Citrus Sinensis ID: 042366

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340---
NITTLDLRNNRIQGSILVPPPSTEVFLVSNNKLSGRIPPSICSLSFLQYLSLSDNNLSGTIPPCLGNFSTELITLHLKNNSLEGHIHDTFANAIVNVENNMTSDSFPCWLGSLPVLKILVLRSNRFDGPLCNSNITFPFQALRIIDLSHNEFTGFLPRRIFPSMEAMKNVDEQGRLEYMGGAFYDESITQKILVMFRAMDFSSNRFHGEIPEVLGNFKSLKVLNLSHNSLTGNIPVSFENMTALESLDLSFNKLDGRIPEQLLSVTALALLNLSHSRLWGRIPQGNQFNTFANDSYFGNIHLCGEPLTMRCSNDGLPKAPPSASTDHEEDETPSRFDWKMAKM
cccEEEccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccHHHccccccEEEcccccccccccHHccccEEEcccccccccccccccccccccEEEcccccccEEccccccccccccccEEEcccccccccccHHHHHHHHHHHcccccccEEEEcccEEEEEEEEEEEccEEEEEcccccccccccHHHHccccccccccccccccccccHHHHccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEc
ccEEEEccccccccccccccccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccccEEEccccEEEEEccHHHHHEEEEcccccccccccHHHccccccEEEEEccccccccccHHHccccccccEEEEcccccccccccHHHcccHHHHHHHHHHcccccccccccccccHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHHccHHHcccccEEEccccccccccccccccccccccccccccccccEEEEEEEc
nittldlrnnriqgsilvpppstevflvsnnklsgrippsicslSFLQYLslsdnnlsgtippclgnfSTELITLHLKnnsleghihdTFANAIVNVennmtsdsfpcwlgslpvlKILVLRsnrfdgplcnsnitfpfqaLRIIdlshneftgflprrifpsmeamKNVDEQGRLEymggafydeSITQKILVMFRAmdfssnrfhgeipevlgnfksLKVLNLshnsltgnipvsfenmtalesLDLSfnkldgripeQLLSVTALALLNLSHsrlwgripqgnqfntfandsyfgnihlcgepltmrcsndglpkappsastdheedetpsrfdwkmakm
nittldlrnnriqgsilvpppstEVFLVSNNKLSGRIPPSICSLSFLQYLSLSDNNLSGTIPPCLGNFSTELITLHLKNNSLEGHIHDTFANAIVNVENNMTSDSFPCWLGSLPVLKILVLRSNRFDGPLCNSNITFPFQALRIIDLSHNEFTGFLPRRIFPSMEAMKNVDEQGRLEYMGGAFYDESITQKILVMFRAMDFSSNRFHGEIPEVLGNFKSLKVLNLSHNSLTGNIPVSFENMTALESLDLSFNKLDGRIPEQLLSVTALALLNLSHSRLWGRIPQGNQFNTFANDSYFGNIHLCGEPLTMRCSNDGLPKappsastdheedetpsrfdwkmakm
NITTLDLRNNRIQGSILVPPPSTEVFLVSNNKLSGRIPPSICSLSFLQYLSLSDNNLSGTIPPCLGNFSTELITLHLKNNSLEGHIHDTFANAIVNVENNMTSDSFPCWLGSLPVLKILVLRSNRFDGPLCNSNITFPFQALRIIDLSHNEFTGFLPRRIFPSMEAMKNVDEQGRLEYMGGAFYDESITQKILVMFRAMDFSSNRFHGEIPEVLGNFKSLKVLNLSHNSLTGNIPVSFENMTALESLDLSFNKLDGRIPEQllsvtalallnlsHSRLWGRIPQGNQFNTFANDSYFGNIHLCGEPLTMRCSNDGLPKAPPSASTDHEEDETPSRFDWKMAKM
**************SILVP*PSTEVFLVSNNKLSGRIPPSICSLSFLQYLSLSDNNLSGTIPPCLGNFSTELITLHLKNNSLEGHIHDTFANAIVNVENNMTSDSFPCWLGSLPVLKILVLRSNRFDGPLCNSNITFPFQALRIIDLSHNEFTGFLPRRIFPSMEAMKNVDEQGRLEYMGGAFYDESITQKILVMFRAMDFSSNRFHGEIPEVLGNFKSLKVLNLSHNSLTGNIPVSFENMTALESLDLSFNKLDGRIPEQLLSVTALALLNLSHSRLWGRIPQGNQFNTFANDSYFGNIHLCGEPLTMR*********************************
NITTLDLRNNRIQGSILVPPPSTEVFLVSNNKLSGRIPPSICSLSFLQYLSLSDNNLSGTIPPCLGNFSTELITLHLKNNSLEGHIHDTFANAIVNVENNMTSDSFPCWLGSLPVLKILVLRSNRFDGPLCNSNITFPFQALRIIDLSHNEFTGFLPRRIFPSMEAM********LEYMGGAFYDESITQKILVMFRAMDFSSNRFHGEIPEVLGNFKSLKVLNLSHNSLTGNIPVSFENMTALESLDLSFNKLDGRIPEQLLSVTALALLNLSHSRLWGRIPQGNQFNTFANDSYFGNIHLCGEPLT**************************RFDWKMAKM
NITTLDLRNNRIQGSILVPPPSTEVFLVSNNKLSGRIPPSICSLSFLQYLSLSDNNLSGTIPPCLGNFSTELITLHLKNNSLEGHIHDTFANAIVNVENNMTSDSFPCWLGSLPVLKILVLRSNRFDGPLCNSNITFPFQALRIIDLSHNEFTGFLPRRIFPSMEAMKNVDEQGRLEYMGGAFYDESITQKILVMFRAMDFSSNRFHGEIPEVLGNFKSLKVLNLSHNSLTGNIPVSFENMTALESLDLSFNKLDGRIPEQLLSVTALALLNLSHSRLWGRIPQGNQFNTFANDSYFGNIHLCGEPLTMRCSNDG*******************RFDWKMAKM
NITTLDLRNNRIQGSILVPPPSTEVFLVSNNKLSGRIPPSICSLSFLQYLSLSDNNLSGTIPPCLGNFSTELITLHLKNNSLEGHIHDTFANAIVNVENNMTSDSFPCWLGSLPVLKILVLRSNRFDGPLCNSNITFPFQALRIIDLSHNEFTGFLPRRIFPSMEAMKNVDEQGRLEYMGGAFYDESITQKILVMFRAMDFSSNRFHGEIPEVLGNFKSLKVLNLSHNSLTGNIPVSFENMTALESLDLSFNKLDGRIPEQLLSVTALALLNLSHSRLWGRIPQGNQFNTFANDSYFGNIHLCGEPLTMRC*********************PSRFDWKMAKM
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NITTLDLRNNRIQGSILVPPPSTEVFLVSNNKLSGRIPPSICSLSFLQYLSLSDNNLSGTIPPCLGNFSTELITLHLKNNSLEGHIHDTFANAIVNVENNMTSDSFPCWLGSLPVLKILVLRSNRFDGPLCNSNITFPFQALRIIDLSHNEFTGFLPRRIFPSMEAMKNVDEQGRLEYMGGAFYDESITQKILVMFRAMDFSSNRFHGEIPEVLGNFKSLKVLNLSHNSLTGNIPVSFENMTALESLDLSFNKLDGRIPEQLLSVTALALLNLSHSRLWGRIPQGNQFNTFANDSYFGNIHLCGEPLTMRCSNDGLPKAPPSASTDHEEDETPSRFDWKMAKM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query343 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 no no 0.985 0.399 0.390 4e-53
Q00874372 DNA-damage-repair/tolerat no no 0.760 0.701 0.354 3e-30
O22476 1196 Protein BRASSINOSTEROID I no no 0.883 0.253 0.309 2e-29
Q42371 976 LRR receptor-like serine/ no no 0.731 0.257 0.309 7e-29
C0LGS2 1136 Probable LRR receptor-lik no no 0.813 0.245 0.330 1e-28
Q9FL28 1173 LRR receptor-like serine/ no no 0.877 0.256 0.316 1e-27
Q9ZVR7 1008 Phytosulfokine receptor 1 no no 0.854 0.290 0.321 3e-27
Q8VZG8 1045 Probable LRR receptor-lik no no 0.793 0.260 0.316 3e-27
Q6XAT2 967 LRR receptor-like serine/ no no 0.871 0.309 0.330 5e-27
C0LGW6 966 LRR receptor-like serine/ no no 0.868 0.308 0.324 7e-27
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  208 bits (530), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 142/364 (39%), Positives = 200/364 (54%), Gaps = 26/364 (7%)

Query: 2   ITTLDLRNNRIQGSI--LVPPPSTEVFL-VSNNKLSGRIPPSICSLS-FLQYLSLSDNNL 57
           I  LDL +N  QG I  ++   S+  FL +SNN  SG IP  I + S  ++ L+L DNN 
Sbjct: 445 IEELDLNSNSFQGPIPYMICKLSSLGFLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNF 504

Query: 58  SGTIPPCLGNFSTELITLHLKNNSLEGHIHDTFANA----IVNVENNMTSDSFPCWLGSL 113
           SGT+P      +TEL++L + +N LEG    +  N     +VNVE+N   D FP WL SL
Sbjct: 505 SGTLPDIFSK-ATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESL 563

Query: 114 PVLKILVLRSNRFDGPLCNSNITFPFQALRIIDLSHNEFTGFLPRRIFPSMEAMKNVDEQ 173
           P L +L LRSN+F GPL + + +  FQ+LRIID+SHN F+G LP   F + + M  + E+
Sbjct: 564 PSLHVLNLRSNKFYGPLYHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDMTTLTEE 623

Query: 174 GR------LEYMGGAFYDESITQKILVM--------FRAMDFSSNRFHGEIPEVLGNFKS 219
                     Y    +++  +  K + M        FRA+DFS N+ +G IPE LG  K 
Sbjct: 624 MDQYMTEFWRYADSYYHEMEMVNKGVDMSFERIRRDFRAIDFSGNKINGNIPESLGYLKE 683

Query: 220 LKVLNLSHNSLTGNIPVSFENMTALESLDLSFNKLDGRIPEQLLSVTALALLNLSHSRLW 279
           L+VLNLS N+ T  IP    N+T LE+LD+S NKL G+IP+ L +++ L+ +N SH+ L 
Sbjct: 684 LRVLNLSGNAFTSVIPRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQ 743

Query: 280 GRIPQGNQFNTFANDSYFGNIHLCGEPLTMRCSNDGLPKAPPSASTDHEEDETPSRFDWK 339
           G +P+G QF      S+  N  L G  L   C + G          D  E E  + F+W 
Sbjct: 744 GPVPRGTQFQRQKCSSFLDNPGLYG--LEDICRDTGALNPTSQLPEDLSEAEE-NMFNWV 800

