1slm_A           95 THLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYE-GEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPG  173 (255)
T ss_dssp             SEEEEEECCCCTTSCHHHHHHHHHHHHHHHHTTSSCEEEECSS-SCCSEEEEEECSCCSSSCCCCSSSSBCEEECCSSST
T ss_pred             CccceEeccCCCCCCHHHHHHHHHHHHHHHHhcCCeeEEEecC-CCcceeeeeeccCCCCccceeCCCCeeeeeecCCCC
Confidence            9999999987654    68999999999999999999999976 489999999999999999998642            


Q ss_pred             ----------CceeecccccchHHHHHHhhhhhcCCCCccC
Q 042321          138 ----------ESWLMLQLLLESQSVCMELIFKELGIFINYN  168 (169)
Q Consensus       138 ----------e~w~~~~~~~~~~~va~HEiGHaLGL~h~~~  168 (169)
                                +.|+....+++++.||+|||||||||.|+-+
T Consensus       174 ~~G~ihfd~~e~w~~~~~g~~l~~va~HEiGHaLGL~Hs~~  214 (255)
T 1slm_A          174 INGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSAN  214 (255)
T ss_dssp             TTTCEEEETTSCEESSSSSEEHHHHHHHHHHHHTTCCCCSC
T ss_pred             cCceEEeCCCCccccCCceeeehhhhHHHHHHHhcCCCCCC
Confidence                      4565433567799999999999999999753
>1eak_A 72 kDa type IV collagenase; hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase A, hydrolase- hydrolase inhib complex; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Back     alignment and structure
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>830c_A MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 1.60A {Homo sapiens} SCOP: d.92.1.11 PDB: 456c_A* 1you_A* 4a7b_A* 3tvc_A* 1eub_A* 1xuc_A* 1xud_A* 1xur_A* 2yig_A* 3elm_A* 3i7g_A* 3i7i_A* 3zxh_A* 2ow9_A* 2ozr_A* 3kek_A* 3kej_A* 3kec_A* 2d1n_A* 1fls_A* ... Back     alignment and structure
>3ma2_D Matrix metalloproteinase-14; protein - protein complex, cleavage on PAIR of basic residue disulfide bond, membrane, metal-binding; 2.05A {Homo sapiens} SCOP: d.92.1.11 PDB: 1bqq_M 1buv_M Back     alignment and structure
>2ovx_A Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) type IV collagenase) (92 kDa gelatinase)...; S1-prime pocket, hydrolase-hydrola inhibitor complex; HET: 4MR; 2.00A {Homo sapiens} SCOP: d.92.1.11 PDB: 2ovz_A* 2ow0_A* 2ow1_A* 2ow2_A* 1gkd_A* 1gkc_A* Back     alignment and structure
>1kap_P Alkaline protease; calcium binding protein, zinc metalloprotease; 1.64A {Pseudomonas aeruginosa} SCOP: b.80.7.1 d.92.1.6 PDB: 1jiw_P 1akl_A Back     alignment and structure
>2xs4_A Karilysin protease; hydrolase, bacterial MMP, virulence factor, metalloprotease, dependent, peptidase; 1.70A {Tannerella forsythia} PDB: 2xs3_A Back     alignment and structure
>3ayu_A 72 kDa type IV collagenase; protease, hydrolase-hydrolase inhibitor complex; 2.00A {Homo sapiens} PDB: 1qib_A 1hov_A* Back     alignment and structure
>2y6d_A Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapiens} PDB: 2ddy_A* 1mmq_A* 1mmp_A* 1mmr_A* 2y6c_A* Back     alignment and structure
>1hy7_A Stromelysin-1, MMP-3; mixed alpha beta structure, zinc protease, inhibited, hydrol; HET: MBS; 1.50A {Homo sapiens} SCOP: d.92.1.11 PDB: 1biw_A* 1bm6_A* 1bqo_A* 1b3d_A* 1cqr_A 1d5j_A* 1d7x_A* 1d8f_A* 1d8m_A* 1g05_A* 1g49_A* 1c3i_A* 1sln_A* 1uea_A 2srt_A* 1ums_A* 1umt_A* 2d1o_A* 3oho_A* 1ciz_A* ... Back     alignment and structure
>1i76_A MMP-8;, neutrophil collagenase; hydrolase, complex (metalloprotease/inhibitor); HET: BSI; 1.20A {Homo sapiens} SCOP: d.92.1.11 PDB: 1i73_A* 1jao_A* 1jap_A 1jaq_A* 1jj9_A* 1mmb_A* 1zp5_A* 1zs0_A* 1zvx_A* 3dng_A* 3dpe_A* 3dpf_A* 1kbc_A* 1jan_A* 1bzs_A* 1mnc_A* 2oy2_A 1a86_A* 1jh1_A* 1a85_A ... Back     alignment and structure
>1cge_A Fibroblast collagenase; hydrolase (metalloprotease); 1.90A {Homo sapiens} SCOP: d.92.1.11 PDB: 2j0t_A 1ayk_A 1hfc_A* 2ayk_A 2tcl_A* 3ayk_A* 4ayk_A* 1cgl_A* 1cgf_A 966c_A* 3shi_A Back     alignment and structure
>1k7i_A PROC, secreted protease C; metalloprotease, hydrolase; 1.59A {Erwinia chrysanthemi} SCOP: b.80.7.1 d.92.1.6 PDB: 1k7g_A 1k7q_A 1go8_P 3hbv_P 3hda_P 3hbu_P 1go7_P 3hb2_P Back     alignment and structure
>1hv5_A Stromelysin 3; inhibition, phosphinic inhibitor, hydrolase; HET: CPS RXP; 2.60A {Mus musculus} SCOP: d.92.1.11 Back     alignment and structure
>1y93_A Macrophage metalloelastase; matrix metalloproteinase, MMP12, complex (elastase inhibitor), acetohydroxamic acid, hydrola; 1.03A {Homo sapiens} SCOP: d.92.1.11 PDB: 1rmz_A 1ycm_A* 1z3j_A* 2hu6_A* 2oxu_A 2oxw_A 2oxz_A 3lik_A* 3lil_A* 3lir_A* 3ljg_A* 1os9_A 1os2_A 3f17_A* 3ehy_A* 3ehx_A* 3f15_A* 3f16_A* 3f18_A* 3f19_A* ... Back     alignment and structure
>1rm8_A MMP-16, matrix metalloproteinase-16, MT3-MMP; membrane type - matrix metalloproteinase, batimastat, hydroxamate inhibitor, protease, hydrolase; HET: BAT; 1.80A {Homo sapiens} SCOP: d.92.1.11 Back     alignment and structure
>2jsd_A Matrix metalloproteinase-20; MMP-NNGH, structural genomics, structural proteomics in europe, spine, spine-2, spine2-complexes, hydrolase; HET: NGH; NMR {Homo sapiens} Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>1sat_A Serratia protease; parallel beta helix, parallel beta roll, hydrolase (serine protease); 1.75A {Serratia marcescens} SCOP: b.80.7.1 d.92.1.6 PDB: 1af0_A* 1smp_A 1srp_A Back     alignment and structure
>1g9k_A Serralysin; beta jelly roll, hydrolase; 1.96A {Pseudomonas} SCOP: b.80.7.1 d.92.1.6 PDB: 1o0q_A 1o0t_A 1om6_A 1om7_A 1om8_A 1omj_A 1h71_P Back     alignment and structure
>1c7k_A NCNP, zinc endoprotease; alpha and beta protein, metalloproteinase, hydrolase; 1.00A {Streptomyces caespitosus} SCOP: d.92.1.1 PDB: 1kuh_A Back     alignment and structure
>3edh_A Bone morphogenetic protein 1; vicinal disulfide, alternative splicing, calcium, chondrogenesis, cleavage on PAIR of basic residues, cytokine; 1.25A {Homo sapiens} SCOP: d.92.1.0 PDB: 3edg_A 3edi_A Back     alignment and structure
>3lq0_A Proastacin; metallopeptidase, zymogen activation, proenzyme, protease, D bond, hydrolase, metal-binding, metalloprotease, zymogen; 1.45A {Astacus astacus} PDB: 1iab_A 1iaa_A 1ast_A 1iac_A 1iad_A 1iae_A 1qji_A* 1qjj_A Back     alignment and structure
>3lqb_A Hatching enzyme, LOC792177 protein; hydrolase, metalloprotease, astacin, metal- protease; 1.10A {Danio rerio} Back     alignment and structure
>4gwm_A Meprin A subunit beta; mulidomain structure, hydrolase; HET: NAG BMA FUC MAN; 1.85A {Homo sapiens} PDB: 4gwn_A* Back     alignment and structure
>1lbu_A Muramoyl-pentapeptide carboxypeptidase; hydrolase, nuclear receptor; 1.80A {Streptomyces albus} SCOP: a.20.1.1 d.65.1.1 Back     alignment and structure
>3bkh_A Phikz144, lytic transglycosylase; bacteriophage, endolysin, peptidoglycan, cell WALL degradation, lysozyme, hydrolase; 2.50A {Pseudomonas phage phikz} PDB: 3bkv_A* Back     alignment and structure
>4fet_B Spore cortex-lytic enzyme prepeptide; transglycosylase, cortex hydrolase domain, sodium ION, seMet hydrolase; 1.91A {Bacillus anthracis} Back     alignment and structure
>2w15_A Zinc metalloproteinase BAP1; hydrolase inhibitor complex, metal-binding, zinc-depending, metalloprotease, metalloproteinase/inhibitor complex; HET: WR2; 1.05A {Bothrops asper} PDB: 2w12_A* 2w13_A* 2w14_A* 1nd1_A 3gbo_A Back     alignment and structure
>1kuf_A Atrolysin E, metalloproteinase; alpha/beta protein, hydrolase; 1.35A {Protobothrops mucrosquamatus} SCOP: d.92.1.9 PDB: 1kui_A 1kuk_A 1kug_A 1wni_A Back     alignment and structure
>1bud_A Protein (acutolysin A); metalloproteinase, snake venom, MMP, toxin; 1.90A {Deinagkistrodon acutus} SCOP: d.92.1.9 PDB: 1bsw_A Back     alignment and structure
>1atl_A Atrolysin C; metalloendopeptidase, hydrolase-hydrolase inhibitor complex; HET: 0QI; 1.80A {Crotalus atrox} SCOP: d.92.1.9 PDB: 1htd_A 1dth_A* 3aig_A* 2aig_P* 4aig_A* 1iag_A Back     alignment and structure
>4axq_A Archaemetzincin; metalloprotease, protease, hydrolase, metal-bindi; 1.40A {Archaeoglobus fulgidus} PDB: 2xhq_A 3zvs_A 4a3w_A* Back     alignment and structure
>1yp1_A FII; FII hydrolase; 1.90A {Deinagkistrodon acutus} Back     alignment and structure
>1qua_A Acutolysin-C, hemorrhagin III; metalloprotease, hemorrhagic toxin, snake venom proteinase; 2.20A {Deinagkistrodon acutus} SCOP: d.92.1.9 Back     alignment and structure
>2cki_A Ulilysin; metalloprotease, hydrolase; HET: ARG; 1.7A {Methanosarcina acetivorans} PDB: 2j83_A* 3lum_A* 3lun_A* Back     alignment and structure
>3b8z_A Protein adamts-5; alpha/beta, hydrolase; HET: 294; 1.40A {Homo sapiens} PDB: 3hyg_A* 3hy9_A* 3hy7_A* 3ljt_A* Back     alignment and structure
>1r55_A ADAM 33; metalloprotease, inhibitor, asthma, hydrolase; HET: NAG MAN 097; 1.58A {Homo sapiens} SCOP: d.92.1.9 PDB: 1r54_A* Back     alignment and structure
>2ddf_A ADAM 17; hydrolase; HET: INN CIT; 1.70A {Homo sapiens} PDB: 2fv5_A* 3l0v_A* 3kme_A* 3l0t_A* 3kmc_A* 3le9_A* 3lea_A* 3lgp_A* 3o64_A* 3ewj_A* 3edz_A* 3e8r_A* 2fv9_A* 1zxc_A* 2oi0_A* 3b92_A* 2a8h_A* 1bkc_A* 3cki_A 1bkc_I* ... Back     alignment and structure
>3lmc_A Peptidase, zinc-dependent; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, MUR16; 2.00A {Methanocorpusculum labreanum} Back     alignment and structure
>2v4b_A Adamts-1; zymogen, protease, hydrolase, metalloprotease, heparin-binding, metalloproteinase, metzincin, glycoprotein metal-binding; 2.00A {Homo sapiens} PDB: 2jih_A 3q2g_A* 3q2h_A* Back     alignment and structure
>4dd8_A Disintegrin and metalloproteinase domain-containi 8; batimastat, inflammation, alpha/beta motif, metalloproteinas allergic asthma, tumorigenesis; HET: BAT; 2.10A {Homo sapiens} Back     alignment and structure
>2rjp_A Adamts-4; metalloprotease domain, aggrecanase, cleavage on PAIR of basic residues, extracellular matrix, glycoprotein, hydrolase, metal-binding; HET: 886; 2.80A {Homo sapiens} PDB: 3b2z_A Back     alignment and structure
>2i47_A ADAM 17; TACE-inhibitor complex, hydrolase; HET: INN KGY; 1.90A {Homo sapiens} SCOP: d.92.1.10 PDB: 3g42_A* Back     alignment and structure
>2x7m_A Archaemetzincin; metalloprotease, protease, hydrolase, metal-bindi; 1.50A {Methanopyrus kandleri} Back     alignment and structure
>2rjq_A Adamts-5; metalloprotease domain, aggrecanase, cleavage on PAIR of BAS residues, extracellular matrix, glycoprotein, hydrolase, ME binding; HET: NAG BAT; 2.60A {Homo sapiens} Back     alignment and structure
>2e3x_A Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis} Back     alignment and structure
>2ero_A VAP-1, vascular apoptosis-inducing protein 1; metalloprotease, disintegrin, calcium-binding, ADAM, SVMP, M protein, toxin; HET: NAG; 2.50A {Crotalus atrox} PDB: 2erp_A* 2erq_A* Back     alignment and structure
>2dw0_A Catrocollastatin; apoptotic toxin, SVMP, metalloproteinase, apoptosis, toxin; HET: NAG BMA MAN GM6; 2.15A {Crotalus atrox} PDB: 2dw1_A* 2dw2_A* 3dsl_A* 3hdb_A* Back     alignment and structure
>3d2y_A N-acetylmuramoyl-L-alanine amidase AMID; zinc amidase, PGRP, peptidoglycan recognizing protein, AMPD, acetylmuramyl-L-alanine amidase; HET: AH0; 1.75A {Escherichia coli} PDB: 2bh7_A 2wkx_A 2bgx_A* 3d2z_A Back     alignment and structure
>3k7n_A K-like; SVMP, hydrolase; HET: NAG FUC FUL; 2.30A {Naja atra} Back     alignment and structure
>3k7l_A Atragin; SVMP, metalloprotease, hydrolase; HET: NAG; 2.50A {Naja atra} Back     alignment and structure
>3g5c_A ADAM 22; alpha/beta fold, cross-linked domain, cell adhesion, cleavag of basic residues, EGF-like domain, glycoprotein, membrane, phosphoprotein; HET: NAG; 2.36A {Homo sapiens} Back     alignment and structure
>3p24_A BFT-3; metzincins, metalloendopeptidase, hydrolase; HET: PG4; 1.80A {Bacteroides fragilis} Back     alignment and structure
>1lml_A Leishmanolysin; metalloprotease, glycoprotein; 1.86A {Leishmania major} SCOP: d.92.1.3 Back     alignment and structure
>3p1v_A Metallo-endopeptidase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; HET: MSE; 1.93A {Bacteroides ovatus atcc 8483} PDB: 4df9_A* Back     alignment and structure
>2ikb_A Hypothetical protein NMB1012; structural genomics, PSI-2, MCSG, PR structure initiative; 1.70A {Neisseria meningitidis} SCOP: d.2.1.9 PDB: 2is5_A* Back     alignment and structure
>3ujz_A Metalloprotease STCE; mucin-type glycoprotein, hydrolase; 2.50A {Escherichia coli} Back     alignment and structure
>3e11_A Predicted zincin-like metalloprotease; DUF1025 family protein, zincin-like fold, conserved matrix metalloprotease motif; 1.80A {Acidothermus cellulolyticus 11B} SCOP: d.92.1.17 Back     alignment and structure
>2nr7_A Secretion activator protein, putative; APCC85792, porphyromonas gingivalis W83 structural genomics, PSI-2, protein structure initiative; 1.30A {Porphyromonas gingivalis} SCOP: d.2.1.9 Back     alignment and structure
>3cqb_A Probable protease HTPX homolog; heat shock protein HTPX domain, PSI-2, protein structure INI structural genomics; HET: MSE; 1.86A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2ejq_A Hypothetical protein TTHA0227; NPPSFA, national project on protein structural and functional analyses; 2.08A {Thermus thermophilus} SCOP: d.92.1.17 Back     alignment and structure
>3c37_A Peptidase, M48 family; Q74D82, GSR143A, structural genomics, protein structure initiative, northeast structural genomics consortium; 1.70A {Geobacter sulfurreducens pca} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 169
d1mmqa_166 d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sap 6e-09
d1slma165 a.20.1.2 (A:16-80) Stromelysin-1 (MMP-3) {Human (H 1e-08
d1i76a_163 d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Hum 3e-08
d1su3a167 a.20.1.2 (A:32-98) Fibroblast collagenase (MMP-1) 8e-08
d1eaka176 a.20.1.2 (A:32-107) Gelatinase A (MMP-2) {Human (H 4e-07
d2ovxa1159 d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human 4e-07
d1hy7a_168 d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo 7e-07
d1l6ja177 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (H 8e-07
d1xuca1169 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Huma 9e-07
d1hv5a_162 d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus 4e-06
d1rm8a_169 d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16 6e-06
d1sata2243 d.92.1.6 (A:4-246) Metalloprotease {Serratia marce 6e-06
d1qiba_161 d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) 9e-06
d1hfca_157 d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Hum 2e-05
d1k7ia2241 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrys 3e-05
d1bqqm_174 d.92.1.11 (M:) Membrane-type matrix metalloprotein 3e-05
d1y93a1158 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) 3e-05
d1g9ka2242 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp 4e-04
d1kapp2246 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas ae 6e-04
>d1mmqa_ d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Matrix metalloproteases, catalytic domain
domain: Matrilysin (MMP-7)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 50.2 bits (119), Expect = 6e-09
 Identities = 18/71 (25%), Positives = 25/71 (35%), Gaps = 7/71 (9%)

Query: 65  GSPRWPASKFSLTYAFLPGT----RGDAINPVARAFQTWAPNTQFQFAESQDYRNADIKI 120
            SP+W      +TY  +  T           V++A   W       F +   +  ADI I
Sbjct: 6   NSPKWT--SKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRK-VVWGTADIMI 62

Query: 121 SFESGDHGAGA 131
            F  G HG   
Sbjct: 63  GFARGAHGDSY 73
>d1slma1 a.20.1.2 (A:16-80) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1i76a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]} Length = 163 Back     information, alignment and structure
>d1su3a1 a.20.1.2 (A:32-98) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1eaka1 a.20.1.2 (A:32-107) Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2ovxa1 d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1hy7a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1l6ja1 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1xuca1 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1hv5a_ d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxId: 10090]} Length = 162 Back     information, alignment and structure
>d1rm8a_ d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16) {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1sata2 d.92.1.6 (A:4-246) Metalloprotease {Serratia marcescens [TaxId: 615]} Length = 243 Back     information, alignment and structure
>d1qiba_ d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1hfca_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d1k7ia2 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]} Length = 241 Back     information, alignment and structure
>d1bqqm_ d.92.1.11 (M:) Membrane-type matrix metalloproteinase (CDMT1-MMP) {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1y93a1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]} Length = 158 Back     information, alignment and structure
>d1g9ka2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]} Length = 242 Back     information, alignment and structure
>d1kapp2 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]} Length = 246 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
d1k7ia2241 Metalloprotease {Erwinia chrysanthemi [TaxId: 556] 99.94
d1mmqa_166 Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9 99.93
d1sata2243 Metalloprotease {Serratia marcescens [TaxId: 615]} 99.93
d1hv5a_162 Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxI 99.92
d1i76a_163 Neutrophil collagenase (MMP-8) {Human (Homo sapien 99.92
d1kapp2246 Metalloprotease {Pseudomonas aeruginosa [TaxId: 28 99.92
d1hy7a_168 Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibro 99.92
d1xuca1169 Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxI 99.91
d2ovxa1159 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 99.89
d1hfca_157 Fibroblast collagenase (MMP-1) {Human (Homo sapien 99.89
d1qiba_161 Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1y93a1158 Macrophage elastase (MMP-12) {Human (Homo sapiens) 99.87
d1rm8a_169 Matrix metalloproteinase-16 (MMP-16) {Human (Homo 99.84
d1bqqm_174 Membrane-type matrix metalloproteinase (CDMT1-MMP) 99.81
d1g9ka2242 Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId 99.74
d1slma165 Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibro 99.73
d1su3a167 Fibroblast collagenase (MMP-1) {Human (Homo sapien 99.72
d1l6ja177 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 99.64
d1eaka176 Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 99.6
d1asta_200 Astacin {European fresh water crayfish (Astacus as 99.45
d1c7ka_132 Zinc protease {Streptomyces caespitosus [TaxId: 53 98.98
d1lbua183 Zn2+ DD-carboxypeptidase, N-terminal domain {Strep 98.36
d1bswa_197 Snake venom metalloprotease {Five-pace snake (Agki 97.14
d1r55a_203 ADAM33 {Human (Homo sapiens) [TaxId: 9606]} 97.13
d1atla_200 Snake venom metalloprotease {Western diamonback ra 96.98
d1quaa_197 Snake venom metalloprotease {Chinese five-pace sna 96.98
d2i47a1254 TNF-alpha converting enzyme, TACE, catalytic domai 96.96
d1kufa_201 Snake venom metalloprotease {Taiwan habu (Trimeres 96.94
d1nd1a_202 Snake venom metalloprotease {Terciopelo (Bothrops 96.81
d2bgxa181 Probable N-acetylmuramoyl-L-alanine amidase YbjR, 96.68
d3e11a1113 Uncharacterized protein Acel_2062 {Acidothermus ce 90.86
d1lmla_ 475 Leishmanolysin {Leishmania major [TaxId: 5664]} 90.83
d2ikba1163 Hypothetical protein NMB1012 {Neisseria meningitid 82.48
>d1k7ia2 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Serralysin-like metalloprotease, catalytic (N-terminal) domain
domain: Metalloprotease
species: Erwinia chrysanthemi [TaxId: 556]

Probab=99.94  E-value=1.7e-27  Score=189.55  Aligned_cols=142  Identities=13%  Similarity=0.137  Sum_probs=102.2

Q ss_pred             cchhHHHHHHHHHHHHhcCCCcccc----CChHHhhhhhcCCccccccCCCCCCCCCcceEEEeccCCch----------
Q 042321           21 DDFDELLESAIKNYQLNYHLKSTEV----LDAGTVGKMRTHDAELQILGSPRWPASKFSLTYAFLPGTRG----------   86 (169)
Q Consensus        21 ~~~~~~~~~ai~~~Q~~~gL~~TG~----lD~~T~~~m~~pD~~~~~~g~~kW~~~k~~LTy~~~~~~~~----------   86 (169)
                      ++|+. +.++|+.|||+.||.+||+    +|+++.++| +++.++.-. ..+|.  +.+|||+|.+..+.          
T Consensus         5 ~~~~~-~~~~l~~~~r~~~l~v~gk~s~~~d~~~~~l~-R~~~~W~~~-~~~~~--~~~ltYsF~~~~~~~~~~~~~~~~   79 (241)
T d1k7ia2           5 SAYNS-VYDFLRYHDRGDGLTVNGKTSYSIDQAAAQIT-RENVSWNGT-NVFGK--SANLTFKFLQSVSSIPSGDTGFVK   79 (241)
T ss_dssp             HHHHH-HHHHTTTTCCSTTCEETTEECCCHHHHHHHHT-TTCEETTEE-SCCSC--CEEEEEEECSCCSCCTTSCBCCBC
T ss_pred             chHHH-HHHHHHHhccCCCcccCCccCcccchHhhhcc-cCCCccCCC-CCCCC--eeEEEEEccCCCCccccCCccccc
Confidence            34444 8999999999999999996    899988776 332222211 12344  66899999764322          


Q ss_pred             ---hhHHHHHHHHHhhccCCCcceEeccCCCcccEEEEeecCCCCCCCCCCCC------------CCceee--------c
Q 042321           87 ---DAINPVARAFQTWAPNTQFQFAESQDYRNADIKISFESGDHGAGALSTAV------------VESWLM--------L  143 (169)
Q Consensus        87 ---~~~~~i~~Af~~Ws~vt~L~F~ev~~~~~ADI~I~F~~~~Hgd~~pfd~~------------~e~w~~--------~  143 (169)
                         ++++++++||+.|++|++|+|+||.+...|||+|.+....+++..++...            ...|..        .
T Consensus        80 ~s~~q~~~~r~A~~~Ws~vani~F~ev~~~~~adi~~~~~~~~~~~~~~~~~~a~a~~p~~~~~~g~~~~~~~~~~~~~~  159 (241)
T d1k7ia2          80 FNAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNP  159 (241)
T ss_dssp             CCHHHHHHHHHHHHHHHTTBSEEEEECCTTCCCSEEEEEECBCTTSCBCCSCCEEECCSSSSTTTTEEEEETTSHHHHCT
T ss_pred             ccHHHHHHHHHHHHHHHhhcCCEEEEecCCCcccEEEEeeecCCCCcCCCCcceeeecCCCcccccceeeccccccccCC
Confidence               57899999999999999999999988778999999988777654433311            111211        0


Q ss_pred             ccccchHHHHHHhhhhhcCCCCcc
Q 042321          144 QLLLESQSVCMELIFKELGIFINY  167 (169)
Q Consensus       144 ~~~~~~~~va~HEiGHaLGL~h~~  167 (169)
                      ..+..++.|++|||||||||.|..
T Consensus       160 ~~g~~~~~t~~HEIGHaLGL~H~~  183 (241)
T d1k7ia2         160 GSEEYGRQTFTHEIGHALGLAHPG  183 (241)
T ss_dssp             TTSHHHHHHHHHHHHHHHTCCCSS
T ss_pred             ccchhHHHHHHHHHHHHhcCCCCC
Confidence            112236789999999999999964
>d1mmqa_ d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sata2 d.92.1.6 (A:4-246) Metalloprotease {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1hv5a_ d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i76a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kapp2 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hy7a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Back     information, alignment and structure
>d1xuca1 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovxa1 d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hfca_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qiba_ d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y93a1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rm8a_ d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqqm_ d.92.1.11 (M:) Membrane-type matrix metalloproteinase (CDMT1-MMP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9ka2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]} Back     information, alignment and structure
>d1slma1 a.20.1.2 (A:16-80) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Back     information, alignment and structure
>d1su3a1 a.20.1.2 (A:32-98) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6ja1 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaka1 a.20.1.2 (A:32-107) Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1asta_ d.92.1.8 (A:) Astacin {European fresh water crayfish (Astacus astacus) [TaxId: 6715]} Back     information, alignment and structure
>d1c7ka_ d.92.1.1 (A:) Zinc protease {Streptomyces caespitosus [TaxId: 53502]} Back     information, alignment and structure
>d1lbua1 a.20.1.1 (A:1-83) Zn2+ DD-carboxypeptidase, N-terminal domain {Streptomyces albus G [TaxId: 1962]} Back     information, alignment and structure
>d1bswa_ d.92.1.9 (A:) Snake venom metalloprotease {Five-pace snake (Agkistrodon acutus), acutolysin A [TaxId: 36307]} Back     information, alignment and structure
>d1r55a_ d.92.1.9 (A:) ADAM33 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1atla_ d.92.1.9 (A:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId: 8730]} Back     information, alignment and structure
>d1quaa_ d.92.1.9 (A:) Snake venom metalloprotease {Chinese five-pace snake (Agkistrodon acutus), acutolysin C [TaxId: 36307]} Back     information, alignment and structure
>d2i47a1 d.92.1.10 (A:220-473) TNF-alpha converting enzyme, TACE, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kufa_ d.92.1.9 (A:) Snake venom metalloprotease {Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E [TaxId: 103944]} Back     information, alignment and structure
>d1nd1a_ d.92.1.9 (A:) Snake venom metalloprotease {Terciopelo (Bothrops asper), bap1 [TaxId: 8722]} Back     information, alignment and structure
>d2bgxa1 a.20.1.1 (A:180-260) Probable N-acetylmuramoyl-L-alanine amidase YbjR, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3e11a1 d.92.1.17 (A:1-113) Uncharacterized protein Acel_2062 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
>d1lmla_ d.92.1.3 (A:) Leishmanolysin {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2ikba1 d.2.1.9 (A:1-163) Hypothetical protein NMB1012 {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure