Citrus Sinensis ID: 042603


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870----
LHNFTNLEELILVESDLHVSQLLQSIASFSSLKYLSMRGCVLKGALHGQDFHEFKNLEHLVMDRMLVEVDTSFLQIVSESMASLRILSLSYSRLNKNTILDQGLCELVHLQELYIRDNDLRDSLLWCLANMTSLQVLNVASNQLTGNFPPGFCELVLLRELYIDNNDLRGSLPLCLANLTSLRVLDVSYNQLTENISSSPLMHLTSIEELILSNNHFQIPISLEPLFNLSKLKTFNGEIYAETESHYNSLTPKFQLTSISLSGYGDGGTFPKFLYHQHDLNNADLSHLNLSGEFPNWLPENNTDLKTLLLANNSLFGSFRMPIHCLQKLATLDVSNNFFLGHIPVEIGTYLPGLMHLNLSRNAFNGSIPSSFADMKMLKSLDISYNQLTGAIPERMAMGCFSLEILALSNNTLQGHIFSEKFNLTNLKRLQLDGNKFIGEIPESLSKCYLLGGLYLSDNHLSGKIPRWLGSLLALQDIIMPNNNLEGPIPNEFCQLDCLKVLDLSNNSIFGTLPSCLSLGSIEQVHLSKNKIEGQLESIIHYYPYLVTLDLSYNRLHGSIPNWIDKLPQLSYILLANNYIEGEIPVQLCQLKEVRLIDLSHNNLSGHIPPCLVNTALSEGYYDAVAPTWDHASAPALSYFPPNGSPMGKEETVQFTTKNMSYYYRGRILTSMSGIDLSCNKLTGEIPTQIGYLTRIRALNLSHNNLTGTIPTTFSNLKQIESLDLSYNLLHGKIPPQLIVLNTLAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPFLCGLPLSKSCDDNGLTTVTTEAYTENEEGDSLIDMDSFLITFTVSYGIVIIGIIGVLYINPYWRRRWFYLVEVCMTSCYYFVADNLTLRRFYRGWM
ccccccccEEEcccccccccccHHHHcccccccEEEccccccccccccccccccccccEEEccccccccccccHHHHHcccccccEEEcccccccccccccHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccEEccccccccccccEEEEEccccEEEcccccccccccccccEEEcccccccccccHHHHccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccEEEEEccccccccccccEEEccccccEEEccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccccEEEccccccEEccccccccccccEEEccccEEEEcccHHHHccccccEEEcccccccccccHHHcccccccEEEccccEEEEEccccccccccccEEEcccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccEEEEEEEEcccEEEEccHHHcccEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEHHHHHEEHHHHccccHHHHHHHHHHHHccEEEEEEEEEEEEHHHHcccc
cccccccEEEEccccccccccccHHHcccccccEEEcccccccccccHHHHHHHHcccHEEHHcccccccccccccHHccccccEEEEEccccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEEccccccccccccccccccEEEEccccccccccHHHcccccccccEEEEEccccccccccHHHcccccccEEEcccccccccccHHHHHHcHcccEEEcccccccccccHHHccccccEEEEEccccccccccHHHHHHcccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHccccccEEEEcccccccccccHHccccccEEEEEccccccccccHHHccccccEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHccHHHHHHHHHccccccccccccccccccHHHccccccEEEEEccccccccccHHHHHHccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHEEEEEHHccccHHHcccc
LHNFTNLEELILVESDLHVSQLLQSIASFSSLKYLSMRGCvlkgalhgqdfhefknLEHLVMDRMLVEVDTSFLQIVSESMASLRILSLSYSRLNKNTILDQGLCELVHLqelyirdnDLRDSLLWCLANMTSLQVLNVAsnqltgnfppgFCELVLLRELYidnndlrgslplcLANLTSLRVLDVSYNQltenisssplmhlTSIEELIlsnnhfqipisleplfnlsklktfngeiyaeteshynsltpkfqltsislsgygdggtfpkflyhqhdlnnadlshlnlsgefpnwlpenntDLKTLLLANnslfgsfrmpihclqklatldvsnnfflghipveigtylpglmhlnlsrnafngsipssfADMKMLKSLDISYNqltgaipermamGCFSLEILALSNNTLQGHIFSEKFNLTNLKRLQLDGNKFIGEIPESLSKCYLlgglylsdnhlsgkiprWLGSLLALQDiimpnnnlegpipnefcqldclkvldlsnnsifgtlpsclslgsieQVHLSKNKIEGQLESIIHYYPYLVTLDLSynrlhgsipnwidklpQLSYILLANNYIEGEIPVQLCQLKEVRLIdlshnnlsghippclvntalsegyydavaptwdhasapalsyfppngspmgkeetVQFTTKNMSYYYRGRIltsmsgidlscnkltgeiptqiGYLTRIRALNlshnnltgtipttfsnlkQIESLDLSYnllhgkippqliVLNTLAVFRVAYNnlsgkipdrvaqfstfeedsyegnpflcglplskscddnglttvtteayteneegdslidmDSFLITFTVSYGIVIIGIIGVlyinpywrRRWFYLVEVCMTSCYYFVADNLTLRRFYRGWM
LHNFTNLEELILVESDLHVSQLLQSIASFSSLKYLSMRGCVLKGALHGQDFHEFKNLEHLVMDRMLVEVDTSFLQIVSESMASLRILSLSYSRLNKNTILDQGLCELVHLQELYIRDNDLRDSLLWCLANMTSLQVLNVASNQLTGNFPPGFCELVLLRELYIDNNDLRGSLPLCLANLTSLRVLDVSYNQLTENISSSPLMHLTSIEELILSNNHFQIPISLEPLFNLSKLKTFNGEIYAETESHYNSLTPKFQLTSISLSGYGDGGTFPKFLYHQHDLNNADLSHLNLSGEFPNWLPENNTDLKTLLLANNSLFGSFRMPIHCLQKLATLDVSNNFFLGHIPVEIGTYLPGLMHLNLSRNAFNGSIPSSFADMKMLKSLDISYNQLTGAIPERMAMGCFSLEILALSNNTLQGHIFSEKFNLTNLKRLQLDGNKFIGEIPESLSKCYLLGGLYLSDNHLSGKIPRWLGSLLALQDIIMPNNNLEGPIPNEFCQLDCLKVLDLSNNSIFGTLPSCLSLGSIEQVHLSKNKIEGQLESIIHYYPYLVTLDLSYNRLHGSIPNWIDKLPQLSYILLANNYIEGEIPVQLCQLKEVRLIDLSHNNLSGHIPPCLVNTALSEGYYDAVAPTWDHASAPALSYFPPNGSPMGKEETVQFTTKNMSYYYRGRILTSMSGIDLSCNKLTGEIPTQIGYLTRIRALNLSHNNLTGTIPTTFSNLKQIESLDLSYNLLHGKIPPQLIVLNTLAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPFLCGLPLSKSCDDNGLTTVTTEAyteneegdsliDMDSFLITFTVSYGIVIIGIIGVLYINPYWRRRWFYLVEVCMTSCYYFVADNLTLRRFYRGWM
LHNFTNLEELILVESDLHVSQLLQSIASFSSLKYLSMRGCVLKGALHGQDFHEFKNLEHLVMDRMLVEVDTSFLQIVSESMAslrilslsysrlNKNTILDQGLCELVHLQELYIRDNDLRDSLLWCLANMTSLQVLNVASNQLTGNFPPGFCELVLLRELYIDNNDLRGSLPLCLANLTSLRVLDVSYNQLTENISSSPLMHLTSIEELILSNNHFQIPISLEPLFNLSKLKTFNGEIYAETESHYNSLTPKFQLTSISLSGYGDGGTFPKFLYHQHDLNNADLSHLNLSGEFPNWLPENNTDLKTLLLANNSLFGSFRMPIHCLQKLATLDVSNNFFLGHIPVEIGTYLPGLMHLNLSRNAFNGSIPSSFADMKMLKSLDISYNQLTGAIPERMAMGCFSLEILALSNNTLQGHIFSEKFNLTNLKRLQLDGNKFIGEIPESLSKCYLLGGLYLSDNHLSGKIPRWLGSLLALQDIIMPNNNLEGPIPNEFCQLDCLKVLDLSNNSIFGTLPSCLSLGSIEQVHLSKNKIEGQLESIIHYYPYLVTLDLSYNRLHGSIPNWIDKLPQLSYILLANNYIEGEIPVQLCQLKEVRLIDLSHNNLSGHIPPCLVNTALSEGYYDAVAPTWDHASAPALSYFPPNGSPMGKEETVQFTTKNMSYYYRGRILTSMSGIDLSCNKLTGEIPTQIGYLTRIRALNLSHNNLTGTIPTTFSNLKQIESLDLSYNLLHGKIPPQLIVLNTLAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPFLCGLPLSKSCDDNGLTTVTTEAYTENEEGDSLIDMDSFLITFTVSYgiviigiigvLYINPYWRRRWFYLVEVCMTSCYYFVADNLTLRRFYRGWM
****TNLEELILVESDLHVSQLLQSIASFSSLKYLSMRGCVLKGALHGQDFHEFKNLEHLVMDRMLVEVDTSFLQIVSESMASLRILSLSYSRLNKNTILDQGLCELVHLQELYIRDNDLRDSLLWCLANMTSLQVLNVASNQLTGNFPPGFCELVLLRELYIDNNDLRGSLPLCLANLTSLRVLDVSYNQLTENISSSPLMHLTSIEELILSNNHFQIPISLEPLFNLSKLKTFNGEIYAETESHYNSLTPKFQLTSISLSGYGDGGTFPKFLYHQHDLNNADLSHLNLSGEFPNWLPENNTDLKTLLLANNSLFGSFRMPIHCLQKLATLDVSNNFFLGHIPVEIGTYLPGLMHLNLSRNAFNGSIPSSFADMKMLKSLDISYNQLTGAIPERMAMGCFSLEILALSNNTLQGHIFSEKFNLTNLKRLQLDGNKFIGEIPESLSKCYLLGGLYLSDNHLSGKIPRWLGSLLALQDIIMPNNNLEGPIPNEFCQLDCLKVLDLSNNSIFGTLPSCLSLGSIEQVHLSKNKIEGQLESIIHYYPYLVTLDLSYNRLHGSIPNWIDKLPQLSYILLANNYIEGEIPVQLCQLKEVRLIDLSHNNLSGHIPPCLVNTALSEGYYDAVAPTWDHASAPALSYF************VQFTTKNMSYYYRGRILTSMSGIDLSCNKLTGEIPTQIGYLTRIRALNLSHNNLTGTIPTTFSNLKQIESLDLSYNLLHGKIPPQLIVLNTLAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPFLCGLPLSKSCDDNGLTTVTTEAYTENEEGDSLIDMDSFLITFTVSYGIVIIGIIGVLYINPYWRRRWFYLVEVCMTSCYYFVADNLTLRRFYRGW*
LHNFTNLEELILVESDLHVSQLLQSIASFSSLKYLSMRGCVLKGALHGQDFHEFKNLEHLVMDRMLVEVDTSFLQIVSESMASLRILSLSYSRLNKNTILDQGLCELVHLQELYIRDNDLRDSLLWCLANMTSLQVLNVASNQLTGNFPPGFCELVLLRELYIDNNDLRGSLPLCLANLTSLRVLDVSYNQLTENISSSPLMHLTSIEELILSNNHFQIPISLEPLFNLSKLKTFNGEIYAETESHYNSLTPKFQLTSISLSGYGDGGTFPKFLYHQHDLNNADLSHLNLSGEFPNWLPENNTDLKTLLLANNSLFGSFRMPIHCLQKLATLDVSNNFFLGHIPVEIGTYLPGLMHLNLSRNAFNGSIPSSFADMKMLKSLDISYNQLTGAIPERMAMGCFSLEILALSNNTLQGHIFSEKFNLTNLKRLQLDGNKFIGEIPESLSKCYLLGGLYLSDNHLSGKIPRWLGSLLALQDIIMPNNNLEGPIPNEFCQLDCLKVLDLSNNSIFGTLPSCLSLGSIEQVHLSKNKIEGQLESIIHYYPYLVTLDLSYNRLHGSIPNWIDKLPQLSYILLANNYIEGEIPVQLCQLKEVRLIDLSHNNLSGHIPPCLVNTALSEGYY***APTWDHASAPALSYFPPNGSPMGKEETVQFTTKNMSYYYRGRILTSMSGIDLSCNKLTGEIPTQIGYLTRIRALNLSHNNLTGTIPTTFSNLKQIESLDLSYNLLHGKIPPQLIVLNTLAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPFLCGLP****************************DMDSFLITFTVSYGIVIIGIIGVLYINPYWRRRWFYLVEVCMTSCYYFVADNLTLRRFYRGWM
LHNFTNLEELILVESDLHVSQLLQSIASFSSLKYLSMRGCVLKGALHGQDFHEFKNLEHLVMDRMLVEVDTSFLQIVSESMASLRILSLSYSRLNKNTILDQGLCELVHLQELYIRDNDLRDSLLWCLANMTSLQVLNVASNQLTGNFPPGFCELVLLRELYIDNNDLRGSLPLCLANLTSLRVLDVSYNQLTENISSSPLMHLTSIEELILSNNHFQIPISLEPLFNLSKLKTFNGEIYAETESHYNSLTPKFQLTSISLSGYGDGGTFPKFLYHQHDLNNADLSHLNLSGEFPNWLPENNTDLKTLLLANNSLFGSFRMPIHCLQKLATLDVSNNFFLGHIPVEIGTYLPGLMHLNLSRNAFNGSIPSSFADMKMLKSLDISYNQLTGAIPERMAMGCFSLEILALSNNTLQGHIFSEKFNLTNLKRLQLDGNKFIGEIPESLSKCYLLGGLYLSDNHLSGKIPRWLGSLLALQDIIMPNNNLEGPIPNEFCQLDCLKVLDLSNNSIFGTLPSCLSLGSIEQVHLSKNKIEGQLESIIHYYPYLVTLDLSYNRLHGSIPNWIDKLPQLSYILLANNYIEGEIPVQLCQLKEVRLIDLSHNNLSGHIPPCLVNTALSEGYYDAVAPTWDHASAPALSYFPPNGSPMGKEETVQFTTKNMSYYYRGRILTSMSGIDLSCNKLTGEIPTQIGYLTRIRALNLSHNNLTGTIPTTFSNLKQIESLDLSYNLLHGKIPPQLIVLNTLAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPFLCGLPLSKSCDDNGLTTVTTEAYTENEEGDSLIDMDSFLITFTVSYGIVIIGIIGVLYINPYWRRRWFYLVEVCMTSCYYFVADNLTLRRFYRGWM
*HNFTNLEELILVESDLHVSQLLQSIASFSSLKYLSMRGCVLKGALHGQDFHEFKNLEHLVMDRMLVEVDTSFLQIVSESMASLRILSLSYSRLNKNTILDQGLCELVHLQELYIRDNDLRDSLLWCLANMTSLQVLNVASNQLTGNFPPGFCELVLLRELYIDNNDLRGSLPLCLANLTSLRVLDVSYNQLTENISSSPLMHLTSIEELILSNNHFQIPISLEPLFNLSKLKTFNGEIYAETESHYNSLTPKFQLTSISLSGYGDGGTFPKFLYHQHDLNNADLSHLNLSGEFPNWLPENNTDLKTLLLANNSLFGSFRMPIHCLQKLATLDVSNNFFLGHIPVEIGTYLPGLMHLNLSRNAFNGSIPSSFADMKMLKSLDISYNQLTGAIPERMAMGCFSLEILALSNNTLQGHIFSEKFNLTNLKRLQLDGNKFIGEIPESLSKCYLLGGLYLSDNHLSGKIPRWLGSLLALQDIIMPNNNLEGPIPNEFCQLDCLKVLDLSNNSIFGTLPSCLSLGSIEQVHLSKNKIEGQLESIIHYYPYLVTLDLSYNRLHGSIPNWIDKLPQLSYILLANNYIEGEIPVQLCQLKEVRLIDLSHNNLSGHIPPCLVNTALSEGYYDAVAPTWDHASAPALSYFPPNGSPMGKEETVQFTTKNMSYYYRGRILTSMSGIDLSCNKLTGEIPTQIGYLTRIRALNLSHNNLTGTIPTTFSNLKQIESLDLSYNLLHGKIPPQLIVLNTLAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPFLCGLPLSKSCDDNGLTTVTTEAYTENEEGDSLIDMDSFLITFTVSYGIVIIGIIGVLYINPYWRRRWFYLVEVCMTSCYYFVADNLTLRRFYRGWM
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LHNFTNLEELILVESDLHVSQLLQSIASFSSLKYLSMRGCVLKGALHGQDFHEFKNLEHLVMDRMLVEVDTSFLQIVSESMASLRILSLSYSRLNKNTILDQGLCELVHLQELYIRDNDLRDSLLWCLANMTSLQVLNVASNQLTGNFPPGFCELVLLRELYIDNNDLRGSLPLCLANLTSLRVLDVSYNQLTENISSSPLMHLTSIEELILSNNHFQIPISLEPLFNLSKLKTFNGEIYAETESHYNSLTPKFQLTSISLSGYGDGGTFPKFLYHQHDLNNADLSHLNLSGEFPNWLPENNTDLKTLLLANNSLFGSFRMPIHCLQKLATLDVSNNFFLGHIPVEIGTYLPGLMHLNLSRNAFNGSIPSSFADMKMLKSLDISYNQLTGAIPERMAMGCFSLEILALSNNTLQGHIFSEKFNLTNLKRLQLDGNKFIGEIPESLSKCYLLGGLYLSDNHLSGKIPRWLGSLLALQDIIMPNNNLEGPIPNEFCQLDCLKVLDLSNNSIFGTLPSCLSLGSIEQVHLSKNKIEGQLESIIHYYPYLVTLDLSYNRLHGSIPNWIDKLPQLSYILLANNYIEGEIPVQLCQLKEVRLIDLSHNNLSGHIPPCLVNTALSEGYYDAVAPTWDHASAPALSYFPPNGSPMGKEETVQFTTKNMSYYYRGRILTSMSGIDLSCNKLTGEIPTQIGYLTRIRALNLSHNNLTGTIPTTFSNLKQIESLDLSYNLLHGKIPPQLIVLNTLAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPFLCGLPLSKSCDDNGLTTVTTEAYTENEEGDSLIDMDSFLITFTVSYGIVIIGIIGVLYINPYWRRRWFYLVEVCMTSCYYFVADNLTLRRFYRGWM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query874 2.2.26 [Sep-21-2011]
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.778 0.543 0.313 3e-76
C0LGQ5 1249 LRR receptor-like serine/ no no 0.875 0.612 0.312 1e-75
Q9C9H7847 Receptor-like protein 12 no no 0.719 0.742 0.306 2e-66
Q9LYN8 1192 Leucine-rich repeat recep no no 0.742 0.544 0.309 3e-64
Q9LHP4 1141 Receptor-like protein kin no no 0.684 0.524 0.310 1e-60
Q9FL28 1173 LRR receptor-like serine/ no no 0.775 0.578 0.289 8e-60
Q8L899 1207 Systemin receptor SR160 O N/A no 0.762 0.551 0.303 1e-59
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.763 0.552 0.299 3e-59
Q9SHI2 1101 Leucine-rich repeat recep no no 0.719 0.571 0.295 5e-58
Q9ZWC8 1166 Serine/threonine-protein no no 0.737 0.553 0.292 3e-57
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function desciption
 Score =  286 bits (733), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 230/733 (31%), Positives = 356/733 (48%), Gaps = 53/733 (7%)

Query: 104 LCELVHLQELYIRDNDLRDSLLWCLANMTSLQVLNVASNQLTGNFPPGFCELVLLRELYI 163
           L  LV+L+ L + DN+L  ++     N+ +LQ+L +AS +LTG  P  F  LV L+ L +
Sbjct: 140 LGSLVNLKSLKLGDNELNGTIPETFGNLVNLQMLALASCRLTGLIPSRFGRLVQLQTLIL 199

Query: 164 DNNDLRGSLPLCLANLTSLRVLDVSYNQLTENISSSPLMHLTSIEELILSNNHF--QIPI 221
            +N+L G +P  + N TSL +   ++N+L  ++ +  L  L +++ L L +N F  +IP 
Sbjct: 200 QDNELEGPIPAEIGNCTSLALFAAAFNRLNGSLPAE-LNRLKNLQTLNLGDNSFSGEIPS 258

Query: 222 SLEPLFNLSKLKTFNGEIYAETESHYNSLTPKFQLTSISLSGYGDGGTFPKFLYHQHDLN 281
            L  L ++  L     ++          LT    L ++ LS     G   +  +  + L 
Sbjct: 259 QLGDLVSIQYLNLIGNQLQGLIPKR---LTELANLQTLDLSSNNLTGVIHEEFWRMNQLE 315

Query: 282 NADLSHLNLSGEFPNWLPENNTDLKTLLLANNSLFGSFRMPIHCLQKLATLDVSNNFFLG 341
              L+   LSG  P  +  NNT LK L L+   L G     I   Q L  LD+SNN   G
Sbjct: 316 FLVLAKNRLSGSLPKTICSNNTSLKQLFLSETQLSGEIPAEISNCQSLKLLDLSNNTLTG 375

Query: 342 HIPVEIGTYLPGLMHLNLSRNAFNGSIPSSFADMKMLKSLDISYNQLTGAIPERMAM--- 398
            IP  +   L  L +L L+ N+  G++ SS +++  L+   + +N L G +P+ +     
Sbjct: 376 QIPDSL-FQLVELTNLYLNNNSLEGTLSSSISNLTNLQEFTLYHNNLEGKVPKEIGFLGK 434

Query: 399 --------------------GCFSLEILALSNNTLQGHIFSEKFNLTNLKRLQLDGNKFI 438
                                C  L+ +    N L G I S    L +L RL L  N+ +
Sbjct: 435 LEIMYLYENRFSGEMPVEIGNCTRLQEIDWYGNRLSGEIPSSIGRLKDLTRLHLRENELV 494

Query: 439 GEIPESLSKCYLLGGLYLSDNHLSGKIPRWLGSLLALQDIIMPNNNLEGPIPNEFCQLDC 498
           G IP SL  C+ +  + L+DN LSG IP   G L AL+  ++ NN+L+G +P+    L  
Sbjct: 495 GNIPASLGNCHQMTVIDLADNQLSGSIPSSFGFLTALELFMIYNNSLQGNLPDSLINLKN 554

Query: 499 LKVLDLSNNSIFGTLPSCLSLGSIEQVHLSKNKIEGQLESIIHYYPYLVTLDLSYNRLHG 558
           L  ++ S+N   G++       S     +++N  EG +   +     L  L L  N+  G
Sbjct: 555 LTRINFSSNKFNGSISPLCGSSSYLSFDVTENGFEGDIPLELGKSTNLDRLRLGKNQFTG 614

Query: 559 SIPNWIDKLPQLSYILLANNYIEGEIPVQLCQLKEVRLIDLSHNNLSGHIP------PCL 612
            IP    K+ +LS + ++ N + G IPV+L   K++  IDL++N LSG IP      P L
Sbjct: 615 RIPRTFGKISELSLLDISRNSLSGIIPVELGLCKKLTHIDLNNNYLSGVIPTWLGKLPLL 674

Query: 613 VNTALSEGYYDAVAPTWDHASAPALSYFPPNGSPMGK--EETVQFTTKNMSYYYRGRI-- 668
               LS   +    PT   +    L+ F    S  G   +E       N       ++  
Sbjct: 675 GELKLSSNKFVGSLPTEIFSLTNILTLFLDGNSLNGSIPQEIGNLQALNALNLEENQLSG 734

Query: 669 --------LTSMSGIDLSCNKLTGEIPTQIGYLTRIR-ALNLSHNNLTGTIPTTFSNLKQ 719
                   L+ +  + LS N LTGEIP +IG L  ++ AL+LS+NN TG IP+T S L +
Sbjct: 735 PLPSTIGKLSKLFELRLSRNALTGEIPVEIGQLQDLQSALDLSYNNFTGRIPSTISTLPK 794

Query: 720 IESLDLSYNLLHGKIPPQLIVLNTLAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPFL 779
           +ESLDLS+N L G++P Q+  + +L    ++YNNL GK+     QFS ++ D++ GN  L
Sbjct: 795 LESLDLSHNQLVGEVPGQIGDMKSLGYLNLSYNNLEGKLK---KQFSRWQADAFVGNAGL 851

Query: 780 CGLPLSKSCDDNG 792
           CG PLS  C+  G
Sbjct: 852 CGSPLSH-CNRAG 863




Together with GSO1, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons. Involved in the nuclear division phase of megagametogenesis.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query874
255581263912 serine-threonine protein kinase, plant-t 0.922 0.883 0.496 0.0
224142481781 predicted protein [Populus trichocarpa] 0.830 0.929 0.482 0.0
224134891953 predicted protein [Populus trichocarpa] 0.943 0.865 0.421 1e-168
224073436 1014 predicted protein [Populus trichocarpa] 0.979 0.844 0.414 1e-164
359476165 1464 PREDICTED: LRR receptor-like serine/thre 0.921 0.549 0.430 1e-164
224073382 1309 predicted protein [Populus trichocarpa] 0.818 0.546 0.444 1e-161
224123984 1016 predicted protein [Populus trichocarpa] 0.882 0.758 0.429 1e-159
224073422969 predicted protein [Populus trichocarpa] 0.868 0.783 0.429 1e-159
224124490 981 predicted protein [Populus trichocarpa] 0.973 0.867 0.409 1e-154
359482745 1026 PREDICTED: leucine-rich repeat receptor 0.958 0.816 0.403 1e-154
>gi|255581263|ref|XP_002531443.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223528936|gb|EEF30930.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/854 (49%), Positives = 546/854 (63%), Gaps = 48/854 (5%)

Query: 30  SSLKYLSMRGCVLKGALHGQDFHEFKNLEHLVMDRMLVEVDTSFLQIVSESMASLRILSL 89
           ++  Y S R   L  +L    F E K+L  L  + ++  V+    + +S  ++SL +L L
Sbjct: 78  TTRAYQSSRNWYLNASLF-LPFEELKSLS-LKGNSIVDCVENEGFERLSTRLSSLEVLDL 135

Query: 90  SYSRLNKNT-----------------------ILDQGLCELVHLQELYIRDNDLRDSLLW 126
           SY+  N++                        I  Q L    +L+ELY+   +L +S L 
Sbjct: 136 SYNSFNESILSSLSEFSSLKSLNLGFNPFEVPIQAQDLPNFENLEELYLDKIELENSFLQ 195

Query: 127 CLANMTSLQVLNVASNQLTGNFP--PGFCELVLLRELYIDNNDLRGSLPLCLANLTSLRV 184
            +  MTSL+VL+++   LTG  P   G CEL+ LR L + +N+  G LP CL+NLTSL++
Sbjct: 196 TVGVMTSLKVLSLSGCGLTGALPNVQGLCELIHLRVLDVSSNEFHGILPWCLSNLTSLQL 255

Query: 185 LDVSYNQLTENISSSPLMHLTSIEELILSNNHFQIPISLEPLFNLSKLKTFNGE---IYA 241
           LD+S NQ   +IS+SPL  L S+ +L +SNNHFQ+P SL P FN S LK   G+   IY 
Sbjct: 256 LDLSSNQFVGDISNSPLKILKSLVDLDVSNNHFQVPFSLGPFFNHSNLKHIRGQNNAIYL 315

Query: 242 ETESHYNSLTPKFQLTSISLSGYGDGGTFPKFLYHQHDLNNADLSHLNLSGEFPNWLPEN 301
           E E H     P+FQL SI  SGYG  GTFP FLYHQ++L   DLSHL+L GEFPNWL  N
Sbjct: 316 EAELHS---APRFQLISIIFSGYGICGTFPNFLYHQNNLQFVDLSHLSLKGEFPNWLLTN 372

Query: 302 NTDLKTLLLANNSLFGSFRMPIHCLQKLATLDVSNNFFLGHIPVEIGTYLPGLMHLNLSR 361
           NT L+ L L NNSL G  ++P+H    L  LD+SNN    HIP+EIGT+LP L  LN+S 
Sbjct: 373 NTRLEILDLVNNSLSGHLQLPLHPHVNLLALDISNNHVHDHIPLEIGTFLPKLELLNMSS 432

Query: 362 NAFNGSIPSSFADMKMLKSLDISYNQLTGAIPERMAMGCFSLEILALSNNTLQGHIFSEK 421
           N F+GSIPSSF +M  L+ LD+S NQL+G+IPE +A GCFSL  L LSNN+LQG +FS++
Sbjct: 433 NGFDGSIPSSFGNMNSLRILDLSNNQLSGSIPEHLATGCFSLNTLILSNNSLQGQMFSKQ 492

Query: 422 FNLTNLKRLQLDGNKFIGEIPESLSKCYLLGGLYLSDNHLSGKIPRWLGSLLALQDIIMP 481
           FNLTNL  L+LD N F G IP+SLSK   L  + LSDNHLSG IP W+G+L  LQ++I+ 
Sbjct: 493 FNLTNLWWLELDKNHFSGRIPKSLSKSA-LSIMDLSDNHLSGMIPGWIGNLSYLQNLILS 551

Query: 482 NNNLEGPIPNEFCQLDCLKVLDLSNNSIFGTLPSCLSLGSIEQVHLSKNKIEGQLESIIH 541
           NN L+GPIP EFCQL  L+VLDL+NNS+ G LPSCLS  SI  VHLS+N IEG   +   
Sbjct: 552 NNRLKGPIPVEFCQLHYLEVLDLANNSVSGILPSCLSPSSIIHVHLSQNMIEGPWTNAFS 611

Query: 542 YYPYLVTLDLSYNRLHGSIPNWIDKLPQLSYILLANNYIEGEIPVQLCQLKEVRLIDLSH 601
              +LVTLDLS NR+ G IP  I  +  L  + L +N  +GEIP Q+C L ++ LI L+ 
Sbjct: 612 GSHFLVTLDLSSNRITGRIPTLIGGINALRILNLKSNRFDGEIPAQICGLYQLSLIVLAD 671

Query: 602 NNLSGHIPPCLVNTALSEGYYDAVAPTWDHASAPALSYFPPNGSPMGKEETVQFTTKNMS 661
           NNLSG IP CL    L +   D++AP       P   Y+ P   PM       FTTK  S
Sbjct: 672 NNLSGSIPSCL---QLDQS--DSLAPDVPPVPNPLNPYYLP-VRPM------YFTTKRRS 719

Query: 662 YYYRGRILTSMSGIDLSCNKLTGEIPTQIGYLTRIRALNLSHNNLTGTIPTTFSNLKQIE 721
           Y Y+G+IL+ +SGID SCNKLTGEIP ++G  + I +LNLS+N  TG IP+TFSNLKQIE
Sbjct: 720 YSYQGKILSYISGIDFSCNKLTGEIPPEMGNHSAIYSLNLSYNRFTGPIPSTFSNLKQIE 779

Query: 722 SLDLSYNLLHGKIPPQLIVLNTLAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPFLCG 781
           SLDLSYN L+G IP QL+ L  L+ F VA+NNL GK P R  QF+TFE  SYEGNP LCG
Sbjct: 780 SLDLSYNNLNGDIPSQLLELKFLSYFSVAHNNLFGKTPKRTGQFATFEVSSYEGNPNLCG 839

Query: 782 LPLSKSCDDNGLTTVTTEAYTENEEGDSLIDMDSFLITFTVSYGIVIIGIIGVLYINPYW 841
           LPL KSC +   ++    +  + E   + +DM++F  +F VSY  VIIG+  VLYINP W
Sbjct: 840 LPLPKSCTEREASSAPRASAMDEES--NFLDMNTFYGSFIVSYTFVIIGMFLVLYINPQW 897

Query: 842 RRRWFYLVEVCMTS 855
           RR WF  V++C++S
Sbjct: 898 RRAWFDFVDICISS 911




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224142481|ref|XP_002324585.1| predicted protein [Populus trichocarpa] gi|222866019|gb|EEF03150.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224134891|ref|XP_002327515.1| predicted protein [Populus trichocarpa] gi|222836069|gb|EEE74490.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073436|ref|XP_002304095.1| predicted protein [Populus trichocarpa] gi|222841527|gb|EEE79074.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359476165|ref|XP_002283141.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224073382|ref|XP_002304087.1| predicted protein [Populus trichocarpa] gi|222841519|gb|EEE79066.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224123984|ref|XP_002330258.1| predicted protein [Populus trichocarpa] gi|222871714|gb|EEF08845.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073422|ref|XP_002304093.1| predicted protein [Populus trichocarpa] gi|222841525|gb|EEE79072.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224124490|ref|XP_002330036.1| predicted protein [Populus trichocarpa] gi|222871461|gb|EEF08592.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359482745|ref|XP_003632825.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query874
TAIR|locus:20250121083 RLP1 "AT1G07390" [Arabidopsis 0.815 0.658 0.417 2.8e-128
TAIR|locus:20373131000 RLP13 "AT1G74170" [Arabidopsis 0.950 0.831 0.370 2.1e-125
TAIR|locus:2101943891 RLP45 "AT3G53240" [Arabidopsis 0.914 0.896 0.368 1.2e-120
TAIR|locus:2037308976 RLP14 "AT1G74180" [Arabidopsis 0.842 0.754 0.4 3.2e-120
TAIR|locus:2155909908 RLP56 "AT5G49290" [Arabidopsis 0.914 0.879 0.352 1.5e-106
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.848 0.793 0.358 9.8e-103
TAIR|locus:2019662965 RLP15 "AT1G74190" [Arabidopsis 0.832 0.754 0.324 3.1e-90
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.824 0.575 0.304 1.6e-76
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.735 0.566 0.297 6e-66
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.765 0.535 0.301 2.1e-64
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1259 (448.2 bits), Expect = 2.8e-128, P = 2.8e-128
 Identities = 312/748 (41%), Positives = 409/748 (54%)

Query:   132 TSLQVLNVASNQL--TGNFPPGFCELVLLRELYIDNNDLRGSLPLCLANLTSLRVLDVSY 189
             TSLQVL+   NQL  T     G C L+ LREL + +N L  SLP CL NLT LR LD+S 
Sbjct:   332 TSLQVLDFKRNQLSLTHEGYLGICRLMKLRELDLSSNALT-SLPYCLGNLTHLRTLDLSN 390

Query:   190 NQLTENISSSPLMHLTSI-EELILSNNHFQIPISLEPLFNLSKLKTFN-----GEIYAET 243
             NQL  N+SS  +  L S+ E L L +N+F        L N ++L  F      G I  +T
Sbjct:   391 NQLNGNLSSF-VSGLPSVLEYLSLLDNNFDGSFLFNSLVNQTRLTVFKLSSKVGVIQVQT 449

Query:   244 ESHYNSLTPKFQLTSISLSGYGDGGTFPKFLYHQHDLNNADLSHLNLSGEFPNWLPENNT 303
             ES   S  P FQL  + LS    G T   FL HQ DL   DLSH  L+G FP WL +NNT
Sbjct:   450 ES---SWAPLFQLKMLYLSNCSLGSTMLGFLVHQRDLCFVDLSHNKLTGTFPTWLVKNNT 506

Query:   304 DLKTLLLANNSLFGSFRMPIHCLQKLATLDVSNNFFLGHIPVEIGTYLPGLMHLNLSRNA 363
              L+T+LL+ NSL    ++PI  +  L  LD+S+N     I  +IG   P L  +N S N 
Sbjct:   507 RLQTILLSGNSLT-KLQLPI-LVHGLQVLDISSNMIYDSIQEDIGMVFPNLRFMNFSSNH 564

Query:   364 FNGSIPSSFADMKMLKSLDISYNQLTGAIPERMAMGCFSLEILALSNNTLQGHIFSEKFN 423
             F G+IPSS  +MK L+ LD+S N L G +P     GC+SL +L LSNN LQG IFS+  N
Sbjct:   565 FQGTIPSSIGEMKSLQVLDMSSNGLYGQLPIMFLSGCYSLRVLKLSNNQLQGKIFSKHAN 624

Query:   424 LTNLKRLQLDGNKFIGEIPESLSKCYLLGGLYLSDNHLSGKIPRWLGSLLALQDIIMPNN 483
             LT L  L LDGN F G + E L K   L  L +SDN  SG +P W+G +  L  + M  N
Sbjct:   625 LTGLVGLFLDGNNFTGSLEEGLLKSKNLTLLDISDNRFSGMLPLWIGRISRLSYLYMSGN 684

Query:   484 NLEGPIPNEFCQLDCLKVLDLSNNSIFGTLPSCLSLGSIEQVHLSKNKIEGQLESIIHYY 543
              L+GP P    Q   ++V+D+S+NS  G++P  ++  S+ ++ L  N+  G +   +   
Sbjct:   685 QLKGPFPF-LRQSPWVEVMDISHNSFSGSIPRNVNFPSLRELRLQNNEFTGLVPGNLFKA 743

Query:   544 PYLVTLDLSYNRLHGSIPNWIDKLPQLSYILLANNYIEGEIPVQLCQLKEVRLIDLSHNN 603
               L  LDL  N   G I N ID+  +L  +LL NN  +  IP ++CQL EV L+DLSHN 
Sbjct:   744 AGLEVLDLRNNNFSGKILNTIDQTSKLRILLLRNNSFQTYIPGKICQLSEVGLLDLSHNQ 803

Query:   604 LSGHIPPCLVNTALSEGYYDAVAPTWDHASAPALSYFP--PNGSPMGKEE---------- 651
               G IP C    +      D             +++ P    GS +  ++          
Sbjct:   804 FRGPIPSCFSKMSFGAEQNDRTMSLVADFDFSYITFLPHCQYGSHLNLDDGVRNGYQPKP 863

Query:   652 --TVQFTTKNMSYYYRGRILTSMSGIDLSCNKLTGEIPTQIGYLTRIRALNLSHNNLTGT 709
                V F TK+    Y+G IL  M G+DLS N+L+GEIP +IG L  IR+LNLS N LTG+
Sbjct:   864 ATVVDFLTKSRYEAYQGDILRYMHGLDLSSNELSGEIPIEIGDLQNIRSLNLSSNRLTGS 923

Query:   710 IPTTFSNLKQIESLDLSYNLLHGKIPPQLIVLNTLAVFRVAYNNLSGKIPDRVAQFSTFE 769
             IP + S LK +ESLDLS N L G IPP L  LN+L    ++YNNLSG+IP +     TF+
Sbjct:   924 IPDSISKLKGLESLDLSNNKLDGSIPPALADLNSLGYLNISYNNLSGEIPFK-GHLVTFD 982

Query:   770 EDSYEGNPFLCGLPLSKSCDDNGLT---TVTTEAYTE-NEEGDSLIDMDSFLITFTVSYX 825
             E SY GN  LCGLP +K+C    +    +V+T A  E NEE  ++IDM  F  T    Y 
Sbjct:   983 ERSYIGNAHLCGLPTNKNCISQRVPEPPSVSTHAKEEENEEEGNVIDMVWFYWTCAAVYI 1042

Query:   826 XXXXXXXXXLYINPYWRRRWFYLVEVCM 853
                      LYI+  W R WFY V++C+
Sbjct:  1043 STSLALFAFLYIDSRWSREWFYRVDLCV 1070


GO:0005575 "cellular_component" evidence=ND
GO:0007165 "signal transduction" evidence=IC
GO:0006457 "protein folding" evidence=RCA
GO:0006857 "oligopeptide transport" evidence=RCA
GO:0009408 "response to heat" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query874
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-60
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-58
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-58
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-51
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-48
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-40
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-32
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  220 bits (562), Expect = 7e-60
 Identities = 160/506 (31%), Positives = 246/506 (48%), Gaps = 32/506 (6%)