Query: 340 MAKM 343
            A +
Sbjct: 801 AAAI 804
Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q00874|DR100_ARATH DNA-damage-repair/toleration protein DRT100 OS=Arabidopsis thaliana GN=DRT100 PE=2 SV=2 Back     alignment and function description
>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 Back     alignment and function description
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZVR7|PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis thaliana GN=PSKR1 PE=2 SV=4 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 Back     alignment and function description
>sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query343
224116970 921 predicted protein [Populus trichocarpa] 0.976 0.363 0.451 3e-82
255568090 1014 serine/threonine-protein kinase bri1, pu 0.997 0.337 0.451 2e-81
359493479 814 PREDICTED: receptor-like protein 12-like 0.979 0.412 0.479 3e-80
225455498 980 PREDICTED: receptor-like protein 12-like 0.976 0.341 0.456 2e-79
147793123 951 hypothetical protein VITISV_032542 [Viti 0.976 0.352 0.456 3e-79
359493544 978 PREDICTED: receptor-like protein 12-like 0.985 0.345 0.473 5e-79
359493539 1001 PREDICTED: receptor-like protein 12-like 0.985 0.337 0.473 1e-78
296089526 616 unnamed protein product [Vitis vinifera] 0.982 0.547 0.457 2e-77
359493546 985 PREDICTED: LRR receptor-like serine/thre 0.985 0.343 0.460 2e-76
225459979 979 PREDICTED: receptor-like protein 12-like 0.985 0.345 0.463 7e-76
>gi|224116970|ref|XP_002331797.1| predicted protein [Populus trichocarpa] gi|222874493|gb|EEF11624.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  311 bits (797), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 171/379 (45%), Positives = 235/379 (62%), Gaps = 44/379 (11%)

Query: 5   LDLRNNRIQGSILVPPPSTEVFLVSNNKLSGRIPPSICSLSFLQYLSLSDNNLSGTIPPC 64
           LDL +N +Q    + P S  + L++NNKL+G IPP IC+++  Q ++LS+N+LSG IP C
Sbjct: 502 LDLTSNLLQQPFPILPQSMYILLIANNKLTGEIPPWICNITTFQIINLSNNSLSGNIPQC 561

Query: 65  LGNFSTELITLHLKNNSLEGHIHDTFANA----------------------------IVN 96
           LGNFSTEL  L+L++NS  G I  +F                               +++
Sbjct: 562 LGNFSTELSVLNLRSNSFHGTIPGSFTEGNKIRSLDLNGNELEGSLPLSLANCKMLEVLD 621

Query: 97  VENNMTSDSFPCWLGSLPVLKILVLRSNRFDGPLCNSNITFPFQALRIIDLSHNEFTGFL 156
           + NN  +DSFP WL +LP L++LVLRSNR  G + N     PF +LRIIDLSHNEF G L
Sbjct: 622 LGNNYINDSFPLWLQTLPKLQVLVLRSNRLHGSIGNPTAISPFSSLRIIDLSHNEFIGLL 681

Query: 157 PRRIFPSMEAMKNVDEQGRL--EYMGGAFYDESIT----------QKILVMFRAMDFSSN 204
           P +   + +AMK VD + +   +Y+G  +Y +SI           ++IL +F  +D SSN
Sbjct: 682 PTQYIANFQAMKKVDGEVKATPKYIGEIYYQDSIVLTMKGTEIPMERILTIFTTIDLSSN 741

Query: 205 RFHGEIPEVLGNFKSLKVLNLSHNSLTGNIPVSFENMTALESLDLSFNKLDGRIPEQLLS 264
           RF G+IP+ +G   SL VLN+S NS+TG IP S  N+TALESLDLS N L G IP QL  
Sbjct: 742 RFEGQIPKEVGLLSSLIVLNISRNSVTGQIPSSLGNLTALESLDLSSNGLGGGIPSQLTR 801

Query: 265 VTALALLNLSHSRLWGRIPQGNQFNTFANDSYFGNIHLCGEPLTMRCSNDGLPKAPPSAS 324
           +T LA+LNLS+++L G IP G+QF+TF NDSY GN+ LCG PL+++CS D  P+ PP   
Sbjct: 802 LTFLAVLNLSYNQLVGPIPHGSQFDTFQNDSYVGNLRLCGFPLSVKCSGDVAPQPPPF-- 859

Query: 325 TDHEEDETPSRFDWKMAKM 343
              E+++  S F+WK A +
Sbjct: 860 --QEKEDPASLFNWKFAMI 876

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255568090|ref|XP_002525021.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] gi|223535683|gb|EEF37348.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359493479|ref|XP_003634609.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225455498|ref|XP_002264793.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147793123|emb|CAN75335.1| hypothetical protein VITISV_032542 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493544|ref|XP_002267509.2| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493539|ref|XP_002267388.2| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296089526|emb|CBI39345.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493546|ref|XP_002267585.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225459979|ref|XP_002267546.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query343
TAIR|locus:2090754711 RLP43 "receptor like protein 4 0.941 0.454 0.376 5.2e-49
TAIR|locus:2085537894 RLP34 "AT3G11010" [Arabidopsis 0.886 0.340 0.395 5.2e-48
TAIR|locus:2825762994 RLP6 "AT1G45616" [Arabidopsis 0.877 0.302 0.390 9.9e-48
TAIR|locus:2074633943 RLP35 "AT3G11080" [Arabidopsis 0.938 0.341 0.375 6.1e-47
TAIR|locus:2078112868 RLP32 "receptor like protein 3 0.883 0.349 0.380 1.2e-46
TAIR|locus:2144392957 RLP53 "receptor like protein 5 0.886 0.317 0.381 1.4e-46
TAIR|locus:2078102875 RLP33 "receptor like protein 3 0.912 0.357 0.372 5.5e-46
TAIR|locus:2825389784 RLP11 "AT1G71390" [Arabidopsis 0.909 0.397 0.376 1.4e-45
TAIR|locus:2180587811 RLP52 "receptor like protein 5 0.947 0.400 0.364 6e-44
TAIR|locus:2046600800 RLP26 "receptor like protein 2 0.912 0.391 0.370 1.2e-43
TAIR|locus:2090754 RLP43 "receptor like protein 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 511 (184.9 bits), Expect = 5.2e-49, P = 5.2e-49
 Identities = 132/351 (37%), Positives = 188/351 (53%)

Query:     9 NNRIQGSI---LVPPPSTEVFLVSNNKLSGRIPPSICSL-SFLQYLSLSDNNLSGTIPPC 64
             NN   G I   +    S E   +S+N  SG IP  + +L S L +L+L  NNLSG +P  
Sbjct:   321 NNNFTGKIPSFICELRSLETLDLSDNNFSGLIPRCMGNLKSNLSHLNLRQNNLSGGLPKH 380

Query:    65 LGNFSTELITLHLKNNSLEGHIHDT---FANA-IVNVENNMTSDSFPCWLGSLPVLKILV 120
             +  F   L +L + +N L G +  +   F+   ++NVE+N  +D+FP WL SLP L++LV
Sbjct:   381 I--FEI-LRSLDVGHNQLVGKLPRSLRFFSTLEVLNVESNRINDTFPFWLTSLPKLQVLV 437

Query:   121 LRSNRFDGPLCNSNITFPFQALRIIDLSHNEFTGFLPRRIFPSMEAMKNV---DEQGRLE 177
             LRSN F GP+  ++    F  LRIID+SHN F G LP   F    AM ++   +++    
Sbjct:   438 LRSNAFHGPIHEAS----FLKLRIIDISHNHFNGTLPSDYFVKWSAMSSLGTDEDRSNAN 493

Query:   178 YMGGAFYDESITQ----------KILVMFRAMDFSSNRFHGEIPEVLGNFKSLKVLNLSH 227
             YMG  +Y +S+            +IL ++ A+DFS N+F GEIP+ +G  K L VLNLS+
Sbjct:   494 YMGSVYYQDSMVLMNKGVESELIRILTIYTALDFSGNKFEGEIPKSIGLLKELLVLNLSN 553

Query:   228 NSLTGNIPVSFENMTALESLDLSFNKLDGRIPEQXXXXXXXXXXXXXHSRLWGRIPQGNQ 287
             N+ TG+IP S   +TALESLD+S NKL G IP++             H++L G +P G Q
Sbjct:   554 NAFTGHIPSSMGKLTALESLDVSQNKLYGEIPQEIGNLSFLSCMNFSHNQLAGLVPGGQQ 613

Query:   288 FNTFANDSYFGNIHLCGEPLTMRCSNDGLPKAPPSASTDHEEDETPSRFDW 338
             F T    S+  N+ L G  L   C +   P +     T   E+E      W
Sbjct:   614 FLTQPCSSFEDNLGLFGSTLEEDCRDIHTPASHQQYKTPETEEEDEEVISW 664
GO:0005886 "plasma membrane" evidence=ISM
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825762 RLP6 "AT1G45616" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078112 RLP32 "receptor like protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825389 RLP11 "AT1G71390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180587 RLP52 "receptor like protein 52" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046600 RLP26 "receptor like protein 26" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pm.C_scaffold_182000003
hypothetical protein (921 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query343
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-36
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-30
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-28
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-27
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 9e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.001
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  137 bits (347), Expect = 7e-36
 Identities = 104/314 (33%), Positives = 156/314 (49%), Gaps = 21/314 (6%)

Query: 1   NITTLDLRNNRIQGSI---LVPPPSTEVFLVSNNKLSGRIPPSICSLSFLQYLSLSDNNL 57
           N+  L L +N   G I   L   P  +V  + +NK SG IP ++   + L  L LS NNL
Sbjct: 309 NLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNL 368

Query: 58  SGTIPPCLGNFSTELITLHLKNNSLEGHIHDTFANAI----VNVENNMTSDSFPCWLGSL 113
           +G IP  L + S  L  L L +NSLEG I  +         V +++N  S   P     L
Sbjct: 369 TGEIPEGLCS-SGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKL 427

Query: 114 PVLKILVLRSNRFDGPLCNSNITFPFQALRIIDLSHNEFTGFLPRRIFPSMEAMKNVDEQ 173
           P++  L + +N   G + +     P  +L+++ L+ N+F G LP       + ++N+D  
Sbjct: 428 PLVYFLDISNNNLQGRINSRKWDMP--SLQMLSLARNKFFGGLPD--SFGSKRLENLD-- 481

Query: 174 GRLEYMGGAFYDESITQKILVMFRAMD--FSSNRFHGEIPEVLGNFKSLKVLNLSHNSLT 231
                +    +  ++ +K+  +   M    S N+  GEIP+ L + K L  L+LSHN L+
Sbjct: 482 -----LSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLS 536

Query: 232 GNIPVSFENMTALESLDLSFNKLDGRIPEQLLSVTALALLNLSHSRLWGRIPQGNQFNTF 291
           G IP SF  M  L  LDLS N+L G IP+ L +V +L  +N+SH+ L G +P    F   
Sbjct: 537 GQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAI 596

Query: 292 ANDSYFGNIHLCGE 305
              +  GNI LCG 
Sbjct: 597 NASAVAGNIDLCGG 610

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 343
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.98
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.89
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.87
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.82
KOG4237498 consensus Extracellular matrix protein slit, conta 99.8
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.78
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.77
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.72
KOG0617264 consensus Ras suppressor protein (contains leucine 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.65
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.33
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.28
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.27
PLN03150623 hypothetical protein; Provisional 99.24
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.24
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.21
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.19
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.19
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.11
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.08
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 99.07
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.04
PLN03150623 hypothetical protein; Provisional 99.04
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.03
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.02
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.02
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.0
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.94
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.92
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.84
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.76
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.52
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.52
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.47
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.35
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.3
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.3
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.21
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.2
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.14
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.13
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.1
PRK15386426 type III secretion protein GogB; Provisional 98.06
PRK15386 426 type III secretion protein GogB; Provisional 98.05
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.0
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.93
KOG4341483 consensus F-box protein containing LRR [General fu 97.82
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.77
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.55
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.52
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.37
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.36
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.21
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.06
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.05
KOG4308 478 consensus LRR-containing protein [Function unknown 95.72
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.65
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.53
KOG4308478 consensus LRR-containing protein [Function unknown 95.32
KOG4341483 consensus F-box protein containing LRR [General fu 95.23
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.79
smart0037026 LRR Leucine-rich repeats, outliers. 94.79
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.52
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.39
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 93.3
KOG0473 326 consensus Leucine-rich repeat protein [Function un 92.73
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.57
smart0037026 LRR Leucine-rich repeats, outliers. 92.41
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.41
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.02
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 90.35
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 89.72
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.96
KOG1947482 consensus Leucine rich repeat proteins, some prote 86.79
smart0008251 LRRCT Leucine rich repeat C-terminal domain. 83.03
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=99.98  E-value=1.5e-31  Score=271.97  Aligned_cols=302  Identities=31%  Similarity=0.497  Sum_probs=239.7

Q ss_pred             CccEEEccCCcccccCCC---CCCCCcEEEccCCcccccCCccccCCCccCeeecccccccccCCchhhcCccCccEEEc
Q 042366            1 NITTLDLRNNRIQGSILV---PPPSTEVFLVSNNKLSGRIPPSICSLSFLQYLSLSDNNLSGTIPPCLGNFSTELITLHL   77 (343)
Q Consensus         1 ~L~~L~ls~n~l~~~~~~---~~~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~L~~n~i~~~~p~~~~~~~~~L~~L~l   77 (343)
                      +|++|++++|.+.+..+.   .+++|+.|++++|.+++..|..+..+++|+.|+|++|.+++.+|..+..+. +|+.|++
T Consensus       285 ~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~-~L~~L~L  363 (968)
T PLN00113        285 KLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHN-NLTVLDL  363 (968)
T ss_pred             CcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCC-CCcEEEC
Confidence            478899999999876654   488999999999999988888999999999999999999888888887775 8999999


Q ss_pred             ccCcccccccccccc----cEEEeccCCCCCCcCccccCCCCcCEEEecCCcccccCCCCCCccCCCCCcEEEeeCCccc
Q 042366           78 KNNSLEGHIHDTFAN----AIVNVENNMTSDSFPCWLGSLPVLKILVLRSNRFDGPLCNSNITFPFQALRIIDLSHNEFT  153 (343)
Q Consensus        78 ~~n~l~~~~~~~~~~----~~l~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~~L~~L~l~~n~l~  153 (343)
                      ++|.+++..+..+..    +.+++++|.+.+..|..+..+++|+.|++++|.+.+..+..+  ..++.|+.|++++|.+.
T Consensus       364 s~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~--~~l~~L~~L~Ls~N~l~  441 (968)
T PLN00113        364 STNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEF--TKLPLVYFLDISNNNLQ  441 (968)
T ss_pred             CCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhH--hcCCCCCEEECcCCccc
Confidence            999998877776665    678888888888888777778888888888888776665554  55667777777777776


Q ss_pred             ccCCcccccCccccccccccCccccc--CC--------------cccCcch--hHHHHhccCeeeccCCcccccCccccc
Q 042366          154 GFLPRRIFPSMEAMKNVDEQGRLEYM--GG--------------AFYDESI--TQKILVMFRAMDFSSNRFHGEIPEVLG  215 (343)
Q Consensus       154 ~~~~~~~~~~l~~L~~l~~~~~~~~~--~~--------------~~~~~~~--~~~~~~~L~~L~Ls~n~l~~~~~~~l~  215 (343)
                      +.++.. +..+++|+.+++++|....  ..              .......  ....++.|++|++++|.+.+..|..+.
T Consensus       442 ~~~~~~-~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~  520 (968)
T PLN00113        442 GRINSR-KWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELS  520 (968)
T ss_pred             CccChh-hccCCCCcEEECcCceeeeecCcccccccceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHc
Confidence            554433 3345566666555543210  00              0000011  123377899999999999988999999


Q ss_pred             CCCCCCEEEccCCcCccCCCccccccCCCCeEeCCCCcCccccchhhhcCCcCCeEeccCCcCeecCCCCCccCCCCccc
Q 042366          216 NFKSLKVLNLSHNSLTGNIPVSFENMTALESLDLSFNKLDGRIPEQLLSVTALALLNLSHSRLWGRIPQGNQFNTFANDS  295 (343)
Q Consensus       216 ~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~N~l~~~~p~~~~~~~~~~~~  295 (343)
                      .+++|++|+|++|.+.+.+|..|..+++|+.|+|++|++++.+|..+..+++|+.+++++|++.+.+|....+..+....
T Consensus       521 ~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~  600 (968)
T PLN00113        521 SCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASA  600 (968)
T ss_pred             CccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999888888888888


Q ss_pred             ccCCCCCCCCC
Q 042366          296 YFGNIHLCGEP  306 (343)
Q Consensus       296 ~~~~~~l~~np  306 (343)
                      +.+++.+||.+
T Consensus       601 ~~~n~~lc~~~  611 (968)
T PLN00113        601 VAGNIDLCGGD  611 (968)
T ss_pred             hcCCccccCCc
Confidence            88888888754

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00082 LRRCT Leucine rich repeat C-terminal domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query343
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-27
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-27
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 8e-13
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score =  119 bits (298), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 116/387 (29%), Positives = 163/387 (42%), Gaps = 85/387 (21%)
Query: 2   ITTLDLRNNRIQGSILV-----PPPSTEVFLVSNNKLSGRIPPSICSLSFLQYLSLSDNN 56
           + TLDL +N   G IL      P  + +   + NN  +G+IPP++ + S L  L LS N 
Sbjct: 367 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 426
Query: 57  LSGTIPPCLGNFST-----------------------ELITLHLKNNSLEGHIHDTFANA 93
           LSGTIP  LG+ S                         L TL L  N L G I    +N 
Sbjct: 427 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNC 486
Query: 94  I----VNVENNMTSDSFPCWLGSLPVLKILVLRSNRFDGPLCNSNITFPF---QALRIID 146
                +++ NN  +   P W+G L  L IL L +N F G     NI       ++L  +D
Sbjct: 487 TNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSG-----NIPAELGDCRSLIWLD 541
Query: 147 LSHNEFTGFLP------------------RRIFPSMEAMKN-VDEQGRLEYMGGAFYDE- 186
           L+ N F G +P                  R ++   + MK      G L    G   ++ 
Sbjct: 542 LNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQL 601
Query: 187 ---------SITQKIL-------------VMFRAMDFSSNRFHGEIPEVLGNFKSLKVLN 224
                    +IT ++              +MF  +D S N   G IP+ +G+   L +LN
Sbjct: 602 NRLSTRNPCNITSRVYGGHTSPTFDNNGSMMF--LDMSYNMLSGYIPKEIGSMPYLFILN 659
Query: 225 LSHNSLTGNIPVSFENMTALESLDLSFNKLDGRIPEQXXXXXXXXXXXXXHSRLWGRIPQ 284
           L HN ++G+IP    ++  L  LDLS NKLDGRIP+              ++ L G IP+
Sbjct: 660 LGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPE 719
Query: 285 GNQFNTFANDSYFGNIHLCGEPLTMRC 311
             QF TF    +  N  LCG PL  RC
Sbjct: 720 MGQFETFPPAKFLNNPGLCGYPLP-RC 745
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query343
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-80
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-53
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-52
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-46
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-39
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-33
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-67
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-24
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-42
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-32
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-30
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-28
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-33
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-31
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-31
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-28
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-28
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-26
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-26
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-15
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-31
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-26
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-25
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-24
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-21
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-29
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-24
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-28
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-27
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-26
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-24
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-26
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-23
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-15
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-20
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-13
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-19
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-19
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-17
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-18
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-16
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-15
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-15
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-15
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-17
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-16
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-13
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-14
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-13
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 8e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-12
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-10
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-06
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-08
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  258 bits (661), Expect = 5e-80
 Identities = 89/334 (26%), Positives = 130/334 (38%), Gaps = 39/334 (11%)

Query: 1   NITTLDLRNNRIQGSILVPP-----PSTEVFLVSNNKLSGRIPPSICSLSFLQYLSLSDN 55
            + TL L  N + G I  P       +     +SNN+L+G IP  I  L  L  L LS+N
Sbjct: 467 TLETLILDFNDLTGEI--PSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNN 524

Query: 56  NLSGTIPPCLGNFSTELITLHLKNNSLEGHIHDTFANAIVNVENNMTSDSFPCWLGSLPV 115
           + SG IP  LG+    LI L L  N   G I          +  N  +     ++ +  +
Sbjct: 525 SFSGNIPAELGDCR-SLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGM 583

Query: 116 LKILVLRSNRFDGPLCNSNITFPFQALRIIDLSHNEFTGFLPRRIFPSMEAMKNVDEQGR 175
            K      N  +     S            +++   + G                     
Sbjct: 584 KKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTF--------------- 628

Query: 176 LEYMGGAFYDESITQKILVMFRAMDFSSNRFHGEIPEVLGNFKSLKVLNLSHNSLTGNIP 235
                                  +D S N   G IP+ +G+   L +LNL HN ++G+IP
Sbjct: 629 ---------------DNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIP 673

Query: 236 VSFENMTALESLDLSFNKLDGRIPEQLLSVTALALLNLSHSRLWGRIPQGNQFNTFANDS 295
               ++  L  LDLS NKLDGRIP+ + ++T L  ++LS++ L G IP+  QF TF    
Sbjct: 674 DEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAK 733

Query: 296 YFGNIHLCGEPLTMRCSNDGLPKAPPSASTDHEE 329
           +  N  LCG PL  RC             + H  
Sbjct: 734 FLNNPGLCGYPLP-RCDPSNADGYAHHQRSHHHH 766
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query343
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.98
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.98
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.98
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.97
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.91
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.91
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.91
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.89
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.89
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.84
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.84
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.78
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.78
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.78
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.76
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.73
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.72
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.72
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.7
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.68
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.68
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.66
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.63
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.62
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.58
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.57
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.56
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.53
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.53
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.45
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.45
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.42
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.4
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.31
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.28
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.26
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.13
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.04
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.04
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.0
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.98
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.92
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.76
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.69
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.51
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.38
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.29
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.24
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.12
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.05
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.7
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.49
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.47
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=4.3e-39  Score=318.27  Aligned_cols=309  Identities=34%  Similarity=0.518  Sum_probs=248.4

Q ss_pred             CccEEEccCCcccccCCCC-----CCCCcEEEccCCcccccCCccccCCCccCeeecccccccccCCchhhcCccCccEE
Q 042366            1 NITTLDLRNNRIQGSILVP-----PPSTEVFLVSNNKLSGRIPPSICSLSFLQYLSLSDNNLSGTIPPCLGNFSTELITL   75 (343)
Q Consensus         1 ~L~~L~ls~n~l~~~~~~~-----~~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~L~~n~i~~~~p~~~~~~~~~L~~L   75 (343)
                      +|++|++++|.+++..+..     +++|++|++++|++++..|..|.++++|++|+|++|.+++.+|..+..+. +|++|
T Consensus       369 ~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~-~L~~L  447 (768)
T 3rgz_A          369 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLS-KLRDL  447 (768)
T ss_dssp             TCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCT-TCCEE
T ss_pred             CCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCC-CCCEE
Confidence            3667777777776644443     45688888888888877888888888888888888888877777777765 78888


Q ss_pred             EcccCcccccccccccc----cEEEeccCCCCCCcCccccCCCCcCEEEecCCcccccCCCCCCccCCCCCcEEEeeCCc
Q 042366           76 HLKNNSLEGHIHDTFAN----AIVNVENNMTSDSFPCWLGSLPVLKILVLRSNRFDGPLCNSNITFPFQALRIIDLSHNE  151 (343)
Q Consensus        76 ~l~~n~l~~~~~~~~~~----~~l~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~~L~~L~l~~n~  151 (343)
                      ++++|.+++..+..+..    +.+++++|.+.+..|..+..+++|++|++++|++.+..|..+  ..+++|++|++++|.
T Consensus       448 ~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~--~~l~~L~~L~L~~N~  525 (768)
T 3rgz_A          448 KLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWI--GRLENLAILKLSNNS  525 (768)
T ss_dssp             ECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGG--GGCTTCCEEECCSSC
T ss_pred             ECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHH--hcCCCCCEEECCCCc
Confidence            88888888777776665    778888888888888888888888888888888877666665  667788888888888


Q ss_pred             ccccCCcccccCccccccccccCcccc--cCCcccC--------------------------------------------
Q 042366          152 FTGFLPRRIFPSMEAMKNVDEQGRLEY--MGGAFYD--------------------------------------------  185 (343)
Q Consensus       152 l~~~~~~~~~~~l~~L~~l~~~~~~~~--~~~~~~~--------------------------------------------  185 (343)
                      +.+.+|.. +..+++|+.+++++|...  +...++.                                            
T Consensus       526 l~~~~p~~-l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  604 (768)
T 3rgz_A          526 FSGNIPAE-LGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQL  604 (768)
T ss_dssp             CEEECCGG-GGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGG
T ss_pred             ccCcCCHH-HcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhh
Confidence            87777754 566777887777766421  1110000                                            


Q ss_pred             -----------------cch--hHHHHhccCeeeccCCcccccCcccccCCCCCCEEEccCCcCccCCCccccccCCCCe
Q 042366          186 -----------------ESI--TQKILVMFRAMDFSSNRFHGEIPEVLGNFKSLKVLNLSHNSLTGNIPVSFENMTALES  246 (343)
Q Consensus       186 -----------------~~~--~~~~~~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~  246 (343)
                                       ...  ....++.|++|++++|.+++.+|..+..++.|+.|+|++|.+.+.+|..++.+++|+.
T Consensus       605 ~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~  684 (768)
T 3rgz_A          605 NRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNI  684 (768)
T ss_dssp             GGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCE
T ss_pred             hccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCE
Confidence                             000  0112467999999999999999999999999999999999999999999999999999


Q ss_pred             EeCCCCcCccccchhhhcCCcCCeEeccCCcCeecCCCCCccCCCCcccccCCCCCCCCCCCCCCCCC
Q 042366          247 LDLSFNKLDGRIPEQLLSVTALALLNLSHSRLWGRIPQGNQFNTFANDSYFGNIHLCGEPLTMRCSND  314 (343)
Q Consensus       247 L~L~~n~l~~~~~~~~~~l~~L~~L~l~~N~l~~~~p~~~~~~~~~~~~~~~~~~l~~np~~~~C~~~  314 (343)
                      |+|++|++++.+|..+..+++|+.|++++|+++|.+|+..++..+...++.+|+.+||.|+. .|...
T Consensus       685 LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~  751 (768)
T 3rgz_A          685 LDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RCDPS  751 (768)
T ss_dssp             EECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC-CCCSC
T ss_pred             EECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc-CCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999987 77543
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 343
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-09
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-12
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-09
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-07
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-04
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 2e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 77.0 bits (188), Expect = 2e-16
 Identities = 41/234 (17%), Positives = 75/234 (32%), Gaps = 45/234 (19%)

Query: 42  CSLSFLQYLSLSDNNLSGTIPPCLGNFSTELITLHLKNNSLEGHIHDTFANAIVNVENNM 101
             L+ L+ L  ++N +S   P       T L  L L  N L+                  
Sbjct: 194 AKLTNLESLIATNNQISDITPLG---ILTNLDELSLNGNQLKD----------------- 233

Query: 102 TSDSFPCWLGSLPVLKILVLRSNRFDGPLCNSNITFPFQALRIIDLSHNEFTGFLPRRIF 161
                   L SL  L  L L +N+       S +T     L  + L  N+ +   P    
Sbjct: 234 -----IGTLASLTNLTDLDLANNQISNLAPLSGLT----KLTELKLGANQISNISPLAGL 284

Query: 162 PSMEAMKNVDEQGRLEYMGGAFYDESITQKILVMFRAMDFSSNRFHGEIPEVLGNFKSLK 221
            ++  +           +     ++      L     +    N      P  + +   L+
Sbjct: 285 TALTNL----------ELNENQLEDISPISNLKNLTYLTLYFNNISDISP--VSSLTKLQ 332

Query: 222 VLNLSHNSLTGNIPVSFENMTALESLDLSFNKLDGRIPEQLLSVTALALLNLSH 275
            L  ++N ++     S  N+T +  L    N++    P  L ++T +  L L+ 
Sbjct: 333 RLFFANNKVSD--VSSLANLTNINWLSAGHNQISDLTP--LANLTRITQLGLND 382
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query343
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.94
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.83
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.81
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.78
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.75
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.74
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.68
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.66
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.64
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.56
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.55
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.54
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.53
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.47
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.46
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.26
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.26
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.33
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.32
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.07
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.75
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.51
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.06
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.97  E-value=8.9e-31  Score=230.07  Aligned_cols=253  Identities=29%  Similarity=0.489  Sum_probs=203.7

Q ss_pred             CCCcEEEccCCcccc--cCCccccCCCccCeeeccc-ccccccCCchhhcCccCccEEEcccCcccccccccccc----c
Q 042366           21 PSTEVFLVSNNKLSG--RIPPSICSLSFLQYLSLSD-NNLSGTIPPCLGNFSTELITLHLKNNSLEGHIHDTFAN----A   93 (343)
Q Consensus        21 ~~L~~L~L~~n~i~~--~~~~~~~~l~~L~~L~L~~-n~i~~~~p~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~----~   93 (343)
                      .+++.|+|+++++++  .+|..++++++|++|+|++ |.++|.+|+.+.++. +|++|++++|++.+..+..+..    +
T Consensus        50 ~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~-~L~~L~Ls~N~l~~~~~~~~~~~~~L~  128 (313)
T d1ogqa_          50 YRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLT-QLHYLYITHTNVSGAIPDFLSQIKTLV  128 (313)
T ss_dssp             CCEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCT-TCSEEEEEEECCEEECCGGGGGCTTCC
T ss_pred             EEEEEEECCCCCCCCCCCCChHHhcCcccccccccccccccccccccccccc-ccchhhhccccccccccccccchhhhc
Confidence            468999999999987  4788999999999999987 788888999999886 8999999999998877665554    6


Q ss_pred             EEEeccCCCCCCcCccccCCCCcCEEEecCCcccccCCCCCCccCCCCC-cEEEeeCCcccccCCcccccCccccccccc
Q 042366           94 IVNVENNMTSDSFPCWLGSLPVLKILVLRSNRFDGPLCNSNITFPFQAL-RIIDLSHNEFTGFLPRRIFPSMEAMKNVDE  172 (343)
Q Consensus        94 ~l~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~~L-~~L~l~~n~l~~~~~~~~~~~l~~L~~l~~  172 (343)
                      .+++++|.+...+|..+..+++|+.+++++|.+.+..|..+  ..+..+ +.+++++|.+++..+..+ .          
T Consensus       129 ~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~--~~l~~l~~~l~~~~n~l~~~~~~~~-~----------  195 (313)
T d1ogqa_         129 TLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSY--GSFSKLFTSMTISRNRLTGKIPPTF-A----------  195 (313)
T ss_dssp             EEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGG--GCCCTTCCEEECCSSEEEEECCGGG-G----------
T ss_pred             ccccccccccccCchhhccCcccceeecccccccccccccc--ccccccccccccccccccccccccc-c----------
Confidence            66777776666677777777777777777777766555544  334443 666777776665444321 1          


Q ss_pred             cCcccccCCcccCcchhHHHHhccCeeeccCCcccccCcccccCCCCCCEEEccCCcCccCCCccccccCCCCeEeCCCC
Q 042366          173 QGRLEYMGGAFYDESITQKILVMFRAMDFSSNRFHGEIPEVLGNFKSLKVLNLSHNSLTGNIPVSFENMTALESLDLSFN  252 (343)
Q Consensus       173 ~~~~~~~~~~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n  252 (343)
                                          ......++++.+.+.+..|..+..+++++.+++++|.+.+.++ .++.+++|+.|+|++|
T Consensus       196 --------------------~l~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N  254 (313)
T d1ogqa_         196 --------------------NLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNN  254 (313)
T ss_dssp             --------------------GCCCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSS
T ss_pred             --------------------ccccccccccccccccccccccccccccccccccccccccccc-ccccccccccccCccC
Confidence                                1234578889999988899999999999999999999986554 5788899999999999


Q ss_pred             cCccccchhhhcCCcCCeEeccCCcCeecCCCCCccCCCCcccccCCCCCCCCCCC
Q 042366          253 KLDGRIPEQLLSVTALALLNLSHSRLWGRIPQGNQFNTFANDSYFGNIHLCGEPLT  308 (343)
Q Consensus       253 ~l~~~~~~~~~~l~~L~~L~l~~N~l~~~~p~~~~~~~~~~~~~~~~~~l~~np~~  308 (343)
                      ++++.+|..+..+++|++|+|++|+|+|.+|+...+..+..+.+.+|..+||.|+.
T Consensus       255 ~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~~l~g~plp  310 (313)
T d1ogqa_         255 RIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLP  310 (313)
T ss_dssp             CCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSSEEESTTSS
T ss_pred             eecccCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHHhCCCccccCCCCC
Confidence            99999999999999999999999999999998777788888888888889998764
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure