Citrus Sinensis ID: 042386
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 699 | ||||||
| 359478930 | 696 | PREDICTED: telomere repeat-binding prote | 0.991 | 0.995 | 0.669 | 0.0 | |
| 255588298 | 688 | conserved hypothetical protein [Ricinus | 0.979 | 0.995 | 0.668 | 0.0 | |
| 224104425 | 673 | predicted protein [Populus trichocarpa] | 0.955 | 0.992 | 0.666 | 0.0 | |
| 297746057 | 646 | unnamed protein product [Vitis vinifera] | 0.921 | 0.996 | 0.637 | 0.0 | |
| 302398979 | 680 | MYBR domain class transcription factor [ | 0.969 | 0.997 | 0.636 | 0.0 | |
| 198075762 | 635 | putative double-strand telomere binding | 0.904 | 0.995 | 0.612 | 0.0 | |
| 356547261 | 722 | PREDICTED: telomere repeat-binding prote | 0.987 | 0.955 | 0.556 | 0.0 | |
| 356557425 | 709 | PREDICTED: telomere repeat-binding prote | 0.971 | 0.957 | 0.550 | 0.0 | |
| 356541233 | 684 | PREDICTED: telomere repeat-binding prote | 0.962 | 0.983 | 0.565 | 0.0 | |
| 449455186 | 674 | PREDICTED: telomere repeat-binding prote | 0.949 | 0.985 | 0.551 | 0.0 |
| >gi|359478930|ref|XP_002283389.2| PREDICTED: telomere repeat-binding protein 5-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 901 bits (2328), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 470/702 (66%), Positives = 537/702 (76%), Gaps = 9/702 (1%)
Query: 1 MVLQKRLDYGFNGYQVPYTPRATRSARKRCSFKKRAEDNQMCAFDLLATVAGKLLLEKQC 60
MVLQKRLDYGFNGYQVP TPRATRSAR+R F+K+ EDNQM AFDLLATVAGKLLLE +
Sbjct: 1 MVLQKRLDYGFNGYQVPATPRATRSARRRGLFRKKVEDNQMFAFDLLATVAGKLLLEGEK 60
Query: 61 TPSSSNTPSDEDQSAVAKEIEQKAMQDENKQLKVETCDQGSCDRGFFVSDLVSQAHDQKC 120
+P S NT + ++Q +A++ + E+K LK+E CDQG+ F VS+L SQ QK
Sbjct: 61 SPDSVNTSNGKEQCVIAEDQVKNEGHAEDKPLKIEPCDQGNSGGSFIVSELSSQMPSQKY 120
Query: 121 SLKPPSCQQADAHPGFASVITTSDCSEGFG-DQKLVNGKPKNEMGTLASKVEVGPSGYMG 179
L+ Q DA ASVIT SDCSE G +KLV G KNE + ASKVEVG SG+
Sbjct: 121 CLREFPRPQNDACSALASVIT-SDCSEKVGCAEKLVIGNGKNETESFASKVEVGSSGFRE 179
Query: 180 YGNCKVEAETNKFMKDESHKTAKVQLGTRADGCSFEDPLVWDGKPPA-VSSDSSAKAPLC 238
+ + K+E ET + +K E KT + L T A EDP+VWDGKP VSS+SSA+ P C
Sbjct: 180 FNDRKLENETKRQIKVEPIKTGRAILNTGAGMFGSEDPVVWDGKPSVLVSSNSSAEVPPC 239
Query: 239 GDHSPHISFPASQDYVNVVSRDDDENSSGCTHPNTTKRSFRPAPRIGDRRIRKILASKYW 298
D+ P SFP + V VVSRDDD+NSSGCT P+T+ +SFRP PRIGDRRIRK+LASKYW
Sbjct: 240 RDNIPCGSFPLCRGDVKVVSRDDDDNSSGCTQPSTSTKSFRPLPRIGDRRIRKLLASKYW 299
Query: 299 KVAPKLKDATLSNTVLMVSDGDLKTVYHNRNSYYRSIRSERNYPIKKRRLFNCSSVPNYD 358
KV PKLK+ LSN DG++K +Y N+ + Y+ RS+RNYP KKR+L CSSV N +
Sbjct: 300 KVTPKLKEDGLSNV-----DGEVKPIYRNKRNCYKRQRSQRNYPFKKRKLLYCSSVSNSE 354
Query: 359 RKIRSEGICVSPERCINGDVSALCAKMHEVTGASSSVAGSHTSFQSRDSHVKLRIKSFRV 418
S+ I SP+ IN D S K+H S+SVAG HTSF SRDSHVKLRIKSFRV
Sbjct: 355 GGNGSQRISDSPQMGINSDASGSGLKLHGGISTSASVAGQHTSFISRDSHVKLRIKSFRV 414
Query: 419 PELFIELPETATVGSLKRRVMEAVNAILGGGLRVGVLLQGKKVKDDNKTLLQTGISHDNQ 478
PELFIE+PETATVGSLKR VMEAV AILGGGLRVGVLL+GKKV+DD+KTL QTGIS D+Q
Sbjct: 415 PELFIEIPETATVGSLKRTVMEAVTAILGGGLRVGVLLRGKKVRDDSKTLQQTGISQDDQ 474
Query: 479 KDVLGFSLEPKTSQTPPPLCSGDSPFMLPSNAPQPLARYPPAPGVVHQGTCDAVPELQMA 538
D LGF+LEP SQ P LC GD+PF+LP + PQPL RYPP P V HQGT DA P+ +
Sbjct: 475 MDALGFTLEPNPSQAPQALCPGDNPFLLPYDTPQPLKRYPPTPTVAHQGTSDASPDPPVT 534
Query: 539 NAVNFIESDHDSAPSP-TDMSIDKSTKDSKALVTVPAMSVEALAVVPVHRKSKRSEIVQR 597
N +F+ESDHDSAPSP TDMSIDKS DSKALV+VPAMS+EALAVVPVHRKSKRSEIVQR
Sbjct: 535 NLCDFVESDHDSAPSPDTDMSIDKSVTDSKALVSVPAMSMEALAVVPVHRKSKRSEIVQR 594
Query: 598 RIRRPFSVAEVEALVQAVEKLGTGRWRDVKLRAFDNAKHRTYVDLKDKWKTLVHTARISP 657
RIRRPFSV+EVEALVQAVEKLGTGRWRDVKLRAFDNAKHRTYVDLKDKWKTLVHTARISP
Sbjct: 595 RIRRPFSVSEVEALVQAVEKLGTGRWRDVKLRAFDNAKHRTYVDLKDKWKTLVHTARISP 654
Query: 658 QQRRGEPVPQELLDRVLTAHAYWTQQQAKQQFKQQPETCLLL 699
QQRRGEPVPQELLDRVLTAHAYW+QQQAKQQ K Q ETCLLL
Sbjct: 655 QQRRGEPVPQELLDRVLTAHAYWSQQQAKQQLKHQSETCLLL 696
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255588298|ref|XP_002534561.1| conserved hypothetical protein [Ricinus communis] gi|223525029|gb|EEF27822.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224104425|ref|XP_002313432.1| predicted protein [Populus trichocarpa] gi|222849840|gb|EEE87387.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297746057|emb|CBI16113.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|302398979|gb|ADL36784.1| MYBR domain class transcription factor [Malus x domestica] | Back alignment and taxonomy information |
|---|
| >gi|198075762|gb|ACH81293.1| putative double-strand telomere binding protein 2 [Carica papaya] | Back alignment and taxonomy information |
|---|
| >gi|356547261|ref|XP_003542034.1| PREDICTED: telomere repeat-binding protein 5-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356557425|ref|XP_003547016.1| PREDICTED: telomere repeat-binding protein 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356541233|ref|XP_003539084.1| PREDICTED: telomere repeat-binding protein 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449455186|ref|XP_004145334.1| PREDICTED: telomere repeat-binding protein 5-like [Cucumis sativus] gi|449471933|ref|XP_004153447.1| PREDICTED: telomere repeat-binding protein 5-like [Cucumis sativus] gi|449515670|ref|XP_004164871.1| PREDICTED: telomere repeat-binding protein 5-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 699 | ||||||
| TAIR|locus:2075145 | 553 | TRFL1 "TRF-like 1" [Arabidopsi | 0.217 | 0.274 | 0.582 | 6.9e-105 | |
| TAIR|locus:2025007 | 630 | TRFL2 "TRF-like 2" [Arabidopsi | 0.402 | 0.446 | 0.444 | 2.8e-82 | |
| TAIR|locus:2101232 | 619 | TRFL9 "TRF-like 9" [Arabidopsi | 0.410 | 0.463 | 0.511 | 9.2e-86 | |
| TAIR|locus:2159048 | 640 | TBP1 "AT5G13820" [Arabidopsis | 0.497 | 0.543 | 0.461 | 1.5e-85 | |
| TAIR|locus:2148383 | 578 | TRP1 "AT5G59430" [Arabidopsis | 0.373 | 0.451 | 0.522 | 3.6e-84 | |
| UNIPROTKB|Q9LL45 | 633 | TBP1 "Telomere-binding protein | 0.386 | 0.426 | 0.455 | 1.6e-75 |
| TAIR|locus:2075145 TRFL1 "TRF-like 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 432 (157.1 bits), Expect = 6.9e-105, Sum P(4) = 6.9e-105
Identities = 92/158 (58%), Positives = 103/158 (65%)
Query: 542 NFIESDHDSAPSPTDMSIDKSTKD-SKALVTVPAMSVEALAVVPVHRKSKRSE---IVQR 597
N ++S H+ PSP D T D S+AL+ P S LA P +RK KR+E QR
Sbjct: 393 NALDSSHEPEPSPADSFGKLGTSDHSRALI--PVASAAMLAPRPPNRKFKRTEQQLAAQR 450
Query: 598 RIRRPFSXXXXXXXXXXXXKLGTGRWRDVKLRAFDNAKHRTYVDLKDKWKTLVHTARISP 657
RIRRPFS KLGTGRWRDVK+RAF++A HRTYVDLKDKWKTLVHTARISP
Sbjct: 451 RIRRPFSVTEVEALVQAVEKLGTGRWRDVKVRAFEDADHRTYVDLKDKWKTLVHTARISP 510
Query: 658 QQRRGEPVPQELLDRVLTAHAYWTXXXXXXXXXXXPET 695
QQRRGEPVPQELLDRVL AHAYW+ P T
Sbjct: 511 QQRRGEPVPQELLDRVLKAHAYWSQHLMHQLQTEPPST 548
|
|
| TAIR|locus:2025007 TRFL2 "TRF-like 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2101232 TRFL9 "TRF-like 9" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2159048 TBP1 "AT5G13820" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2148383 TRP1 "AT5G59430" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9LL45 TBP1 "Telomere-binding protein 1" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| gw1.IX.4198.1 | hypothetical protein (673 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 699 | |||
| cd11660 | 50 | cd11660, SANT_TRF, Telomere repeat binding factor- | 2e-17 | |
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 6e-07 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 7e-06 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 6e-05 |
| >gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family | Back alignment and domain information |
|---|
Score = 76.1 bits (188), Expect = 2e-17
Identities = 23/51 (45%), Positives = 29/51 (56%), Gaps = 1/51 (1%)
Query: 601 RPFSVAEVEALVQAVEKLGTGRWRDVKLRAFDNAKHRTYVDLKDKWKTLVH 651
R ++ E EALV+ VEK G G W + F +RT VDLKDKW+ L
Sbjct: 1 RKWTDEEDEALVEGVEKYGVGNWAKILKDYFFV-NNRTSVDLKDKWRNLKK 50
|
Human telomere repeat binding factors, TRF1 and TRF2, function as part of the 6 component shelterin complex. TRF2 binds DNA and recruits RAP1 (via binding to the RAP1 protein c-terminal (RCT)) and TIN2 in the protection of telomeres from DNA repair machinery. Metazoan shelterin consists of 3 DNA binding proteins (TRF2, TRF1, and POT1) and 3 recruited proteins that bind to one or more of these DNA-binding proteins (RAP1, TIN2, TPP1). Schizosaccharomyces pombe TAZ1 is an orthlog and binds RAP1. Human TRF1 and TRF2 bind double-stranded DNA. hTRF2 consists of a basic N-terminus, a TRF homology domain, the RAP1 binding motif (RBM), the TIN2 binding motif (TBM) and a myb-like DNA binding domain, SANT, named after 'SWI3, ADA2, N-CoR and TFIIIB', several factors that share this domain. Tandem copies of the domain bind telomeric DNA tandem repeats as part of the capping complex. The single myb-like domain of TRF-type proteins is similar to the tandem myb_like domains found in yeast RAP1. Length = 50 |
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 699 | |||
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 98.62 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 98.34 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 98.23 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 97.89 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 97.78 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 97.27 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 97.06 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 97.01 | |
| smart00213 | 64 | UBQ Ubiquitin homologues. Ubiquitin-mediated prote | 96.8 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 96.72 | |
| cd01804 | 78 | midnolin_N Ubiquitin-like domain of midnolin. midn | 96.5 | |
| cd01805 | 77 | RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo | 96.38 | |
| cd01792 | 80 | ISG15_repeat1 ISG15 ubiquitin-like protein, first | 96.27 | |
| cd01769 | 69 | UBL Ubiquitin-like domain of UBL. UBLs function by | 96.23 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 96.21 | |
| cd01808 | 71 | hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC | 96.17 | |
| cd01791 | 73 | Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know | 96.12 | |
| cd01809 | 72 | Scythe_N Ubiquitin-like domain of Scythe protein. | 96.04 | |
| PF00240 | 69 | ubiquitin: Ubiquitin family; InterPro: IPR000626 U | 95.94 | |
| cd01807 | 74 | GDX_N ubiquitin-like domain of GDX. GDX contains a | 95.8 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 95.74 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 95.42 | |
| PF13873 | 78 | Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | 94.81 | |
| cd01796 | 71 | DDI1_N DNA damage inducible protein 1 ubiquitin-li | 94.75 | |
| cd01803 | 76 | Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 | 94.72 | |
| cd01806 | 76 | Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn | 94.65 | |
| cd01799 | 75 | Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO | 94.43 | |
| cd01812 | 71 | BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter | 94.36 | |
| PF13325 | 199 | MCRS_N: N-terminal region of micro-spherule protei | 94.31 | |
| cd01793 | 74 | Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui | 94.31 | |
| cd01810 | 74 | ISG15_repeat2 ISG15 ubiquitin-like protein, second | 94.18 | |
| cd01798 | 70 | parkin_N amino-terminal ubiquitin-like of parkin p | 94.03 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 93.14 | |
| cd01801 | 77 | Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- | 93.08 | |
| PLN02560 | 308 | enoyl-CoA reductase | 92.79 | |
| cd01790 | 79 | Herp_N Homocysteine-responsive endoplasmic reticul | 92.73 | |
| cd01813 | 74 | UBP_N UBP ubiquitin processing protease. The UBP ( | 92.5 | |
| cd01795 | 107 | USP48_C USP ubiquitin-specific protease. The USP ( | 92.28 | |
| cd01794 | 70 | DC_UbP_C dendritic cell derived ubiquitin-like pro | 91.75 | |
| TIGR00601 | 378 | rad23 UV excision repair protein Rad23. All protei | 91.54 | |
| PF13881 | 111 | Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB | 91.15 | |
| cd01802 | 103 | AN1_N ubiquitin-like domain of AN1. AN1 (also know | 90.89 | |
| cd01789 | 84 | Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol | 90.79 | |
| PF11543 | 80 | UN_NPL4: Nuclear pore localisation protein NPL4; I | 89.86 | |
| cd01800 | 76 | SF3a120_C Ubiquitin-like domain of Mammalian splic | 89.84 | |
| cd01763 | 87 | Sumo Small ubiquitin-related modifier (SUMO). Smal | 89.7 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 89.47 | |
| PF09111 | 118 | SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain | 88.93 | |
| cd01815 | 75 | BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC | 88.65 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 88.46 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 88.22 | |
| cd01797 | 78 | NIRF_N amino-terminal ubiquitin-like domain of Np9 | 86.15 | |
| PF10302 | 97 | DUF2407: DUF2407 ubiquitin-like domain; InterPro: | 85.6 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 84.82 | |
| KOG3391 | 151 | consensus Transcriptional co-repressor component [ | 84.43 | |
| KOG4282 | 345 | consensus Transcription factor GT-2 and related pr | 82.36 | |
| PF11976 | 72 | Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter | 81.06 | |
| KOG0010 | 493 | consensus Ubiquitin-like protein [Posttranslationa | 80.2 |
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
Probab=98.62 E-value=3.5e-08 Score=76.79 Aligned_cols=48 Identities=29% Similarity=0.552 Sum_probs=41.3
Q ss_pred CCCCCHHHHHHHHHHHHHhCCCchHHHhhhccCCCCCCCchhhhhhhhhch
Q 042386 600 RRPFSVAEVEALVQAVEKLGTGRWRDVKLRAFDNAKHRTYVDLKDKWKTLV 650 (699)
Q Consensus 600 rr~WT~eEveaLv~GVekyG~GkW~~Il~~~~~~f~~RT~VDLKDKWRNL~ 650 (699)
|.+||.+|.+.|++||++||.++|..|..... ..||..+++++|+++.
T Consensus 1 r~~Wt~eE~~~l~~~v~~~g~~~W~~Ia~~~~---~~Rt~~qc~~~~~~~~ 48 (48)
T PF00249_consen 1 RGPWTEEEDEKLLEAVKKYGKDNWKKIAKRMP---GGRTAKQCRSRYQNLL 48 (48)
T ss_dssp S-SS-HHHHHHHHHHHHHSTTTHHHHHHHHHS---SSSTHHHHHHHHHHHT
T ss_pred CCCCCHHHHHHHHHHHHHhCCcHHHHHHHHcC---CCCCHHHHHHHHHhhC
Confidence 46899999999999999999999999987532 5899999999999873
|
These belong to the SANT domain family that specifically recognise the sequence YAAC(G/T)G [, ]. In myb, one of the most conserved regions consisting of three tandem repeats has been shown to be involved in DNA-binding [].; PDB: 1X41_A 2XAF_B 2XAG_B 2XAH_B 2UXN_B 2Y48_B 2XAQ_B 2X0L_B 2IW5_B 2XAJ_B .... |
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >smart00213 UBQ Ubiquitin homologues | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01804 midnolin_N Ubiquitin-like domain of midnolin | Back alignment and domain information |
|---|
| >cd01805 RAD23_N Ubiquitin-like domain of RAD23 | Back alignment and domain information |
|---|
| >cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 | Back alignment and domain information |
|---|
| >cd01769 UBL Ubiquitin-like domain of UBL | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 | Back alignment and domain information |
|---|
| >cd01791 Ubl5 UBL5 ubiquitin-like modifier | Back alignment and domain information |
|---|
| >cd01809 Scythe_N Ubiquitin-like domain of Scythe protein | Back alignment and domain information |
|---|
| >PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade | Back alignment and domain information |
|---|
| >cd01807 GDX_N ubiquitin-like domain of GDX | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | Back alignment and domain information |
|---|
| >cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain | Back alignment and domain information |
|---|
| >cd01803 Ubiquitin Ubiquitin | Back alignment and domain information |
|---|
| >cd01806 Nedd8 Nebb8-like ubiquitin protein | Back alignment and domain information |
|---|
| >cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 | Back alignment and domain information |
|---|
| >cd01812 BAG1_N Ubiquitin-like domain of BAG1 | Back alignment and domain information |
|---|
| >PF13325 MCRS_N: N-terminal region of micro-spherule protein | Back alignment and domain information |
|---|
| >cd01793 Fubi Fubi ubiquitin-like protein | Back alignment and domain information |
|---|
| >cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 | Back alignment and domain information |
|---|
| >cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 | Back alignment and domain information |
|---|
| >PLN02560 enoyl-CoA reductase | Back alignment and domain information |
|---|
| >cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein | Back alignment and domain information |
|---|
| >cd01813 UBP_N UBP ubiquitin processing protease | Back alignment and domain information |
|---|
| >cd01795 USP48_C USP ubiquitin-specific protease | Back alignment and domain information |
|---|
| >cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein | Back alignment and domain information |
|---|
| >TIGR00601 rad23 UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A | Back alignment and domain information |
|---|
| >cd01802 AN1_N ubiquitin-like domain of AN1 | Back alignment and domain information |
|---|
| >cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B | Back alignment and domain information |
|---|
| >PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway | Back alignment and domain information |
|---|
| >cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 | Back alignment and domain information |
|---|
| >cd01763 Sumo Small ubiquitin-related modifier (SUMO) | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices | Back alignment and domain information |
|---|
| >cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF | Back alignment and domain information |
|---|
| >PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG3391 consensus Transcriptional co-repressor component [Transcription] | Back alignment and domain information |
|---|
| >KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] | Back alignment and domain information |
|---|
| >PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins | Back alignment and domain information |
|---|
| >KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 699 | ||||
| 2juh_A | 121 | Solution Structure Of Dna Binding Domain Of Ngtrf1 | 2e-39 | ||
| 2roh_A | 122 | The Dna Binding Domain Of Rtbp1 Length = 122 | 1e-34 | ||
| 2qhb_A | 86 | Crystal Structure Of Ngtrf Complexed With Telomeric | 9e-34 | ||
| 2aje_A | 105 | Solution Structure Of The Arabidopsis Thaliana Telo | 1e-33 | ||
| 2ckx_A | 83 | Crystal Structure Of Ngtrf1, Double-Stranded Telome | 1e-31 |
| >pdb|2JUH|A Chain A, Solution Structure Of Dna Binding Domain Of Ngtrf1 Length = 121 | Back alignment and structure |
|
| >pdb|2ROH|A Chain A, The Dna Binding Domain Of Rtbp1 Length = 122 | Back alignment and structure |
| >pdb|2QHB|A Chain A, Crystal Structure Of Ngtrf Complexed With Telomeric Dna Length = 86 | Back alignment and structure |
| >pdb|2AJE|A Chain A, Solution Structure Of The Arabidopsis Thaliana Telomeric Repeat-Binding Protein Dna Binding Domain Length = 105 | Back alignment and structure |
| >pdb|2CKX|A Chain A, Crystal Structure Of Ngtrf1, Double-Stranded Telomeric Repeat Binding Factor From Nicotiana Tabacum Length = 83 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 699 | |||
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 3e-41 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 8e-39 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 2e-38 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 1e-35 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 6e-16 | |
| 1vf9_A | 64 | Telomeric repeat binding factor 2; MYB, helix-turn | 7e-16 | |
| 1w0u_A | 55 | Telomeric repeat binding factor 2; telomere, DNA-b | 9e-15 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 9e-14 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 4e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 |
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 | Back alignment and structure |
|---|
Score = 145 bits (366), Expect = 3e-41
Identities = 80/117 (68%), Positives = 91/117 (77%), Gaps = 1/117 (0%)
Query: 571 TVPAMSVEALAVVPVHRKSKRSEIVQRRIRRPFSVAEVEALVQAVEKLGTGRWRDVKLRA 630
+ ALA VP+ +SKR + QRRIRRPF+VAEVE LV+AVE LGTGRWRDVK RA
Sbjct: 3 PFADPNSLALANVPL-SRSKRPDFGQRRIRRPFTVAEVELLVEAVEHLGTGRWRDVKFRA 61
Query: 631 FDNAKHRTYVDLKDKWKTLVHTARISPQQRRGEPVPQELLDRVLTAHAYWTQQQAKQ 687
F+N HRTYVDLKDKWKTLVHTA I+PQQRRG PVPQELLDRVL A AYW+ + +
Sbjct: 62 FENVHHRTYVDLKDKWKTLVHTASIAPQQRRGAPVPQELLDRVLAAQAYWSVDSSGR 118
|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 | Back alignment and structure |
|---|
| >1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 | Back alignment and structure |
|---|
| >1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 62 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 699 | |||
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 99.97 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 99.97 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 99.95 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 99.94 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 99.69 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 99.37 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 99.18 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 99.16 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 98.67 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 98.59 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 98.55 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 98.4 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 98.38 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 98.33 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 98.25 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 98.18 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 98.12 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 98.1 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 98.1 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 98.08 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 98.02 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 97.97 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 97.96 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 97.95 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 97.93 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 97.88 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 97.86 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 97.86 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 97.85 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 97.78 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 97.77 | |
| 1v2y_A | 105 | 3300001G02RIK protein; hypothetical protein, ubiqu | 97.67 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 96.77 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 97.57 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 97.21 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 97.02 | |
| 2kk8_A | 84 | Uncharacterized protein AT4G05270; solution arabid | 97.0 | |
| 1wia_A | 95 | Hypothetical ubiquitin-like protein (riken cDNA 20 | 96.98 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 96.96 | |
| 2dzi_A | 81 | Ubiquitin-like protein 4A; GDX, structural genomic | 96.93 | |
| 1wx7_A | 106 | Ubiquilin 3; ubiquitin-like domain, structural gen | 96.83 | |
| 3a9j_A | 76 | Ubiquitin; protein complex, cytoplasm, isopeptide | 96.76 | |
| 2kan_A | 94 | Uncharacterized protein AR3433A; ubiquitin fold, a | 96.7 | |
| 3mtn_B | 85 | UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit | 96.69 | |
| 1wx8_A | 96 | Riken cDNA 4931431F19; ubiquitin-like domain, ubiq | 96.68 | |
| 1ndd_A | 76 | NEDD8, protein (ubiquitin-like protein NEDD8); pro | 96.66 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 96.65 | |
| 1j8c_A | 125 | Ubiquitin-like protein hplic-2; ubiquitin-like dom | 96.63 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 96.63 | |
| 3dbh_I | 88 | NEDD8; cell cycle, activating enzyme, apoptosis, m | 96.62 | |
| 1uel_A | 95 | HHR23B, UV excision repair protein RAD23 homolog B | 96.61 | |
| 2bwf_A | 77 | Ubiquitin-like protein DSK2; signaling protein, UB | 96.59 | |
| 1v86_A | 95 | DNA segment, CHR 7, wayne state university 128, ex | 96.54 | |
| 3n3k_B | 85 | Ubiquitin; hydrolase, protease, thiol protease, DU | 96.51 | |
| 2hj8_A | 88 | Interferon-induced 17 kDa protein; HR2873B, human | 96.33 | |
| 2wyq_A | 85 | HHR23A, UV excision repair protein RAD23 homolog A | 96.32 | |
| 1v5o_A | 102 | 1700011N24RIK protein; hypothetical protein, ubiqu | 96.29 | |
| 1wxv_A | 92 | BAG-family molecular chaperone regulator-1; struct | 96.28 | |
| 1wh3_A | 87 | 59 kDa 2'-5'-oligoadenylate synthetase like protei | 96.27 | |
| 2klc_A | 101 | Ubiquilin-1; ubiquitin-like, structural genomics, | 96.25 | |
| 4hcn_B | 98 | Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas | 96.24 | |
| 3phx_B | 79 | Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu | 96.24 | |
| 3v6c_B | 91 | Ubiquitin; structural genomics, structural genomic | 96.13 | |
| 2uyz_B | 79 | Small ubiquitin-related modifier 1; sumoylation, c | 96.12 | |
| 1yqb_A | 100 | Ubiquilin 3; structural genomics consortium, ubiqu | 96.1 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 96.09 | |
| 3k9o_B | 96 | Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b | 96.08 | |
| 2l7r_A | 93 | Ubiquitin-like protein FUBI; structural genomics, | 96.04 | |
| 1yx5_B | 98 | Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s | 95.99 | |
| 2ojr_A | 111 | Ubiquitin; lanthide-binding TAG, terbium, TB, SAD | 95.94 | |
| 3vdz_A | 111 | Ubiquitin-40S ribosomal protein S27A; gadolinium, | 95.94 | |
| 1x1m_A | 107 | Ubiquitin-like protein SB132; structural genomics, | 95.91 | |
| 1wy8_A | 89 | NP95-like ring finger protein, isoform A; ubiquiti | 95.82 | |
| 1wgd_A | 93 | Homocysteine-responsive endoplasmic reticulum- res | 95.82 | |
| 2dzj_A | 88 | Synaptic glycoprotein SC2; ubiquitin-like fold, st | 95.78 | |
| 4dwf_A | 90 | HLA-B-associated transcript 3; ubiquitin-like doma | 95.75 | |
| 1ttn_A | 106 | DC-UBP, dendritic cell-derived ubiquitin-like prot | 95.75 | |
| 2faz_A | 78 | Ubiquitin-like containing PHD and ring finger DOM | 95.65 | |
| 1sif_A | 88 | Ubiquitin; hydrophobic mutants, folding, stability | 95.64 | |
| 4fbj_B | 88 | NEDD8; effector-HOST target complex, glutamine dea | 95.57 | |
| 2kdb_A | 99 | Homocysteine-responsive endoplasmic reticulum- res | 95.51 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 95.49 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 95.4 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 95.36 | |
| 4a20_A | 98 | Ubiquitin-like protein MDY2; protein binding, GET- | 95.29 | |
| 1we7_A | 115 | SF3A1 protein; structural genomics, ubiquitin-like | 95.22 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 95.2 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 95.16 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 95.15 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 95.14 | |
| 1wyw_B | 97 | Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho | 95.07 | |
| 3m62_B | 106 | UV excision repair protein RAD23; armadillo-like r | 95.02 | |
| 2xb0_X | 270 | Chromo domain-containing protein 1; hydrolase, DNA | 95.01 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 94.96 | |
| 3b1l_X | 76 | E3 ubiquitin-protein ligase parkin; proteasome, AL | 93.89 | |
| 4eew_A | 88 | Large proline-rich protein BAG6; ubiquitin-like fo | 94.87 | |
| 2kdi_A | 114 | Ubiquitin, vacuolar protein sorting-associated pro | 94.67 | |
| 1v5t_A | 90 | 8430435I17RIK protein; hypothetical protein, ubiqu | 94.64 | |
| 2lxa_A | 87 | Ubiquitin-like protein MDY2; ubiquitin-like domain | 94.48 | |
| 4dbg_A | 105 | Ranbp-type and C3HC4-type zinc finger-containing; | 94.31 | |
| 3m63_B | 101 | Ubiquitin domain-containing protein DSK2; armadill | 94.2 | |
| 1wf9_A | 107 | NPL4 family protein; beta-grAsp fold like domain, | 94.18 | |
| 2kd0_A | 85 | LRR repeats and ubiquitin-like domain-containing p | 94.17 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 94.06 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 94.03 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 93.87 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 93.72 | |
| 1wgg_A | 96 | Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti | 93.6 | |
| 1we6_A | 111 | Splicing factor, putative; structural genomics, ub | 93.58 | |
| 2kj6_A | 97 | Tubulin folding cofactor B; methods development, N | 93.57 | |
| 2daf_A | 118 | FLJ35834 protein; hypothetical protein FLJ35834, u | 93.34 | |
| 3u5e_m | 128 | 60S ribosomal protein L40; translation, ribosome, | 93.23 | |
| 1uh6_A | 100 | Ubiquitin-like 5; beta-grAsp fold, structural geno | 92.91 | |
| 3l0w_B | 169 | Monoubiquitinated proliferating cell nuclear antig | 92.05 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 92.0 | |
| 2kzr_A | 86 | Ubiquitin thioesterase OTU1; structural genomics, | 91.97 | |
| 2gow_A | 125 | HCG-1 protein, ubiquitin-like protein 3; BC059385, | 91.58 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 91.52 | |
| 3ai5_A | 307 | Yeast enhanced green fluorescent protein, ubiquit; | 91.35 | |
| 2fnj_B | 118 | Transcription elongation factor B polypeptide 2; b | 91.17 | |
| 3u5c_f | 152 | 40S ribosomal protein S31; translation, ribosome, | 91.08 | |
| 1wgh_A | 116 | Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo | 90.51 | |
| 2dzm_A | 100 | FAS-associated factor 1; ubiquitin-like domain, HF | 90.32 | |
| 2kjr_A | 95 | CG11242; UBL, ubiquitin, ubiquitin-like, structura | 90.03 | |
| 1v6e_A | 95 | Cytoskeleton-associated protein 1; tubulin-specifi | 90.02 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 89.71 | |
| 4ajy_B | 118 | Transcription elongation factor B polypeptide 2; E | 88.88 | |
| 3q3f_A | 189 | Ribonuclease/ubiquitin chimeric protein; domain SW | 88.75 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 88.63 | |
| 1t0y_A | 122 | Tubulin folding cofactor B; ubiquitin-like, cytosk | 87.83 | |
| 1se9_A | 126 | Ubiquitin family; ubiquitin-like, cell-free, wheat | 87.82 | |
| 3a4r_A | 79 | Nfatc2-interacting protein; ubiquitin fold, coiled | 87.66 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 87.09 | |
| 2io1_B | 94 | Small ubiquitin-related modifier 3 precursor; SUMO | 86.67 | |
| 2xb0_X | 270 | Chromo domain-containing protein 1; hydrolase, DNA | 86.54 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 86.4 | |
| 1wju_A | 100 | NEDD8 ultimate buster-1; ubiquitin-like domain, st | 86.33 | |
| 1wm3_A | 72 | Ubiquitin-like protein SMT3B; ubiquitin fold, half | 86.12 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 86.05 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 85.99 | |
| 1wjn_A | 97 | Tubulin-folding protein TBCE; ubiquitin-like domai | 85.95 | |
| 3plu_A | 93 | Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- | 85.17 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 83.66 | |
| 4b6w_A | 86 | Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik | 82.47 | |
| 2k8h_A | 110 | Small ubiquitin protein; SUMO, post-translational | 81.35 | |
| 2pjh_A | 80 | Protein NPL4, nuclear protein localization protein | 81.21 | |
| 2d07_B | 93 | Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho | 80.47 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 80.19 |
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
Probab=99.97 E-value=9.4e-32 Score=246.61 Aligned_cols=116 Identities=69% Similarity=1.087 Sum_probs=111.0
Q ss_pred eccCCcccccccccccccCCCcccccCCCCCCCCHHHHHHHHHHHHHhCCCchHHHhhhccCCCCCCCchhhhhhhhhch
Q 042386 571 TVPAMSVEALAVVPVHRKSKRSEIVQRRIRRPFSVAEVEALVQAVEKLGTGRWRDVKLRAFDNAKHRTYVDLKDKWKTLV 650 (699)
Q Consensus 571 ~vp~~~~e~lA~~P~~~K~k~~e~~~RR~rr~WT~eEveaLv~GVekyG~GkW~~Il~~~~~~f~~RT~VDLKDKWRNL~ 650 (699)
+||+++++++|++|+ +|++.++.++||++++||.||+++|++||++||.|+|+.|+..+|+.|.+||.||||||||||+
T Consensus 3 ~~~~~~~~~~~~~p~-~k~~~~~~~~rr~r~~WT~EEd~~L~~gV~k~G~g~W~~I~~~~~~~~~~RT~vdlKdRWrnll 81 (122)
T 2roh_A 3 PFADPNSLALANVPL-SRSKRPDFGQRRIRRPFTVAEVELLVEAVEHLGTGRWRDVKFRAFENVHHRTYVDLKDKWKTLV 81 (122)
T ss_dssp CCSCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHSSSCHHHHHHHHHSSSCCCCHHHHHHHHHHHH
T ss_pred CCCCCCcccccccCc-ccCCCcCcCCCCCCCCCCHHHHHHHHHHHHHHCCCChHHHHHHhccccCCCCHHHHHHHHHHHH
Confidence 578888899999999 7888889999999999999999999999999999999999998888899999999999999999
Q ss_pred hccccCccccCCCCCChHHHHHHHHhhhchhHHHHHh
Q 042386 651 HTARISPQQRRGEPVPQELLDRVLTAHAYWTQQQAKQ 687 (699)
Q Consensus 651 K~a~i~pq~rr~~~iP~ell~RV~~~~ayw~q~q~kq 687 (699)
|.+.++|+.+++.++|+||++||++||+||.+||+||
T Consensus 82 k~~~~~p~~kr~~~~p~e~~~~v~~~h~~~g~~~~~~ 118 (122)
T 2roh_A 82 HTASIAPQQRRGAPVPQELLDRVLAAQAYWSVDSSGR 118 (122)
T ss_dssp HHHHSCTTTCCCSSCCHHHHHHHHHHHHHHHSSCSCC
T ss_pred hhccCCccccCCCCCCHHHHHHHHHHHHHHhhHHhhh
Confidence 9999999999999999999999999999999999886
|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... | Back alignment and structure |
|---|
| >2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I | Back alignment and structure |
|---|
| >1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S | Back alignment and structure |
|---|
| >1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A | Back alignment and structure |
|---|
| >1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B | Back alignment and structure |
|---|
| >2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B | Back alignment and structure |
|---|
| >1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A | Back alignment and structure |
|---|
| >2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B | Back alignment and structure |
|---|
| >2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A | Back alignment and structure |
|---|
| >1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A | Back alignment and structure |
|---|
| >1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B | Back alignment and structure |
|---|
| >2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A | Back alignment and structure |
|---|
| >1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C | Back alignment and structure |
|---|
| >3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A | Back alignment and structure |
|---|
| >4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A | Back alignment and structure |
|---|
| >2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A | Back alignment and structure |
|---|
| >3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p | Back alignment and structure |
|---|
| >1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
| >2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* | Back alignment and structure |
|---|
| >2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A | Back alignment and structure |
|---|
| >3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f | Back alignment and structure |
|---|
| >1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* | Back alignment and structure |
|---|
| >3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
| >1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} | Back alignment and structure |
|---|
| >2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 699 | ||||
| d2ckxa1 | 83 | a.4.1.3 (A:578-660) Telomere binding protein TBP1 | 3e-22 | |
| d1w0ta_ | 52 | a.4.1.4 (A:) DNA-binding domain of human telomeric | 4e-07 | |
| d1w0ua_ | 55 | a.4.1.4 (A:) Telomeric repeat binding factor 2, TR | 2e-05 |
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: Telomere binding protein TBP1 species: Tobacco (Nicotiana tabacum) [TaxId: 4097]
Score = 89.0 bits (220), Expect = 3e-22
Identities = 74/83 (89%), Positives = 79/83 (95%)
Query: 601 RPFSVAEVEALVQAVEKLGTGRWRDVKLRAFDNAKHRTYVDLKDKWKTLVHTARISPQQR 660
RPFSVAEVEALV+AVE LGTGRWRDVK+RAFDNA HRTYVDLKDKWKTLVHTA I+PQQR
Sbjct: 1 RPFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKWKTLVHTASIAPQQR 60
Query: 661 RGEPVPQELLDRVLTAHAYWTQQ 683
RGEPVPQ+LLDRVL AHAYW+QQ
Sbjct: 61 RGEPVPQDLLDRVLAAHAYWSQQ 83
|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 699 | |||
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 99.85 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 99.47 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 99.45 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 98.62 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 98.58 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 98.38 | |
| d1x58a1 | 49 | Hypothetical protein 4930532d21rik {Mouse (Mus mus | 98.19 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 98.12 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 98.07 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 97.98 | |
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 97.84 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 97.74 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 97.72 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 97.35 | |
| d1oqya4 | 77 | Ubiquitin-like domain of Rad23 homolog A (Hhr23a) | 97.17 | |
| d1wiaa_ | 95 | Ubiquitin-like protein bab25500 (2010008E23Rik) {M | 97.07 | |
| d1wgda_ | 93 | Homocysteine-responsive endoplasmic reticulum-resi | 96.49 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 96.48 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 96.39 | |
| d1v2ya_ | 105 | Ubiquitin-like protein 3300001g02rik {Mouse (Mus m | 96.39 | |
| d1uela_ | 95 | Ubiquitin-like domain of Rad23 homolog B (Hhr23B) | 95.96 | |
| d1v86a_ | 95 | hypothetical D7wsu128e protein {Mouse (Mus musculu | 95.77 | |
| d2bwfa1 | 73 | DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 95.57 | |
| d1yqba1 | 84 | Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | 95.54 | |
| d1wxva1 | 81 | Bag-family molecular chaperone regulator-1 {Human | 95.51 | |
| d1j8ca_ | 103 | Ubiquitin-like N-terminal domain of PLIC-2 {Human | 95.48 | |
| d1wx8a1 | 83 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 95.1 | |
| d1v5oa_ | 102 | 1700011n24rik protein {Mouse (Mus musculus) [TaxId | 94.74 | |
| d2c9wb1 | 103 | Elongin B {Human (Homo sapiens) [TaxId: 9606]} | 94.43 | |
| d1m94a_ | 73 | Ubiquitin-like modifier protein hub1 {Baker's yeas | 94.41 | |
| d1z2ma2 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 94.38 | |
| d1wjua_ | 100 | NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens | 94.21 | |
| d1bt0a_ | 73 | Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI | 94.17 | |
| d1ttna1 | 80 | Dendritic cell-derived ubiquitin-like protein {Hum | 94.15 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 93.85 | |
| d1ogwa_ | 76 | Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | 93.8 | |
| d1wh3a_ | 87 | 2'-5'-oligoadenylate synthetase-like protein, OASL | 93.76 | |
| d1wgga_ | 96 | Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M | 93.62 | |
| d1wgha_ | 116 | Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu | 93.4 | |
| d1z2ma1 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 93.25 | |
| d2zeqa1 | 78 | Ubiquitin-like domain of parkin {Mouse (Mus muscul | 92.8 | |
| d1v5ta_ | 90 | 8430435i17rik protein {Mouse (Mus musculus) [TaxId | 92.72 | |
| d1wjna_ | 97 | Tubulin-folding protein TbcE {Mouse (Mus musculus) | 92.04 | |
| d1wx9a1 | 73 | Large proline-rich protein BAT3 {Human (Homo sapie | 91.11 | |
| d1uh6a_ | 100 | Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu | 89.97 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 89.56 | |
| d1wy8a1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 88.35 | |
| d1se9a_ | 101 | Hypothetical protein At3g01050 {Thale cress (Arabi | 88.04 | |
| d1zkha1 | 86 | Splicing factor 3 subunit 1, C-terminal domain {Hu | 87.71 | |
| d2faza1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 87.28 | |
| d1euvb_ | 79 | SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy | 82.94 | |
| d1ofcx2 | 128 | SLIDE domain of the nucleosome remodeling ATPase I | 82.8 | |
| d1t0ya_ | 90 | Ubiquitin-like domain of tubulin folding cofactor | 82.13 | |
| d2uyzb1 | 77 | SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax | 80.56 | |
| d1we6a_ | 111 | Splicing factor 3 subunit 1, C-terminal domain {Th | 80.56 |
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: Telomere binding protein TBP1 species: Tobacco (Nicotiana tabacum) [TaxId: 4097]
Probab=99.85 E-value=4.7e-22 Score=168.38 Aligned_cols=83 Identities=89% Similarity=1.409 Sum_probs=79.7
Q ss_pred CCCCHHHHHHHHHHHHHhCCCchHHHhhhccCCCCCCCchhhhhhhhhchhccccCccccCCCCCChHHHHHHHHhhhch
Q 042386 601 RPFSVAEVEALVQAVEKLGTGRWRDVKLRAFDNAKHRTYVDLKDKWKTLVHTARISPQQRRGEPVPQELLDRVLTAHAYW 680 (699)
Q Consensus 601 r~WT~eEveaLv~GVekyG~GkW~~Il~~~~~~f~~RT~VDLKDKWRNL~K~a~i~pq~rr~~~iP~ell~RV~~~~ayw 680 (699)
|+||.||.++|++||++||.|+|+.|...++..|.+||.+|||||||||++.+...++.++++++|++||+||+++|++|
T Consensus 1 r~WT~eEd~~L~~~V~~~G~~~W~~I~~~~~~~~~~Rt~~qck~RWrn~l~~~~~~~~~~~~~~~p~ell~~v~~~~~~w 80 (83)
T d2ckxa1 1 RPFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKWKTLVHTASIAPQQRRGEPVPQDLLDRVLAAHAYW 80 (83)
T ss_dssp CCCCHHHHHHHHHHHHHHCSSCHHHHHHHHCTTCTTSCHHHHHHHHHHHHHHHHSCGGGCCSSCCCHHHHHHHHHHHHHH
T ss_pred CCCCHHHHHHHHHHHHHHCcccHHHHHHHHHhhccCCCHHHHHHHHHHHhhhhccCcccccCCCCCHHHHHHHHHHHHHH
Confidence 69999999999999999999999999988777889999999999999999999999999999999999999999999999
Q ss_pred hHH
Q 042386 681 TQQ 683 (699)
Q Consensus 681 ~q~ 683 (699)
+|+
T Consensus 81 sq~ 83 (83)
T d2ckxa1 81 SQQ 83 (83)
T ss_dssp HHC
T ss_pred hcC
Confidence 984
|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|