Query: 285 LSHLNLSGEFPNW---LPENNTDLKTLLLANNSLFGSFRMPIHCLQKLATLDVSNNFFLG 341
           LS+ N S +   W      N++ + ++ L+  ++ G     I  L  + T+++SNN   G
Sbjct: 48  LSNWNSSADVCLWQGITCNNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSG 107

Query: 342 HIPVEIGTYLPGLMHLNLSRNAFNGSIPSSFADMKMLKSLDISYNQLTGAIPERMAMGCF 401
            IP +I T    L +LNLS N F GSIP        L++LD+S N L+G IP  +  G F
Sbjct: 108 PIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSI--PNLETLDLSNNMLSGEIPNDI--GSF 163

Query: 402 S-LEILALSNNTLQGHIFSEKFNLTNLKRLQLDGNKFIGEIPESLSKCYLLGGLYLSDNH 460
           S L++L L  N L G I +   NLT+L+ L L  N+ +G+IP  L +   L  +YL  N+
Sbjct: 164 SSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNN 223

Query: 461 LSGKIPRWLGSLLALQDIIMPNNNLEGPIPNEFCQLDCLKVLDLSNNSIFGTLP-SCLSL 519
           LSG+IP  +G L +L  + +  NNL GPIP+    L  L+ L L  N + G +P S  SL
Sbjct: 224 LSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSL 283

Query: 520 GSIEQVHLSKNKIEGQLESIIHYYPYLVTLDLSYNRLHGSIPNWIDKLPQLSYILLANNY 579
             +  + LS N + G++  ++     L  L L  N   G IP  +  LP+L  + L +N 
Sbjct: 284 QKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNK 343

Query: 580 IEGEIPVQLCQLKEVRLIDLSHNNLSGHIPPCLVNTA-------LSEGYYDAVAPTWDHA 632
             GEIP  L +   + ++DLS NNL+G IP  L ++         S      +  +    
Sbjct: 344 FSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGAC 403

Query: 633 SAPALSYFPPNGSPMGKEETVQFTTKNMSYY-------YRGRI------LTSMSGIDLSC 679
            +        N      E   +FT   + Y+        +GRI      + S+  + L+ 
Sbjct: 404 RSLRRVRLQDNS--FSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLAR 461

Query: 680 NKLTGEIPTQIGYLTRIRALNLSHNNLTGTIPTTFSNLKQIESLDLSYNLLHGKIPPQLI 739
           NK  G +P   G   R+  L+LS N  +G +P    +L ++  L LS N L G+IP +L 
Sbjct: 462 NKFFGGLPDSFGS-KRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELS 520

Query: 740 VLNTLAVFRVAYNNLSGKIPDRVAQF 765
               L    +++N LSG+IP   ++ 
Sbjct: 521 SCKKLVSLDLSHNQLSGQIPASFSEM 546


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 874
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG4237498 consensus Extracellular matrix protein slit, conta 99.94
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
KOG4237498 consensus Extracellular matrix protein slit, conta 99.89
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
PLN03150623 hypothetical protein; Provisional 99.6
PLN03150623 hypothetical protein; Provisional 99.23
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.17
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.16
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.16
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.15
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.11
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.1
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.08
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.07
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.99
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.98
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.97
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.97
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.89
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.85
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.85
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.84
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.74
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.66
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.66
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.64
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.43
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.3
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.25
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.14
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.14
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.12
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.04
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.03
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.02
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.84
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.78
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.76
KOG4341483 consensus F-box protein containing LRR [General fu 97.75
PRK15386426 type III secretion protein GogB; Provisional 97.69
KOG4341483 consensus F-box protein containing LRR [General fu 97.68
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.61
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.52
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.46
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.44
PRK15386426 type III secretion protein GogB; Provisional 97.26
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.55
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.49
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.29
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.29
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.2
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.17
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.86
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.57
KOG4308478 consensus LRR-containing protein [Function unknown 94.88
KOG4308478 consensus LRR-containing protein [Function unknown 91.73
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.15
smart0037026 LRR Leucine-rich repeats, outliers. 91.15
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.85
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.99
KOG0473 326 consensus Leucine-rich repeat protein [Function un 89.31
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.27
smart0037026 LRR Leucine-rich repeats, outliers. 89.27
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 87.09
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.3
KOG3864221 consensus Uncharacterized conserved protein [Funct 85.31
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.6e-62  Score=603.50  Aligned_cols=541  Identities=34%  Similarity=0.503  Sum_probs=474.0

Q ss_pred             CCCCEEEccCCcCCCCCcccccCCCCCCEEEccCCcCCCCcccccc-CCCCCCEEEcccccccccCCccccCCCCCCCEE
Q 042603          132 TSLQVLNVASNQLTGNFPPGFCELVLLRELYIDNNDLRGSLPLCLA-NLTSLRVLDVSYNQLTENISSSPLMHLTSIEEL  210 (874)
Q Consensus       132 ~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~-~l~~L~~L~L~~n~l~~~~~~~~l~~l~~L~~L  210 (874)
                      .+++.|++++|.+++..+..|..+++|++|++++|++.+.+|..+. .+++|++|+|++|++++.+|.   ..+++|++|
T Consensus        69 ~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~---~~l~~L~~L  145 (968)
T PLN00113         69 SRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR---GSIPNLETL  145 (968)
T ss_pred             CcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc---cccCCCCEE
Confidence            4688888888888877777888888888888888888766665543 778888888888887775554   345666666


Q ss_pred             EccccccccccCcccccCCCCCceeccccccccccccCCCCCCceeeEEEccCCCCCCCCChhccCCCCCCEEEcCCCCC
Q 042603          211 ILSNNHFQIPISLEPLFNLSKLKTFNGEIYAETESHYNSLTPKFQLTSISLSGYGDGGTFPKFLYHQHDLNNADLSHLNL  290 (874)
Q Consensus       211 ~l~~n~~~~~~~~~~l~~l~~L~~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~n~l  290 (874)
                      ++++|.+.                                                 +.+|..++.+++|++|++++|.+
T Consensus       146 ~Ls~n~~~-------------------------------------------------~~~p~~~~~l~~L~~L~L~~n~l  176 (968)
T PLN00113        146 DLSNNMLS-------------------------------------------------GEIPNDIGSFSSLKVLDLGGNVL  176 (968)
T ss_pred             ECcCCccc-------------------------------------------------ccCChHHhcCCCCCEEECccCcc
Confidence            66666543                                                 44566677777888888888888


Q ss_pred             cccCCcchhcCCCCCCEEEccCCcccccccCCccCCCcccEEEccCCcCCccCChhhhcCCCCCcEEEccCCcCCcccch
Q 042603          291 SGEFPNWLPENNTDLKTLLLANNSLFGSFRMPIHCLQKLATLDVSNNFFLGHIPVEIGTYLPGLMHLNLSRNAFNGSIPS  370 (874)
Q Consensus       291 ~~~~p~~l~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~i~~~~~~~l~~L~~L~l~~n~i~~~~~~  370 (874)
                      .+.+|..+ .++++|++|++++|.+.+..|..+..+++|++|++++|.+.+.+|..+.. +++|++|++++|.+++..|.
T Consensus       177 ~~~~p~~~-~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~-l~~L~~L~L~~n~l~~~~p~  254 (968)
T PLN00113        177 VGKIPNSL-TNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGG-LTSLNHLDLVYNNLTGPIPS  254 (968)
T ss_pred             cccCChhh-hhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhc-CCCCCEEECcCceeccccCh
Confidence            77777765 57888888888888888888888888889999999999888888877655 78999999999999888898


Q ss_pred             hccCCCCcCEEEcccCcCCCCchhHHHhcCCCCCEEEcccCcccccCCccccCCCCCCeEEccCCcCcccCCccccccCC
Q 042603          371 SFADMKMLKSLDISYNQLTGAIPERMAMGCFSLEILALSNNTLQGHIFSEKFNLTNLKRLQLDGNKFIGEIPESLSKCYL  450 (874)
Q Consensus       371 ~~~~l~~L~~L~l~~n~i~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~  450 (874)
                      .+.++++|++|++++|.+++.+|..+. .+++|+.|++++|.+.+..|..+..+++|+.|++++|.+.+..|..+..+++
T Consensus       255 ~l~~l~~L~~L~L~~n~l~~~~p~~l~-~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~  333 (968)
T PLN00113        255 SLGNLKNLQYLFLYQNKLSGPIPPSIF-SLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPR  333 (968)
T ss_pred             hHhCCCCCCEEECcCCeeeccCchhHh-hccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCC
Confidence            999999999999999999888887765 4889999999999998888888888999999999999999888988999999


Q ss_pred             CCeEEccCCcCCCCCchhhhccccCCeeecCCCcccccCCccccCCCCCCEEECcCCcCcccCCCCCC-CCcccEEEeeC
Q 042603          451 LGGLYLSDNHLSGKIPRWLGSLLALQDIIMPNNNLEGPIPNEFCQLDCLKVLDLSNNSIFGTLPSCLS-LGSIEQVHLSK  529 (874)
Q Consensus       451 L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~-~~~L~~L~l~~  529 (874)
                      |+.|++++|.+.+.+|..++.+++|+.|++++|++.+.+|..++.+++|+.|++++|++.+.+|..+. +++|+.|++++
T Consensus       334 L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~  413 (968)
T PLN00113        334 LQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQD  413 (968)
T ss_pred             CCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcC
Confidence            99999999999999999999999999999999999999999999999999999999999988887654 88999999999


Q ss_pred             cccCccchhhhhcCCCCcEEEccCccCCCCCchhhcCCCCCcEEEccCccCcccCCccccCCCCCCEEEccCCcCCCCCC
Q 042603          530 NKIEGQLESIIHYYPYLVTLDLSYNRLHGSIPNWIDKLPQLSYILLANNYIEGEIPVQLCQLKEVRLIDLSHNNLSGHIP  609 (874)
Q Consensus       530 n~i~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p  609 (874)
                      |++++..|..+..+++|+.|++++|.+++.+|..+..+++|+.|++++|++.+.+|..+ ..++|+.||+++|++++.+|
T Consensus       414 n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~  492 (968)
T PLN00113        414 NSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVP  492 (968)
T ss_pred             CEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccC
Confidence            99999999999999999999999999999999999999999999999999998888765 46899999999999999888


Q ss_pred             chhhccccccccccCCCCCccccCCCCcccCCCCCCCCCccceEEEEecCcccccccccccCcceEEcCCCcccccCCcc
Q 042603          610 PCLVNTALSEGYYDAVAPTWDHASAPALSYFPPNGSPMGKEETVQFTTKNMSYYYRGRILTSMSGIDLSCNKLTGEIPTQ  689 (874)
Q Consensus       610 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~Ls~N~l~~~~p~~  689 (874)
                      ..+.++                                                      ++|+.|++++|.+++.+|..
T Consensus       493 ~~~~~l------------------------------------------------------~~L~~L~Ls~N~l~~~~p~~  518 (968)
T PLN00113        493 RKLGSL------------------------------------------------------SELMQLKLSENKLSGEIPDE  518 (968)
T ss_pred             hhhhhh------------------------------------------------------hccCEEECcCCcceeeCChH
Confidence            776553                                                      48899999999999999999


Q ss_pred             ccccccCCeEecCCcccccchhhhccCCCCCCEEECCCCcCcccCChhhhcCCCCCeEEccCCCCcccCCCccccCCCCC
Q 042603          690 IGYLTRIRALNLSHNNLTGTIPTTFSNLKQIESLDLSYNLLHGKIPPQLIVLNTLAVFRVAYNNLSGKIPDRVAQFSTFE  769 (874)
Q Consensus       690 ~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~LdLs~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~l~  769 (874)
                      ++.+++|++|+|++|.+++.+|..|+++++|+.|||++|++++.+|..+..+++|+.+++++|+++|.+|.. +++.++.
T Consensus       519 ~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~-~~~~~~~  597 (968)
T PLN00113        519 LSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPST-GAFLAIN  597 (968)
T ss_pred             HcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCc-chhcccC
Confidence            999999999999999999999999999999999999999999999999999999999999999999999985 7889999


Q ss_pred             cccccCCCCCCCCC
Q 042603          770 EDSYEGNPFLCGLP  783 (874)
Q Consensus       770 ~~~~~gNp~~C~~~  783 (874)
                      ..++.|||.+||.+
T Consensus       598 ~~~~~~n~~lc~~~  611 (968)
T PLN00113        598 ASAVAGNIDLCGGD  611 (968)
T ss_pred             hhhhcCCccccCCc
Confidence            99999999999854



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query874
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 9e-54
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-08
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-53
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-08
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-14
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-14
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 6e-07
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 4e-04
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 4e-05
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 6e-05
3cig_A 697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 7e-05
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 8e-05
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 2e-04
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 3e-04
4b8c_D727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 3e-04
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 3e-04
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 3e-04
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 7e-04
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 7e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 208 bits (530), Expect = 9e-54, Method: Compositional matrix adjust. Identities = 211/695 (30%), Positives = 307/695 (44%), Gaps = 96/695 (13%) Query: 151 GFCELVLLRELYIDNNDLRGSLPL--CLANLTSLRVLDVSYNQLTENISSSPLMHLTSIE 208 GF L L + N L G + L + + L+ L+VS N L S + L S+E Sbjct: 92 GFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLE 151 Query: 209 ELILSNNHFQIP-----ISLEPLFNLSKLKTFNGEIYAETESHYNSLTPKFQLTSISLSG 263 L LS N + + L L +I + + S + +S + Sbjct: 152 VLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDV---SRCVNLEFLDVSSNN 208 Query: 264 YGDGGTFPKFLYHQHDLNNADLSHLNLSGEFPNWLPENNTDLKTLLLANNSLFGSFRMPI 323 + G P FL L + D+S LSG+F + T+LK L +++N G +P Sbjct: 209 FSTG--IP-FLGDCSALQHLDISGNKLSGDFSRAI-STCTELKLLNISSNQFVGP--IPP 262 Query: 324 HCLQKLATLDVSNNFFLGHIPVEIGTYLPGLMHLNLSRNAFNGSIPSSFA---------- 373 L+ L L ++ N F G IP + L L+LS N F G++P F Sbjct: 263 LPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLAL 322 Query: 374 ---------------DMKMLKSLDISYNQLTGAIPERMAMGCFSLEILALSNNTLQGHIF 418 M+ LK LD+S+N+ +G +PE + SL L LS+N G I Sbjct: 323 SSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPIL 382 Query: 419 SE--KFNLTNLKRLQLDGNKFIGEIPESLSKCYLLGGLYLSDNHLSGKIPRWLGSLLALQ 476 + L+ L L N F G+IP +LS C L L+LS N+LSG IP LGSL L+ Sbjct: 383 PNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLR 442 Query: 477 DIIMPNNNLEGPIPNEFCQLDCLKVLDLSNNSIFGTLPSCLSLGSIEQVHLSKNKIEGQL 536 D+ + N LEG IP E + L+ L L N + G +PS LS Sbjct: 443 DLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLS------------------ 484 Query: 537 ESIIHYYPYLVTLDLSYNRLHGSIPNWIDKLPQLSYILLANNYIEGEIPVQLCQLKEVRL 596 L + LS NRL G IP WI +L L+ + L+NN G IP +L + + Sbjct: 485 -----NCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIW 539 Query: 597 IDLSHNNLSGHIPPCL--------VNTALSEGYY----DAVAPTWDHASAPALSYFPPNG 644 +DL+ N +G IP + N + Y D + H + L + Sbjct: 540 LDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKEC-HGAGNLLEF----- 593 Query: 645 SPMGKEETVQFTTKN----MSYYYRGRIL------TSMSGIDLSCNKLTGEIPTQIGYLT 694 + E+ + +T+N S Y G SM +D+S N L+G IP +IG + Sbjct: 594 QGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMP 653 Query: 695 RIRALNLSHNNLTGTIPTTFSNLKQIESLDLSYNLLHGKIPPQLIVLNTLAVFRVAYNNL 754 + LNL HN+++G+IP +L+ + LDLS N L G+IP + L L ++ NNL Sbjct: 654 YLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNL 713 Query: 755 SGKIPDRVAQFSTFEEDSYEGNPFLCGLPLSKSCD 789 SG IP+ + QF TF + NP LCG PL + CD Sbjct: 714 SGPIPE-MGQFETFPPAKFLNNPGLCGYPLPR-CD 746
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query874
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-177
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-87
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-77
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-74
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-63
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-55
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-51
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-73
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-70
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-50
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-48
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-41
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-34
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-68
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-68
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-64
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-59
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-41
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-68
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-66
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-58
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-36
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-28
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-66
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-55
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-55
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-43
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-40
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-36
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-31
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-60
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-57
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-53
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-45
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-42
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-60
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-56
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-54
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-54
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-44
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-25
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-24
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-18
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-51
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-44
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-33
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-27
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-07
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-44
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-44
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-41
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-33
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-26
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-43
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-41
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-37
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-36
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-24
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-40
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-38
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-35
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-34
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-29
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-19
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-35
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-31
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-31
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-29
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-29
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-35
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-34
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-32
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-21
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-06
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-33
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-22
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-31
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-31
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-32
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-31
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-21
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-32
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-17
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-31
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-30
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-29
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-28
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-19
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-30
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-28
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-26
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-28
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-26
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-25
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-25
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-22
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-26
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-24
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-26
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-12
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-10
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-24
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 8e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-23
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-06
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-21
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-16
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-12
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-21
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-21
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-17
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-17
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-07
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-11
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-11
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 6e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 7e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 5e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  530 bits (1368), Expect = e-177
 Identities = 202/721 (28%), Positives = 314/721 (43%), Gaps = 47/721 (6%)

Query: 105 CELVHLQELYIRDNDLRD---SLLWCLANMTSLQVLNVASNQLTGNFPPGFCELVLLREL 161
           C    +  + +    L     ++   L ++T L+ L ++++ + G+    F     L  L
Sbjct: 47  CRDDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVSG-FKCSASLTSL 105

Query: 162 YIDNNDLRGSLP--LCLANLTSLRVLDVSYNQLTENISSSPLMHLTSIEELILSNNHF-- 217
            +  N L G +     L + + L+ L+VS N L      S  + L S+E L LS N    
Sbjct: 106 DLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISG 165

Query: 218 QIPISLEPLFNLSKLKTFNGEIYAETESHYNSLTPKF------QLTSISLSGYGDGGTFP 271
              +         +LK              N ++          L  + +S        P
Sbjct: 166 ANVVGWVLSDGCGELKHLA--------ISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIP 217

Query: 272 KFLYHQHDLNNADLSHLNLSGEFPNWLPENNTDLKTLLLANNSLFGSFRMPIHCLQKLAT 331
            FL     L + D+S   LSG+F   +    T+LK L +++N   G    P   L+ L  
Sbjct: 218 -FLGDCSALQHLDISGNKLSGDFSRAIS-TCTELKLLNISSNQFVGPI--PPLPLKSLQY 273

Query: 332 LDVSNNFFLGHIPVEIGTYLPGLMHLNLSRNAFNGSIPSSFADMKMLKSLDISYNQLTGA 391
           L ++ N F G IP  +      L  L+LS N F G++P  F    +L+SL +S N  +G 
Sbjct: 274 LSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGE 333

Query: 392 IPERMAMGCFSLEILALSNNTLQGHIFSEKFNLT-NLKRLQLDGNKFIGEIPESLSKCYL 450
           +P    +    L++L LS N   G +     NL+ +L  L L  N F G I  +L +   
Sbjct: 334 LPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPK 393

Query: 451 --LGGLYLSDNHLSGKIPRWLGSLLALQDIIMPNNNLEGPIPNEFCQLDCLKVLDLSNNS 508
             L  LYL +N  +GKIP  L +   L  + +  N L G IP+    L  L+ L L  N 
Sbjct: 394 NTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNM 453

Query: 509 IFGTLPSCLS-LGSIEQVHLSKNKIEGQLESIIHYYPYLVTLDLSYNRLHGSIPNWIDKL 567
           + G +P  L  + ++E + L  N + G++ S +     L  + LS NRL G IP WI +L
Sbjct: 454 LEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRL 513

Query: 568 PQLSYILLANNYIEGEIPVQLCQLKEVRLIDLSHNNLSGHIPPCLVNTAL------SEGY 621
             L+ + L+NN   G IP +L   + +  +DL+ N  +G IP  +   +         G 
Sbjct: 514 ENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGK 573

Query: 622 YDAVAPTWDHASAPALSYFPPNGSPMGKEETVQFTTKNM----SYYYRGRI------LTS 671
                           +        +  E+  + +T+N     S  Y G          S
Sbjct: 574 RYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGS 633

Query: 672 MSGIDLSCNKLTGEIPTQIGYLTRIRALNLSHNNLTGTIPTTFSNLKQIESLDLSYNLLH 731
           M  +D+S N L+G IP +IG +  +  LNL HN+++G+IP    +L+ +  LDLS N L 
Sbjct: 634 MMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLD 693

Query: 732 GKIPPQLIVLNTLAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPFLCGLPLSKSCDDN 791
           G+IP  +  L  L    ++ NNLSG IP+   QF TF    +  NP LCG PL +    N
Sbjct: 694 GRIPQAMSALTMLTEIDLSNNNLSGPIPEM-GQFETFPPAKFLNNPGLCGYPLPRCDPSN 752

Query: 792 G 792
            
Sbjct: 753 A 753


>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query874
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.71
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.66
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.66
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.65
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.65
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.63
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.57
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.56
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.54
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.54
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.53
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.5
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.49
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.44
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.44
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.43
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.41
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.41
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.38
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.33
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.27
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.27
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.25
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.22
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.09
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.76
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.74
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.54
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.46
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.34
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.33
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.94
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.66
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.6
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.41
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.36
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.24
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2.1e-79  Score=732.82  Aligned_cols=672  Identities=29%  Similarity=0.425  Sum_probs=490.2

Q ss_pred             CCCEEecCCCCCCCCc---hhhhccCCCCCCEEEccCCcccccccCccccCCCCCcEEECCCcccc--ccc--hhHHHHH
Q 042603            6 NLEELILVESDLHVSQ---LLQSIASFSSLKYLSMRGCVLKGALHGQDFHEFKNLEHLVMDRMLVE--VDT--SFLQIVS   78 (874)
Q Consensus         6 ~L~~L~Ls~~~~~~~~---~~~~l~~l~~L~~L~Ls~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~--~~~--~~~~~~~   78 (874)
                      +++.|+|+++.+ .+.   ++..+..+++|+.++++.+.+.. ++ ..+.++++|++|++++|.+.  ++.  .     +
T Consensus        51 ~v~~L~L~~~~l-~g~~~~l~~~l~~L~~L~~l~~~~~~~~~-l~-~~~~~l~~L~~L~Ls~n~l~~~~~~~~~-----l  122 (768)
T 3rgz_A           51 KVTSIDLSSKPL-NVGFSAVSSSLLSLTGLESLFLSNSHING-SV-SGFKCSASLTSLDLSRNSLSGPVTTLTS-----L  122 (768)
T ss_dssp             EEEEEECTTSCC-CEEHHHHHHHTTTCTTCCEEECTTSCEEE-CC-CCCCCCTTCCEEECCSSEEEEEGGGGGG-----G
T ss_pred             cEEEEECCCCCc-CCccCccChhHhccCcccccCCcCCCcCC-Cc-hhhccCCCCCEEECCCCcCCCcCCChHH-----H
Confidence            466677777766 444   66667777777777777665532 22 35667777777777777665  333  3     5


Q ss_pred             hcCCCCCEEEccccCCCCCccccccccCCCCCcEEEcCCCCCCCcchhc---ccCCCCCCEEEccCCcCCCCCcccccCC
Q 042603           79 ESMASLRILSLSYSRLNKNTILDQGLCELVHLQELYIRDNDLRDSLLWC---LANMTSLQVLNVASNQLTGNFPPGFCEL  155 (874)
Q Consensus        79 ~~l~~L~~L~Ls~n~~~~~~~~~~~l~~l~~L~~L~L~~n~i~~~~~~~---~~~l~~L~~L~Ls~n~i~~~~~~~~~~l  155 (874)
                      +++++|++|++++|.+....+ ...+.++++|++|++++|++++..+..   +.++++|++|++++|.+.+..|  +..+
T Consensus       123 ~~l~~L~~L~Ls~n~l~~~~~-~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~--~~~l  199 (768)
T 3rgz_A          123 GSCSGLKFLNVSSNTLDFPGK-VSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD--VSRC  199 (768)
T ss_dssp             GGCTTCCEEECCSSEEECCSS-CCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCB--CTTC
T ss_pred             hCCCCCCEEECcCCccCCcCC-HHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCC--cccC
Confidence            667777777777776654221 122356677777777777776666655   5667777777777777665544  2566


Q ss_pred             CCCCEEEccCCcCCCCccccccCCCCCCEEEcccccccccCCccccCCCCCCCEEEccccccccccCcccccCCCCCcee
Q 042603          156 VLLRELYIDNNDLRGSLPLCLANLTSLRVLDVSYNQLTENISSSPLMHLTSIEELILSNNHFQIPISLEPLFNLSKLKTF  235 (874)
Q Consensus       156 ~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~~l~~l~~L~~l  235 (874)
                      ++|++|++++|.+.+.+|. ++++++|++|++++|.+++.++. .+.++++|++|++++|.+.+.               
T Consensus       200 ~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~-~l~~l~~L~~L~Ls~n~l~~~---------------  262 (768)
T 3rgz_A          200 VNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSR-AISTCTELKLLNISSNQFVGP---------------  262 (768)
T ss_dssp             TTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHH-HTTTCSSCCEEECCSSCCEES---------------
T ss_pred             CcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccH-HHhcCCCCCEEECCCCcccCc---------------
Confidence            7777777777777665555 66777777777777777665454 566677777777766655432               


Q ss_pred             ccccccccccccCCCCCCceeeEEEccCCCCCCCCChhccCCCCCCEEEcCCCCCcccCCcchhcCCCCCCEEEccCCcc
Q 042603          236 NGEIYAETESHYNSLTPKFQLTSISLSGYGDGGTFPKFLYHQHDLNNADLSHLNLSGEFPNWLPENNTDLKTLLLANNSL  315 (874)
Q Consensus       236 ~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~n~l~~~~p~~l~~~l~~L~~L~L~~n~l  315 (874)
                                                        +|..  .+++|++|++++|.+.+.+|..++..+++|++|++++|.+
T Consensus       263 ----------------------------------~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l  306 (768)
T 3rgz_A          263 ----------------------------------IPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHF  306 (768)
T ss_dssp             ----------------------------------CCCC--CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEE
T ss_pred             ----------------------------------cCcc--ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcC
Confidence                                              2222  4567777778888777777777655567888888888888


Q ss_pred             cccccCCccCCCcccEEEccCCcCCccCChhhhcCCCCCcEEEccCCcCCcccchhccCCC-CcCEEEcccCcCCCCchh
Q 042603          316 FGSFRMPIHCLQKLATLDVSNNFFLGHIPVEIGTYLPGLMHLNLSRNAFNGSIPSSFADMK-MLKSLDISYNQLTGAIPE  394 (874)
Q Consensus       316 ~~~~~~~~~~l~~L~~L~Ls~n~l~~~i~~~~~~~l~~L~~L~l~~n~i~~~~~~~~~~l~-~L~~L~l~~n~i~~~~~~  394 (874)
                      .+..|..+..+++|++|++++|.+.+.+|...+..+++|++|++++|.+++.+|..+.+++ +|++|++++|++++.+|.
T Consensus       307 ~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~  386 (768)
T 3rgz_A          307 YGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILP  386 (768)
T ss_dssp             EECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCT
T ss_pred             CCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcCh
Confidence            7777777888888888888888887777777555577888888888888777777777776 788888888887776666


Q ss_pred             HHHh-cCCCCCEEEcccCcccccCCccccCCCCCCeEEccCCcCcccCCccccccCCCCeEEccCCcCCCCCchhhhccc
Q 042603          395 RMAM-GCFSLEILALSNNTLQGHIFSEKFNLTNLKRLQLDGNKFIGEIPESLSKCYLLGGLYLSDNHLSGKIPRWLGSLL  473 (874)
Q Consensus       395 ~~~~-~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~  473 (874)
                      .+.. .+++|++|++++|.+++.+|..+..+++|++|++++|++++..|..+..+++|++|++++|.+.+.+|..+..++
T Consensus       387 ~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~  466 (768)
T 3rgz_A          387 NLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK  466 (768)
T ss_dssp             TTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCT
T ss_pred             hhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCC
Confidence            5542 256778888888887777777777778888888888887777777777777888888888887777777777777


Q ss_pred             cCCeeecCCCcccccCCccccCCCCCCEEECcCCcCcccCCCCCC-CCcccEEEeeCcccCccchhhhhcCCCCcEEEcc
Q 042603          474 ALQDIIMPNNNLEGPIPNEFCQLDCLKVLDLSNNSIFGTLPSCLS-LGSIEQVHLSKNKIEGQLESIIHYYPYLVTLDLS  552 (874)
Q Consensus       474 ~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~-~~~L~~L~l~~n~i~~~~~~~~~~l~~L~~L~Ls  552 (874)
                      +|++|++++|++.+.+|..+..+++|++|++++|++++.+|..+. +++|++|++++|++++..|..+..+++|++|+++
T Consensus       467 ~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls  546 (768)
T 3rgz_A          467 TLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLN  546 (768)
T ss_dssp             TCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECC
T ss_pred             CceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECC
Confidence            888888888887777777777777788888888877777776654 7777777777777777777777777777777777


Q ss_pred             CccCCCCCchhhcCCCCCcEEEccCc----------------------cCcccCCccccCCCCCCEEEccCCcCCCCCCc
Q 042603          553 YNRLHGSIPNWIDKLPQLSYILLANN----------------------YIEGEIPVQLCQLKEVRLIDLSHNNLSGHIPP  610 (874)
Q Consensus       553 ~n~l~~~~~~~~~~l~~L~~L~l~~n----------------------~~~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~  610 (874)
                      +|++++.+|.++.....+..+.+..+                      .+.+..+..+..++.++.++++.|.++|.+|.
T Consensus       547 ~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~  626 (768)
T 3rgz_A          547 TNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSP  626 (768)
T ss_dssp             SSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCC
T ss_pred             CCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCch
Confidence            77777777777666555444333221                      12223333334444444445555555554444


Q ss_pred             hhhccccccccccCCCCCccccCCCCcccCCCCCCCCCccceEEEEecCcccccccccccCcceEEcCCCcccccCCccc
Q 042603          611 CLVNTALSEGYYDAVAPTWDHASAPALSYFPPNGSPMGKEETVQFTTKNMSYYYRGRILTSMSGIDLSCNKLTGEIPTQI  690 (874)
Q Consensus       611 ~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~Ls~N~l~~~~p~~~  690 (874)
                      .+..                                                      +++|+.|||++|+++|.+|..+
T Consensus       627 ~~~~------------------------------------------------------l~~L~~LdLs~N~l~g~ip~~l  652 (768)
T 3rgz_A          627 TFDN------------------------------------------------------NGSMMFLDMSYNMLSGYIPKEI  652 (768)
T ss_dssp             SCSS------------------------------------------------------SBCCCEEECCSSCCBSCCCGGG
T ss_pred             hhhc------------------------------------------------------cccccEEECcCCcccccCCHHH
Confidence            3322                                                      4589999999999999999999


Q ss_pred             cccccCCeEecCCcccccchhhhccCCCCCCEEECCCCcCcccCChhhhcCCCCCeEEccCCCCcccCCCccccCCCCCc
Q 042603          691 GYLTRIRALNLSHNNLTGTIPTTFSNLKQIESLDLSYNLLHGKIPPQLIVLNTLAVFRVAYNNLSGKIPDRVAQFSTFEE  770 (874)
Q Consensus       691 ~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~LdLs~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~l~~  770 (874)
                      +.+++|+.|+|++|+++|.+|+.|+++++|++||||+|+++|.+|+.++.+++|++|++++|+++|.+|.. +++.++..
T Consensus       653 ~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~-~~~~~~~~  731 (768)
T 3rgz_A          653 GSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEM-GQFETFPP  731 (768)
T ss_dssp             GGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSS-SSGGGSCG
T ss_pred             hccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCc-hhhccCCH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999995 89999999


Q ss_pred             ccccCCCCCCCCCCCCCCCCCCCCccc
Q 042603          771 DSYEGNPFLCGLPLSKSCDDNGLTTVT  797 (874)
Q Consensus       771 ~~~~gNp~~C~~~l~~~c~~~~~~~~~  797 (874)
                      .+|.|||++||.|+. .|.......|.
T Consensus       732 ~~~~gN~~Lcg~~l~-~C~~~~~~~~~  757 (768)
T 3rgz_A          732 AKFLNNPGLCGYPLP-RCDPSNADGYA  757 (768)
T ss_dssp             GGGCSCTEEESTTSC-CCCSCC-----
T ss_pred             HHhcCCchhcCCCCc-CCCCCccCCCC
Confidence            999999999999987 89866655543



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 874
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-21
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-19
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-18
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-11
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 7e-07
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 6e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 6e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.003
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 3e-04
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 95.5 bits (236), Expect = 1e-21
 Identities = 76/388 (19%), Positives = 127/388 (32%), Gaps = 29/388 (7%)

Query: 152 FCELVLLRELYIDNNDLRGSLPLCLANLTSLRVLDVSYNQLTENISSSPLMHLTSIEELI 211
           F +  L  ++         +  +   +L  +  L      +    S   + +L ++ ++ 
Sbjct: 16  FTDTALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIK---SIDGVEYLNNLTQIN 72

Query: 212 LSNNHFQIPISLEPLFNLSKLKTFNGEIYAETESHYNSLTPKFQLTSISLSGYGDGGTFP 271
            SNN       L+ L  L  +   N +I   T     +      L +  ++         
Sbjct: 73  FSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLT 132

Query: 272 KFLYHQHDLNNADLSHLNLSGEFPNWLPENNTDLKTLLLANNSLFGSFRMPIHC------ 325
                +   N                L   N       LAN +      +  +       
Sbjct: 133 NLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISV 192

Query: 326 ---LQKLATLDVSNNFFLGHIPVEIGTYLPGLMHLNLSRNAFNGSIPSSFADMKMLKSLD 382
              L  L +L  +NN      P+ I T L     L+L+ N        + A +  L  LD
Sbjct: 193 LAKLTNLESLIATNNQISDITPLGILTNL---DELSLNGNQLKD--IGTLASLTNLTDLD 247

Query: 383 ISYNQLTGAIPERMAMGCFSLEILALSNNTLQGHIFSEKFNLTNLKRLQLDGNKFIGEIP 442
           ++ NQ++   P     G   L  L L  N +     S    LT L  L+L+ N+     P
Sbjct: 248 LANNQISNLAPL---SGLTKLTELKLGANQISN--ISPLAGLTALTNLELNENQLEDISP 302

Query: 443 ESLSKCYLLGGLYLSDNHLSGKIPRWLGSLLALQDIIMPNNNLEGPIPNEFCQLDCLKVL 502
            S      L  L L  N++S   P  + SL  LQ +   NN +     +    L  +  L
Sbjct: 303 IS--NLKNLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSDV--SSLANLTNINWL 356

Query: 503 DLSNNSIFGTLPSCLSLGSIEQVHLSKN 530
              +N I    P   +L  I Q+ L+  
Sbjct: 357 SAGHNQISDLTPLA-NLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query874
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.8
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.55
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.46
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.43
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.41
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.4
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.4
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.36
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.29
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.18
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.18
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.38
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.14
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.91
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.9
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.47
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.42
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.97  E-value=1.5e-31  Score=281.65  Aligned_cols=256  Identities=30%  Similarity=0.562  Sum_probs=207.7

Q ss_pred             CCeeecCCCcccc--cCCccccCCCCCCEEECcC-CcCcccCCCCCC-CCcccEEEeeCcccCccchhhhhcCCCCcEEE
Q 042603          475 LQDIIMPNNNLEG--PIPNEFCQLDCLKVLDLSN-NSIFGTLPSCLS-LGSIEQVHLSKNKIEGQLESIIHYYPYLVTLD  550 (874)
Q Consensus       475 L~~L~l~~n~l~~--~~~~~~~~l~~L~~L~L~~-n~l~~~~~~~~~-~~~L~~L~l~~n~i~~~~~~~~~~l~~L~~L~  550 (874)
                      ++.|++++|.+.+  .+|..++++++|++|+|++ |++.|.+|..+. +++|++|++++|++.+..+..+..++.|+.++
T Consensus        52 v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~  131 (313)
T d1ogqa_          52 VNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLD  131 (313)
T ss_dssp             EEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEE
T ss_pred             EEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccc
Confidence            3334444444433  2445555555555555553 455555554333 56666666666667777777788888899999


Q ss_pred             ccCccCCCCCchhhcCCCCCcEEEccCccCcccCCccccCCCCC-CEEEccCCcCCCCCCchhhccccccccccCCCCCc
Q 042603          551 LSYNRLHGSIPNWIDKLPQLSYILLANNYIEGEIPVQLCQLKEV-RLIDLSHNNLSGHIPPCLVNTALSEGYYDAVAPTW  629 (874)
Q Consensus       551 Ls~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L-~~L~Ls~N~l~~~~p~~l~~~~~~~~~~~~~~~~~  629 (874)
                      +++|.+.+.+|..+++++.++.+++++|.+.+.+|..+..+..+ +.+++++|++++..|..+...              
T Consensus       132 l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l--------------  197 (313)
T d1ogqa_         132 FSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANL--------------  197 (313)
T ss_dssp             CCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGC--------------
T ss_pred             cccccccccCchhhccCcccceeecccccccccccccccccccccccccccccccccccccccccc--------------
Confidence            99999988889999999999999999999998999888888776 889999999998877765543              


Q ss_pred             cccCCCCcccCCCCCCCCCccceEEEEecCcccccccccccCcceEEcCCCcccccCCccccccccCCeEecCCcccccc
Q 042603          630 DHASAPALSYFPPNGSPMGKEETVQFTTKNMSYYYRGRILTSMSGIDLSCNKLTGEIPTQIGYLTRIRALNLSHNNLTGT  709 (874)
Q Consensus       630 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~  709 (874)
                                                               ....++++++...+.+|..++.+++++.+++++|.+++.
T Consensus       198 -----------------------------------------~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~  236 (313)
T d1ogqa_         198 -----------------------------------------NLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFD  236 (313)
T ss_dssp             -----------------------------------------CCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCB
T ss_pred             -----------------------------------------ccccccccccccccccccccccccccccccccccccccc
Confidence                                                     334689999999999999999999999999999999987


Q ss_pred             hhhhccCCCCCCEEECCCCcCcccCChhhhcCCCCCeEEccCCCCcccCCCccccCCCCCcccccCCCCCCCCCCCCCC
Q 042603          710 IPTTFSNLKQIESLDLSYNLLHGKIPPQLIVLNTLAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPFLCGLPLSKSC  788 (874)
Q Consensus       710 ~p~~~~~l~~L~~LdLs~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~l~~~~~~gNp~~C~~~l~~~c  788 (874)
                      +| .++.+++|+.|||++|+++|.+|+.++++++|++|++++|+|+|.+|+ ++++++++.+++.||+.+||.|++ .|
T Consensus       237 ~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~~l~g~plp-~c  312 (313)
T d1ogqa_         237 LG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNKCLCGSPLP-AC  312 (313)
T ss_dssp             GG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSSEEESTTSS-CC
T ss_pred             cc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCccccCCCCC-CC
Confidence            66 688999999999999999999999999999999999999999999997 588999999999999999999986 66



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure