Citrus Sinensis ID: 042610

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-
ICELKNLFELNFGGNKFEGHLPQCLNNLTHLKVLDVSSNKLSGILPSVIANLTSLEYLALYDNRFKGRLFSFYSLANLSKFEAFQLSMETDLLQVEIENCLPTFQLKVLSLPNCNLGAIPNFLLLQFNLKYLDLSHNKLAGNFPTWLLENNTKLELLYLVNNSFSGFQLTSAQHGLLSLDISSNSFTGELPQNMDIVLPKLVYMNVSKNSFEGNIPSSIGKMQGLLATYMNMTQLWALYLHNDNFSRKIKDGLLRSTELEDLDISNNILSGHIPSWMGNFSHLHTLSMSNNHLEGNIPVQCQNLAGLYIPDISENNLSGSMISTLNLSSVACLYLQNNALGDRFVKLNTSY
ccccccccEEEccccccEEcccHHHHccccccEEEcccccccccccHHccccccccEEEccccccEEEccccccccccccccEEEEEccccEEEEEcccccccccccEEccccccccccHHHHHccccccEEEcccccccccccHHHHHccccccEEEccccEEEEEccccccccccEEEcccccccccccHHHHHccccccEEEcccccccccccHHHHHcccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHcccccccEEcccccccccccHHcccccccccEEccccccccccccccccccccEEEccccccccccccccccc
cccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEEcccccccccccccHHcccccccEEEcccccccccccHHHcccccHHEEEEccccccccccHHHccccccEEEEcccccccccccHHHHHccccccEEEEcccccccccccccccccEEEEEccccccccccHHHHHHcccccEEEEccccccccccHHHccccccHHHHcccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHcccccccEEEccccccccccccccccc
icelknlfelnfggnkfeghlpqclnnlthlkvldvssnklsgiLPSVIANLTSLEYLALYDNRFKGRLFSFYSLANLSKFEAFQLSMETDLLQVEIENCLPTFQLKvlslpncnlgaipnFLLLQFNLKYLdlshnklagnfptwllenntkLELLYLVNNSFSGFQLTSAQHGLlsldissnsftgelpqnmdivLPKLVYMNVsknsfegnipssIGKMQGLLATYMNMTQLWALYLHndnfsrkikdgllrsteledldisnnilsghipswmgnfsHLHTLSMsnnhlegnipvqcqnlaglyipdisennlsgsmisTLNLSSVACLYLQNNALGDRFVKLNTSY
ICELKNLFELNFGGNKFEGHLPQCLNNLTHLKVLDVSSNKLSGILPSVIANLTSLEYLALYDNRFKGRLFSFYSLANLSKFEAFQLSMETDLLQVEIENCLPTFQLKVLSLPNCNLGAIPNFLLLQFNLKYLDLSHNKLAGNFPTWLLENNTKLELLYLVNNSFSGFQLTSAQHGLLSLDISSNSFTGELPQNMDIVLPKLVYMNVSKNSFEGNIPSSIGKMQGLLATYMNMTQLWALYLHNDNFSRKIKDGLLRSTELEDLDISNNILSGHIPSWMGNFSHLHTLSMSNNHLEGNIPVQCQNLAGLYIPDISENNLSGSMISTLNLSSVACLYLQnnalgdrfVKLNTSY
ICELKNLFELNFGGNKFEGHLPQCLNNLTHLKVLDVSSNKLSGILPSVIANLTSLEYLALYDNRFKGRLFSFYSLANLSKFEAFQLSMETDLLQVEIENCLPTFQLKVLSLPNCNLGAIPNFLLLQFNLKYLDLSHNKLAGNFPTWLLENNTKLELLYLVNNSFSGFQLTSAQHGLLSLDISSNSFTGELPQNMDIVLPKLVYMNVSKNSFEGNIPSSIGKMQGLLATYMNMTQLWALYLHNDNFSRKIKDGLLRSTELEDLDISNNILSGHIPSWMGNFSHLHTLSMSNNHLEGNIPVQCQNLAGLYIPDISENNLSGSMISTLNLSSVACLYLQNNALGDRFVKLNTSY
***LKNLFELNFGGNKFEGHLPQCLNNLTHLKVLDVSSNKLSGILPSVIANLTSLEYLALYDNRFKGRLFSFYSLANLSKFEAFQLSMETDLLQVEIENCLPTFQLKVLSLPNCNLGAIPNFLLLQFNLKYLDLSHNKLAGNFPTWLLENNTKLELLYLVNNSFSGFQLTSAQHGLLSLDISSNSFTGELPQNMDIVLPKLVYMNVSKNSFEGNIPSSIGKMQGLLATYMNMTQLWALYLHNDNFSRKIKDGLLRSTELEDLDISNNILSGHIPSWMGNFSHLHTLSMSNNHLEGNIPVQCQNLAGLYIPDISENNLSGSMISTLNLSSVACLYLQNNALGDRFVK*****
ICELKNLFELNFGGNKFEGHLPQCLNNLTHLKVLDVSSNKLSGILPSVIANLTSLEYLALYDNRFKGRLFSFYSLANLSKFEAFQLSMETDLLQVEIENCLPTFQLKVLSLPNCNLGAIPNFLLLQFNLKYLDLSHNKLAGNFPTWLLENNTKLELLYLVNNSFSGFQLTSAQHGLLSLDISSNSFTGELPQNMDIVLPKLVYMNVSKNSFEGNIPSSIGKMQGLLATYMNMTQLWALYLHNDNFSRKIKDGLLRSTELEDLDISNNILSGHIPSWMGNFSHLHTLSMSNNHLEGNIPVQCQNLAGLYIPDISENNLSGSMISTLNLSSVACLYLQNNALGDRFVKLNTS*
ICELKNLFELNFGGNKFEGHLPQCLNNLTHLKVLDVSSNKLSGILPSVIANLTSLEYLALYDNRFKGRLFSFYSLANLSKFEAFQLSMETDLLQVEIENCLPTFQLKVLSLPNCNLGAIPNFLLLQFNLKYLDLSHNKLAGNFPTWLLENNTKLELLYLVNNSFSGFQLTSAQHGLLSLDISSNSFTGELPQNMDIVLPKLVYMNVSKNSFEGNIPSSIGKMQGLLATYMNMTQLWALYLHNDNFSRKIKDGLLRSTELEDLDISNNILSGHIPSWMGNFSHLHTLSMSNNHLEGNIPVQCQNLAGLYIPDISENNLSGSMISTLNLSSVACLYLQNNALGDRFVKLNTSY
*CELKNLFELNFGGNKFEGHLPQCLNNLTHLKVLDVSSNKLSGILPSVIANLTSLEYLALYDNRFKGRLFSFYSLANLSKFEAFQLSMETDLLQVEIENCLPTFQLKVLSLPNCNLGAIPNFLLLQFNLKYLDLSHNKLAGNFPTWLLENNTKLELLYLVNNSFSGFQLTSAQHGLLSLDISSNSFTGELPQNMDIVLPKLVYMNVSKNSFEGNIPSSIGKMQGLLATYMNMTQLWALYLHNDNFSRKIKDGLLRSTELEDLDISNNILSGHIPSWMGNFSHLHTLSMSNNHLEGNIPVQCQNLAGLYIPDISENNLSGSMISTLNLSSVACLYLQNNALGDRFVKLNT**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ICELKNLFELNFGGNKFEGHLPQCLNNLTHLKVLDVSSNKLSGILPSVIANLTSLEYLALYDNRFKGRLFSFYSLANLSKFEAFQLSMETDLLQVEIENCLPTFQLKVLSLPNCNLGAIPNFLLLQFNLKYLDLSHNKLAGNFPTWLLENNTKLELLYLVNNSFSGFQLTSAQHGLLSLDISSNSFTGELPQNMDIVLPKLVYMNVSKNSFEGNIPSSIGKMQGLLATYMNMTQLWALYLHNDNFSRKIKDGLLRSTELEDLDISNNILSGHIPSWMGNFSHLHTLSMSNNHLEGNIPVQCQNLAGLYIPDISENNLSGSMISTLNLSSVACLYLQNNALGDRFVKLNTSY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query351 2.2.26 [Sep-21-2011]
Q9LHP4 1141 Receptor-like protein kin no no 0.977 0.300 0.316 7e-27
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.948 0.265 0.3 2e-26
Q42371 976 LRR receptor-like serine/ no no 0.957 0.344 0.310 4e-26
C0LGX3 993 LRR receptor-like serine/ no no 0.874 0.309 0.318 4e-25
O22476 1196 Protein BRASSINOSTEROID I no no 0.880 0.258 0.305 1e-24
C0LGS2 1136 Probable LRR receptor-lik no no 0.860 0.265 0.301 1e-24
Q9M0G7 1013 Leucine-rich repeat recep no no 0.920 0.318 0.287 2e-24
Q9SGP2 996 Receptor-like protein kin no no 0.868 0.306 0.300 2e-24
Q9C9H7 847 Receptor-like protein 12 no no 0.874 0.362 0.335 3e-24
Q9LYN8 1192 Leucine-rich repeat recep no no 0.888 0.261 0.321 5e-24
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function desciption
 Score =  121 bits (304), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 121/382 (31%), Positives = 189/382 (49%), Gaps = 39/382 (10%)

Query: 1   ICELKNLFELNFGGNKFEGHLPQCLNNLTHLKVLDVSSNKLSGILPSVIANLTSLEYLAL 60
           I +L  L +L    N   G +P+ + N ++LK++D+S N LSG +PS I  L+ LE   +
Sbjct: 294 IGQLTKLEQLFLWQNSLVGGIPEEIGNCSNLKMIDLSLNLLSGSIPSSIGRLSFLEEFMI 353

Query: 61  YDNRFKGRLFSFYSLANLSKFEAFQLSMETDLLQVEIENCLPTFQLKVLSLPNCNL--GA 118
            DN+F G + +  +++N S     QL ++ + +   I + L T     L     N   G+
Sbjct: 354 SDNKFSGSIPT--TISNCSSL--VQLQLDKNQISGLIPSELGTLTKLTLFFAWSNQLEGS 409

Query: 119 IPNFLLLQFNLKYLDLSHNKLAGNFPT--WLLENNTKLELLYLVNNSFSGF--QLTSAQH 174
           IP  L    +L+ LDLS N L G  P+  ++L N TKL    L++NS SGF  Q      
Sbjct: 410 IPPGLADCTDLQALDLSRNSLTGTIPSGLFMLRNLTKL---LLISNSLSGFIPQEIGNCS 466

Query: 175 GLLSLDISSNSFTGELPQNMDIVLPKLVYMNVSKNSFEGNIPSSIGK------------- 221
            L+ L +  N  TGE+P  +   L K+ +++ S N   G +P  IG              
Sbjct: 467 SLVRLRLGFNRITGEIPSGIG-SLKKINFLDFSSNRLHGKVPDEIGSCSELQMIDLSNNS 525

Query: 222 MQGLLATYMN-MTQLWALYLHNDNFSRKIKDGLLRSTELEDLDISNNILSGHIPSWMGNF 280
           ++G L   ++ ++ L  L +  + FS KI   L R   L  L +S N+ SG IP+ +G  
Sbjct: 526 LEGSLPNPVSSLSGLQVLDVSANQFSGKIPASLGRLVSLNKLILSKNLFSGSIPTSLGMC 585

Query: 281 SHLHTLSMSNNHLEGNIPVQCQNLAGLYIP-DISENNLSGSMISTL-NLSSVACLYLQNN 338
           S L  L + +N L G IP +  ++  L I  ++S N L+G + S + +L+ ++ L L +N
Sbjct: 586 SGLQLLDLGSNELSGEIPSELGDIENLEIALNLSSNRLTGKIPSKIASLNKLSILDLSHN 645

Query: 339 AL-GD--------RFVKLNTSY 351
            L GD          V LN SY
Sbjct: 646 MLEGDLAPLANIENLVSLNISY 667

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description
>sp|C0LGX3|HSL2_ARATH LRR receptor-like serine/threonine-protein kinase HSL2 OS=Arabidopsis thaliana GN=HSL2 PE=2 SV=1 Back     alignment and function description
>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9M0G7|PXL2_ARATH Leucine-rich repeat receptor-like protein kinase PXL2 OS=Arabidopsis thaliana GN=PXL2 PE=2 SV=1 Back     alignment and function description
>sp|Q9SGP2|HSL1_ARATH Receptor-like protein kinase HSL1 OS=Arabidopsis thaliana GN=HSL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query351
358345471 933 Receptor kinase [Medicago truncatula] gi 0.965 0.363 0.479 4e-78
255553269 2793 receptor-kinase, putative [Ricinus commu 0.965 0.121 0.469 2e-73
297842171 966 leucine-rich repeat family protein [Arab 0.965 0.350 0.418 1e-68
15221162 965 receptor like protein 15 [Arabidopsis th 0.960 0.349 0.418 8e-68
12324907 910 putative disease resistance protein; 468 0.960 0.370 0.418 1e-67
186495296 1000 receptor like protein 13 [Arabidopsis th 0.957 0.336 0.424 3e-66
12323814 1068 disease resistance protein, putative; 11 0.957 0.314 0.424 4e-66
449491173 2349 PREDICTED: uncharacterized protein LOC10 0.945 0.141 0.428 7e-66
12323813 951 disease resistance protein, putative; 63 0.874 0.322 0.478 1e-65
449436623 1111 PREDICTED: probable LRR receptor-like se 0.962 0.304 0.431 2e-65
>gi|358345471|ref|XP_003636801.1| Receptor kinase [Medicago truncatula] gi|355502736|gb|AES83939.1| Receptor kinase [Medicago truncatula] Back     alignment and taxonomy information
 Score =  297 bits (761), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 186/388 (47%), Positives = 238/388 (61%), Gaps = 49/388 (12%)

Query: 1   ICELKNLFELNFGGNKFEGHLPQCLNNLTHLKVLDVSSNKLSGILPSVIANLTSLEYLAL 60
           +C +KNL EL+   N   G+ PQCL NLT L+VLD+SSN   G +PS I +L SLEYL+L
Sbjct: 178 LCGMKNLQELDLSRNGMSGYFPQCLRNLTSLRVLDLSSNNFVGNIPSFIISLKSLEYLSL 237

Query: 61  YDNRFKGRLFSFYSLANLSKFEAFQLSMETDLLQVEIE---NCLPTFQLKVLSLPNCNL- 116
           +D  F G +FSF SL N SK E F LS +T+ L VE E   +  PTFQLKVL L NC L 
Sbjct: 238 FDTNFDG-IFSFSSLNNHSKLEVFLLSPKTNNLYVETEESPSWHPTFQLKVLQLRNCFLN 296

Query: 117 ----GAIPNFLLLQFNLKYLDLSHNKLAGNFPTWLLENNTKLELLYLVNNSFSG-FQLTS 171
               G  P FLL Q  L+ LDLSHNKL+GNFP+W+LENNTKLE LYL+NNSF+G  +L +
Sbjct: 297 SKRDGTFPTFLLYQHELQLLDLSHNKLSGNFPSWILENNTKLETLYLMNNSFTGTLELPT 356

Query: 172 AQHGLLSLDISSNSFTGELPQNMDIVLPKLVYMNVSKNSFEGNIPSSIGKMQ-------- 223
            +HGLL L IS+N   G+L +++  + P L Y+N+SKNSFEG +PSSIG+MQ        
Sbjct: 357 FKHGLLDLQISNNKIGGQLQEDIGKIFPNLYYVNLSKNSFEGILPSSIGEMQTIRTLDLS 416

Query: 224 ------------------------------GLLATYMNMTQLWALYLHNDNFSRKIKDGL 253
                                         GL+    N+T+L  LYL+N++FS  I+DG+
Sbjct: 417 NNNFSGELSSHLISNLTSLRLLRLSHNSFHGLVPLLSNLTRLNWLYLNNNSFSGVIEDGV 476

Query: 254 LRSTELEDLDISNNILSGHIPSWMGNFSHLHTLSMSNNHLEGNIPVQCQNLAGLYIPDIS 313
             ++ L  LDISNN+LSG IP W+G F+ L  LS+S N L+G IP +  NL  L   D+S
Sbjct: 477 SNNSSLFSLDISNNMLSGRIPRWIGRFTKLSVLSLSKNRLQGEIPNELCNLISLSYLDLS 536

Query: 314 ENNLSGSMISTL-NLSSVACLYLQNNAL 340
           ENNLS  +     N   +  LYLQ NAL
Sbjct: 537 ENNLSDFLPYCFKNFKYMKFLYLQKNAL 564

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255553269|ref|XP_002517677.1| receptor-kinase, putative [Ricinus communis] gi|223543309|gb|EEF44841.1| receptor-kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297842171|ref|XP_002888967.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297334808|gb|EFH65226.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15221162|ref|NP_177559.1| receptor like protein 15 [Arabidopsis thaliana] gi|12323812|gb|AAG51871.1|AC079678_1 disease resistance protein, putative; 1096-4664 [Arabidopsis thaliana] gi|332197443|gb|AEE35564.1| receptor like protein 15 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|12324907|gb|AAG52409.1|AC020579_11 putative disease resistance protein; 46848-50365 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|186495296|ref|NP_177557.2| receptor like protein 13 [Arabidopsis thaliana] gi|332197441|gb|AEE35562.1| receptor like protein 13 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|12323814|gb|AAG51873.1|AC079678_3 disease resistance protein, putative; 11609-15699 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449491173|ref|XP_004158820.1| PREDICTED: uncharacterized protein LOC101224990 [Cucumis sativus] Back     alignment and taxonomy information
>gi|12323813|gb|AAG51872.1|AC079678_2 disease resistance protein, putative; 6346-10057 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449436623|ref|XP_004136092.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query351
TAIR|locus:2037308 976 RLP14 "AT1G74180" [Arabidopsis 0.934 0.336 0.469 4.9e-69
TAIR|locus:2019662 965 RLP15 "AT1G74190" [Arabidopsis 0.945 0.344 0.437 1.6e-65
TAIR|locus:2037313 1000 RLP13 "AT1G74170" [Arabidopsis 0.965 0.339 0.433 9.7e-64
TAIR|locus:2155909 908 RLP56 "AT5G49290" [Arabidopsis 0.951 0.367 0.433 4.6e-61
TAIR|locus:2101943 891 RLP45 "AT3G53240" [Arabidopsis 0.937 0.369 0.396 2.9e-54
TAIR|locus:2025012 1083 RLP1 "AT1G07390" [Arabidopsis 0.965 0.313 0.398 1.5e-53
TAIR|locus:2040075 935 RLP21 "AT2G25470" [Arabidopsis 0.943 0.354 0.348 6.8e-38
TAIR|locus:2137296 811 RLP46 "receptor like protein 4 0.914 0.395 0.334 5.4e-33
TAIR|locus:2005540 999 HAE "HAESA" [Arabidopsis thali 0.940 0.330 0.336 1.8e-32
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.900 0.278 0.334 3.5e-31
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 700 (251.5 bits), Expect = 4.9e-69, P = 4.9e-69
 Identities = 161/343 (46%), Positives = 220/343 (64%)

Query:     2 CELKNLFELNFGGNKFEGHLPQCLNNLTHLKVLDVSSNKLSGILPSVIANLTSLEYLALY 61
             CE+KNL +L+  GN FEG LP CL NL  L+VLD+SSN+LSG LP+   +L SLEYL+L 
Sbjct:   257 CEMKNLRQLDLRGNYFEGQLPVCLGNLNKLRVLDLSSNQLSGNLPASFNSLESLEYLSLS 316

Query:    62 DNRFKGRLFSFYSLANLSKFEAFQLSMETDLLQVEIE-NCLPTFQLKVLSLPNCNLGAIP 120
             DN F+G  FS   LANL+K + F+LS  +++LQVE E N LP FQL V +LP C+LG IP
Sbjct:   317 DNNFEG-FFSLNPLANLTKLKVFRLSSTSEMLQVETESNWLPKFQLTVAALPFCSLGKIP 375

Query:   121 NFLLLQFNLKYLDLSHNKLAGNFPTWLLENNTKLELLYLVNNSFSGFQLTSAQHGLLSLD 180
             NFL+ Q NL+ +DLS N+L+G+ PTWLLENN +L++L L NNSF+ FQ+ +  H L  LD
Sbjct:   376 NFLVYQTNLRLVDLSSNRLSGDIPTWLLENNPELKVLQLKNNSFTIFQIPTIVHKLQVLD 435

Query:   181 ISSNSFTGELPQNMDIVLPKLVYMNVSKNSFEGNIPSSIGKMQGLLATYMNMTQLWALYL 240
              S+N  TG LP N+  VLP+L++MN S N F+GN+PSS+G+M  +  ++++++       
Sbjct:   436 FSANDITGVLPDNIGHVLPRLLHMNGSHNGFQGNLPSSMGEMNDI--SFLDLS------- 486

Query:   241 HNDNFSRKIKDGLLRST-ELEDLDISNNILSGHIPSWMGNFSHLHTLSMSNNHLEGNIPV 299
             +N NFS ++   LL     L  L +S+N  SG I       + L  L M NN   G I V
Sbjct:   487 YN-NFSGELPRSLLTGCFSLITLQLSHNSFSGPILPIQTRLTSLIVLRMHNNLFTGEIGV 545

Query:   300 QCQNLAGLYIPDISENNLSGSMISTL--NLSSVACLYLQNNAL 340
               + L  L I D S N L+G + S++  + S +  L L NN L
Sbjct:   546 GLRTLVNLSIFDASNNRLTGLISSSIPPDSSHLIMLLLSNNLL 588
GO:0007165 "signal transduction" evidence=IC
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137296 RLP46 "receptor like protein 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005540 HAE "HAESA" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query351
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-31
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-29
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-28
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-24
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-10
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  125 bits (315), Expect = 1e-31
 Identities = 112/346 (32%), Positives = 160/346 (46%), Gaps = 47/346 (13%)

Query: 3   ELKNLFELNFGGNKFEGHLPQCLNNLTHLKVLDVSSNKLSGILPSVIANLTSLEYLALYD 62
           ++K+L  +  G N   G +P  +  LT L  LD+  N L+G +PS + NL +L+YL LY 
Sbjct: 210 QMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQ 269

Query: 63  NRFKGRL-FSFYSLANLSK--FEAFQLSMETDLLQVEIEN-------------------- 99
           N+  G +  S +SL  L         LS E   L ++++N                    
Sbjct: 270 NKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALT 329

Query: 100 CLPTFQLKVLSLPNCNL-GAIPNFLLLQFNLKYLDLSHNKLAGNFPTWLLENNTKLELLY 158
            LP  +L+VL L +    G IP  L    NL  LDLS N L G  P  L  ++  L  L 
Sbjct: 330 SLP--RLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLC-SSGNLFKLI 386

Query: 159 LVNNSFSGF--QLTSAQHGLLSLDISSNSFTGELPQNMDIVLPKLVYMNVSKNSFEGNIP 216
           L +NS  G   +   A   L  + +  NSF+GELP      LP + ++++S N+ +G I 
Sbjct: 387 LFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEF-TKLPLVYFLDISNNNLQGRIN 445

Query: 217 SSIGKMQGLLATYMNMTQLWALYLHNDNFSRKIKDGLLRSTELEDLDISNNILSGHIPSW 276
           S             +M  L  L L  + F   + D    S  LE+LD+S N  SG +P  
Sbjct: 446 SR----------KWDMPSLQMLSLARNKFFGGLPD-SFGSKRLENLDLSRNQFSGAVPRK 494

Query: 277 MGNFSHLHTLSMSNNHLEGNIPVQ---CQNLAGLYIPDISENNLSG 319
           +G+ S L  L +S N L G IP +   C+ L  L   D+S N LSG
Sbjct: 495 LGSLSELMQLKLSENKLSGEIPDELSSCKKLVSL---DLSHNQLSG 537

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 351
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.84
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.83
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.82
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.78
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.71
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.69
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.68
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
KOG0617264 consensus Ras suppressor protein (contains leucine 99.46
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.38
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.27
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.27
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.25
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.18
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.05
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.05
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.03
PLN03150623 hypothetical protein; Provisional 99.02
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.97
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.96
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.95
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.95
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.92
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.91
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.91
PLN03150 623 hypothetical protein; Provisional 98.84
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.81
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.7
KOG4341483 consensus F-box protein containing LRR [General fu 98.66
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.66
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.65
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.63
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.61
KOG4341483 consensus F-box protein containing LRR [General fu 98.51
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.44
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.42
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.32
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.25
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.22
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.22
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.06
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.02
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.0
PRK15386 426 type III secretion protein GogB; Provisional 97.92
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.86
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.83
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.79
PRK15386 426 type III secretion protein GogB; Provisional 97.71
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.61
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.33
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.32
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.24
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.2
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.12
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.89
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.85
KOG1947 482 consensus Leucine rich repeat proteins, some prote 95.44
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.39
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.16
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.34
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.81
KOG4308 478 consensus LRR-containing protein [Function unknown 92.46
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.01
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 91.91
KOG4308 478 consensus LRR-containing protein [Function unknown 90.03
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 89.15
smart0037026 LRR Leucine-rich repeats, outliers. 89.0
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.0
KOG0473 326 consensus Leucine-rich repeat protein [Function un 83.75
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2e-34  Score=286.05  Aligned_cols=340  Identities=31%  Similarity=0.447  Sum_probs=236.1

Q ss_pred             CCCCCccEEEccCccccccCCccccCCCCCcEEEccCCcCCCCCchhhccCCCCCeEEeecccccCCCcchhhhcccccc
Q 042610            2 CELKNLFELNFGGNKFEGHLPQCLNNLTHLKVLDVSSNKLSGILPSVIANLTSLEYLALYDNRFKGRLFSFYSLANLSKF   81 (351)
Q Consensus         2 ~~l~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~l~~l~~L   81 (351)
                      .++++|++|++++|.+.+.+|..++++++|++|++++|++.+..|..+.++++|++|++++|.+.+..  ...+.++++|
T Consensus       209 ~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~--p~~l~~l~~L  286 (968)
T PLN00113        209 GQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPI--PPSIFSLQKL  286 (968)
T ss_pred             cCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccC--chhHhhccCc
Confidence            46778888888888887778888888888888888888887777778888888888888888765421  1245566777


Q ss_pred             cccccccccccceeeecCcCCccceeEEEcCCCCC-CcCCchhhcCCCceEEEccCcccCCCcChhhhhcCccceEEEec
Q 042610           82 EAFQLSMETDLLQVEIENCLPTFQLKVLSLPNCNL-GAIPNFLLLQFNLKYLDLSHNKLAGNFPTWLLENNTKLELLYLV  160 (351)
Q Consensus        82 ~~l~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~-~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~~~~~~~~L~~L~l~  160 (351)
                      +.+++..+..... ....+..+.+|+.|++++|.+ ..+|..+..+++|+.+++++|.+.+.+|..+ ..+++|+.|+++
T Consensus       287 ~~L~Ls~n~l~~~-~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l-~~~~~L~~L~Ls  364 (968)
T PLN00113        287 ISLDLSDNSLSGE-IPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNL-GKHNNLTVLDLS  364 (968)
T ss_pred             CEEECcCCeeccC-CChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHH-hCCCCCcEEECC
Confidence            7777765543221 222344555666666666665 3445556666666666666666655555432 455566666666


Q ss_pred             CCccccccc--------------------------cccccCCcEEEeeCCccccccCchhhhcCCCceEEEeecCccccC
Q 042610          161 NNSFSGFQL--------------------------TSAQHGLLSLDISSNSFTGELPQNMDIVLPKLVYMNVSKNSFEGN  214 (351)
Q Consensus       161 ~~~l~~~~~--------------------------~~~~~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~  214 (351)
                      +|.+.....                          ...+++|+.|++++|.+.+.+|..+. .+++|+.+++++|.+.+.
T Consensus       365 ~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~-~l~~L~~L~Ls~N~l~~~  443 (968)
T PLN00113        365 TNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFT-KLPLVYFLDISNNNLQGR  443 (968)
T ss_pred             CCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHh-cCCCCCEEECcCCcccCc
Confidence            555443211                          11345566666666666555554443 566666666666666555


Q ss_pred             CCCCccccccchh-------------hhcCccccceeeeccccccccccccccCCCCccEEEccCCcccccCCCCccCCC
Q 042610          215 IPSSIGKMQGLLA-------------TYMNMTQLWALYLHNDNFSRKIKDGLLRSTELEDLDISNNILSGHIPSWMGNFS  281 (351)
Q Consensus       215 ~~~~~~~~~~l~~-------------~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~  281 (351)
                      ++..+..++++..             .....++|+.|++++|.+.+..+..+..+++|+.|++++|.+.+..|..++.++
T Consensus       444 ~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~  523 (968)
T PLN00113        444 INSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCK  523 (968)
T ss_pred             cChhhccCCCCcEEECcCceeeeecCcccccccceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCcc
Confidence            5543333333221             111235678888888888877777788888899999999998888888888899


Q ss_pred             CCcEEEccCcccccCcchhhhcccCCceeecCCCcccccccccc-ccCcccEEEccCccccccccc
Q 042610          282 HLHTLSMSNNHLEGNIPVQCQNLAGLYIPDISENNLSGSMISTL-NLSSVACLYLQNNALGDRFVK  346 (351)
Q Consensus       282 ~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~-~~~~L~~l~l~~n~~~~~~p~  346 (351)
                      +|+.|++++|.+++.+|..+..+++|+.|++++|++.+..|..+ ++++|+++++++|++.|.+|.
T Consensus       524 ~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~  589 (968)
T PLN00113        524 KLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPS  589 (968)
T ss_pred             CCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCC
Confidence            99999999999998899999999999999999999988777766 888999999999999998885

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query351
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-26
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-08
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 5e-26
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-08
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-07
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-06
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 7e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score =  100 bits (249), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 112/383 (29%), Positives = 185/383 (48%), Gaps = 52/383 (13%)
Query: 3   ELKNLFELNFGGNKFEGHLPQCLNNLT-HLKVLDVSSNKLSG-ILPSVIANLT-SLEYLA 59
           +++ L  L+   N+F G LP+ L NL+  L  LD+SSN  SG ILP++  N   +L+ L 
Sbjct: 338 KMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELY 397
Query: 60  LYDNRFKGRLFSFYSLANLSKFEAFQLSMETDLLQVEIENCLPTF-QLKVLSLP-NCNLG 117
           L +N F G++    +L+N S+  +  LS   + L   I + L +  +L+ L L  N   G
Sbjct: 398 LQNNGFTGKIPP--TLSNCSELVSLHLSF--NYLSGTIPSSLGSLSKLRDLKLWLNMLEG 453
Query: 118 AIPNFLLLQFNLKYLDLSHNKLAGNFPTWLLENNTKLELLYLVNNSFSGF--QLTSAQHG 175
            IP  L+    L+ L L  N L G  P+ L  N T L  + L NN  +G   +       
Sbjct: 454 EIPQELMYVKTLETLILDFNDLTGEIPSGL-SNCTNLNWISLSNNRLTGEIPKWIGRLEN 512
Query: 176 LLSLDISSNSFTGELPQNMDIVLPKLVYMNVSKNSFEGNIPSSIGKMQGLLATYMNMTQL 235
           L  L +S+NSF+G +P  +      L++++++ N F G IP+++ K  G +A      + 
Sbjct: 513 LAILKLSNNSFSGNIPAELGDCR-SLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKR 571
Query: 236 WALYLHNDNFSRKIKDGL-------LRSTELEDL-------------------------- 262
           + +Y+ ND   ++            +RS +L  L                          
Sbjct: 572 Y-VYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGS 630
Query: 263 ----DISNNILSGHIPSWMGNFSHLHTLSMSNNHLEGNIPVQCQNLAGLYIPDISENNLS 318
               D+S N+LSG+IP  +G+  +L  L++ +N + G+IP +  +L GL I D+S N L 
Sbjct: 631 MMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLD 690
Query: 319 GSMISTLN-LSSVACLYLQNNAL 340
           G +   ++ L+ +  + L NN L
Sbjct: 691 GRIPQAMSALTMLTEIDLSNNNL 713
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query351
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-59
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-55
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-54
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-49
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-49
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-49
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-45
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-44
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-32
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-39
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-39
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-31
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-19
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-33
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-31
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-31
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-31
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-23
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-22
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-31
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-31
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-30
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-28
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-28
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-18
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-29
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-29
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-24
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-27
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-24
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-24
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-26
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-25
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-25
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-24
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-24
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-22
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-13
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-21
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-21
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-18
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-18
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-09
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-09
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-19
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-18
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-13
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-15
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-08
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-15
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-13
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-13
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-04
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-08
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  203 bits (519), Expect = 1e-59
 Identities = 101/348 (29%), Positives = 152/348 (43%), Gaps = 25/348 (7%)

Query: 1   ICELKNLFELNFGGNKFEGHLPQCLNNLTHLKVLDVSSNKLSGILPSVIANLTSLEYLAL 60
           +    NL  L+   N F   +P  L + + L+ LD+S NKLSG     I+  T L+ L +
Sbjct: 196 VSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNI 254

Query: 61  YDNRFKGRLFSFYSLANLSKFEAFQLSME--TDLLQVEIENCLPTFQLKVLSLPNCNL-G 117
             N+F G +        L   +   L+    T  +   +        L  L L   +  G
Sbjct: 255 SSNQFVGPIPPL----PLKSLQYLSLAENKFTGEIPDFLSGACD--TLTGLDLSGNHFYG 308

Query: 118 AIPNFLLLQFNLKYLDLSHNKLAGNFPTWLLENNTKLELLYLVNNSFSG---FQLTSAQH 174
           A+P F      L+ L LS N  +G  P   L     L++L L  N FSG     LT+   
Sbjct: 309 AVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 368

Query: 175 GLLSLDISSNSFTGELPQNM-DIVLPKLVYMNVSKNSFEGNIPSSIGKMQGLLATYMNMT 233
            LL+LD+SSN+F+G +  N+       L  + +  N F G IP ++           N +
Sbjct: 369 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLS----------NCS 418

Query: 234 QLWALYLHNDNFSRKIKDGLLRSTELEDLDISNNILSGHIPSWMGNFSHLHTLSMSNNHL 293
           +L +L+L  +  S  I   L   ++L DL +  N+L G IP  +     L TL +  N L
Sbjct: 419 ELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 478

Query: 294 EGNIPVQCQNLAGLYIPDISENNLSGSMISTL-NLSSVACLYLQNNAL 340
            G IP    N   L    +S N L+G +   +  L ++A L L NN+ 
Sbjct: 479 TGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSF 526
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query351
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.98
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.98
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.93
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.92
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.9
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.89
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.89
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.83
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.83
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.83
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.81
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.81
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.81
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.76
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.74
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.73
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.73
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.73
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.71
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.71
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.69
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.69
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.66
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.66
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.66
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.64
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.63
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.61
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.59
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.55
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.55
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.54
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.52
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.52
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.51
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.49
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.45
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.44
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.42
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.41
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.38
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.36
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.34
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.32
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.32
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.3
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.27
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.27
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.26
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.24
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.98
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.97
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.91
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.84
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.77
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.67
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.54
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.53
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.46
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.17
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.02
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.53
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.45
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.45
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.18
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=3.7e-38  Score=304.15  Aligned_cols=338  Identities=31%  Similarity=0.417  Sum_probs=219.5

Q ss_pred             CCccEEEccCccccccCCccccCCCCCcEEEccCCcCCCCCchh-hccCCCCCeEEeecccccCCCcchhhhcccc-ccc
Q 042610            5 KNLFELNFGGNKFEGHLPQCLNNLTHLKVLDVSSNKLSGILPSV-IANLTSLEYLALYDNRFKGRLFSFYSLANLS-KFE   82 (351)
Q Consensus         5 ~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~-~~~l~~L~~L~l~~~~~~~~~~~~~~l~~l~-~L~   82 (351)
                      ++|++|++++|.+.+.+|..++++++|++|++++|.+.+..|.. +.++++|++|++++|.+.+...  ..+.+++ +|+
T Consensus       294 ~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p--~~l~~l~~~L~  371 (768)
T 3rgz_A          294 DTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELP--ESLTNLSASLL  371 (768)
T ss_dssp             TTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCC--TTHHHHTTTCS
T ss_pred             CcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCcccc--HHHHhhhcCCc
Confidence            44444444444444444444444444444444444444333322 4444444444444444431111  1122222 444


Q ss_pred             ccccccccccceeeecCcC--CccceeEEEcCCCCCC-cCCchhhcCCCceEEEccCcccCCCcChhhhhcCccceEEEe
Q 042610           83 AFQLSMETDLLQVEIENCL--PTFQLKVLSLPNCNLG-AIPNFLLLQFNLKYLDLSHNKLAGNFPTWLLENNTKLELLYL  159 (351)
Q Consensus        83 ~l~l~~~~~~~~~~~~~~~--~~~~L~~L~l~~~~~~-~~~~~~~~~~~L~~l~l~~~~~~~~~~~~~~~~~~~L~~L~l  159 (351)
                      .+++..+....... ..+.  .+..|+.|++++|.+. .+|..+..+++|+.|++++|.+.+.+|.. +..+++|+.|++
T Consensus       372 ~L~Ls~N~l~~~~~-~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~-l~~l~~L~~L~L  449 (768)
T 3rgz_A          372 TLDLSSNNFSGPIL-PNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS-LGSLSKLRDLKL  449 (768)
T ss_dssp             EEECCSSEEEEECC-TTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGG-GGGCTTCCEEEC
T ss_pred             EEEccCCCcCCCcC-hhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHH-HhcCCCCCEEEC
Confidence            44444333211111 1111  1456677777777663 56666777777777777777776555554 356677777777


Q ss_pred             cCCccccccc--cccccCCcEEEeeCCccccccCchhhhcCCCceEEEeecCccccCCCCCccccccch-----------
Q 042610          160 VNNSFSGFQL--TSAQHGLLSLDISSNSFTGELPQNMDIVLPKLVYMNVSKNSFEGNIPSSIGKMQGLL-----------  226 (351)
Q Consensus       160 ~~~~l~~~~~--~~~~~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~l~-----------  226 (351)
                      ++|.+....+  ...+++|+.|++++|.+.+.+|..+. .+++|+.|++++|.+.+.+|.+++.++++.           
T Consensus       450 ~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~-~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~  528 (768)
T 3rgz_A          450 WLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLS-NCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSG  528 (768)
T ss_dssp             CSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGG-GCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEE
T ss_pred             CCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHh-cCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccC
Confidence            7776664322  22556677777777766655665554 566777777777776666666665555443           


Q ss_pred             ---hhhcCccccceeeecccccccccccc---------------------------------------------------
Q 042610          227 ---ATYMNMTQLWALYLHNDNFSRKIKDG---------------------------------------------------  252 (351)
Q Consensus       227 ---~~~~~~~~L~~L~l~~~~~~~~~~~~---------------------------------------------------  252 (351)
                         ..+..+++|+.|++++|.+.+.+|..                                                   
T Consensus       529 ~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~  608 (768)
T 3rgz_A          529 NIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLS  608 (768)
T ss_dssp             ECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGG
T ss_pred             cCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccc
Confidence               34566778888998888776544432                                                   


Q ss_pred             -------------------ccCCCCccEEEccCCcccccCCCCccCCCCCcEEEccCcccccCcchhhhcccCCceeecC
Q 042610          253 -------------------LLRSTELEDLDISNNILSGHIPSWMGNFSHLHTLSMSNNHLEGNIPVQCQNLAGLYIPDIS  313 (351)
Q Consensus       253 -------------------~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~  313 (351)
                                         +..+++|+.|++++|.+++.+|..++.+++|+.|++++|.+++.+|..++.++.|+.|+++
T Consensus       609 ~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs  688 (768)
T 3rgz_A          609 TRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLS  688 (768)
T ss_dssp             GTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECC
T ss_pred             cccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECC
Confidence                               3345678999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcccccccccc-ccCcccEEEccCcccccccccc
Q 042610          314 ENNLSGSMISTL-NLSSVACLYLQNNALGDRFVKL  347 (351)
Q Consensus       314 ~n~~~~~~~~~~-~~~~L~~l~l~~n~~~~~~p~~  347 (351)
                      +|++++.+|..+ .+++|++|++++|+++|.+|..
T Consensus       689 ~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~  723 (768)
T 3rgz_A          689 SNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEM  723 (768)
T ss_dssp             SSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSS
T ss_pred             CCcccCcCChHHhCCCCCCEEECcCCcccccCCCc
Confidence            999999999888 8999999999999999999964
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 351
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.004
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 65.4 bits (158), Expect = 2e-12
 Identities = 61/372 (16%), Positives = 112/372 (30%), Gaps = 64/372 (17%)

Query: 3   ELKNLFELNFGGNKFEGHLPQCLNNLTHLKVLDVSSNKLSGILPSVIANLTSLEYLALYD 62
           +L  +  L       +      +  L +L  ++ S+N+L+ I P  + NLT L  + + +
Sbjct: 42  DLDQVTTLQADRLGIKS--IDGVEYLNNLTQINFSNNQLTDITP--LKNLTKLVDILMNN 97

Query: 63  NRFKGRLFSFYSLANLSK-----------------------------------FEAFQLS 87
           N+                                                        L 
Sbjct: 98  NQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQ 157

Query: 88  METDLLQVEIENCLPTFQLKVLSLPNCNLGAIPNFLLLQFNLKYLDLSHNKLAGNFPTWL 147
             +   QV     L           + N  +  + L    NL+ L  ++N+++   P   
Sbjct: 158 QLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLG- 216

Query: 148 LENNTKLELLYLVNNSFSGFQLTSAQHGLLSLDISSNSFTGELPQNMDIVLPKLVYMNVS 207
               T L+ L L  N        ++   L  LD+++N  +   P +    L KL  + + 
Sbjct: 217 --ILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAPLSG---LTKLTELKLG 271

Query: 208 KNSFEGNIPSSIGKMQGLLATYMNMTQLWALYLHNDNFSRKIKDGLLRSTELEDLDISNN 267
            N      P +       L    N  +  +   +  N              L  L +  N
Sbjct: 272 ANQISNISPLAGLTALTNLELNENQLEDISPISNLKN--------------LTYLTLYFN 317

Query: 268 ILSGHIPSWMGNFSHLHTLSMSNNHLEGNIPVQCQNLAGLYIPDISENNLSGSMISTLNL 327
            +S   P  + + + L  L  +NN +         NL  +       N +S       NL
Sbjct: 318 NISDISP--VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGHNQISDL-TPLANL 372

Query: 328 SSVACLYLQNNA 339
           + +  L L + A
Sbjct: 373 TRITQLGLNDQA 384
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query351
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.88
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.83
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.71
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.66
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.62
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.61
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.6
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.58
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.45
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.43
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.41
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.16
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.16
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.13
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.03
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.04
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.02
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.97
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.95
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.5
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.45
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.95  E-value=6.5e-27  Score=200.34  Aligned_cols=105  Identities=21%  Similarity=0.214  Sum_probs=71.8

Q ss_pred             eeeeccccccccccccccCCCCccEEEccCCcccccCCCCccCCCCCcEEEccCcccccCcchhhhcccCCceeecCCCc
Q 042610          237 ALYLHNDNFSRKIKDGLLRSTELEDLDISNNILSGHIPSWMGNFSHLHTLSMSNNHLEGNIPVQCQNLAGLYIPDISENN  316 (351)
Q Consensus       237 ~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~n~  316 (351)
                      .+++..+...+..+..+..+++++.+++.++.+.+.. ..++.+++|+.|++++|++++.+|..++++++|++|++++|+
T Consensus       201 ~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~-~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~  279 (313)
T d1ogqa_         201 FVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDL-GKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNN  279 (313)
T ss_dssp             EEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBG-GGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSE
T ss_pred             ccccccccccccccccccccccccccccccccccccc-cccccccccccccCccCeecccCChHHhCCCCCCEEECcCCc
Confidence            4555555555555555666677777777777776443 346667777777777777777777777777777777777777


Q ss_pred             cccccccccccCcccEEEccCcc-ccc
Q 042610          317 LSGSMISTLNLSSVACLYLQNNA-LGD  342 (351)
Q Consensus       317 ~~~~~~~~~~~~~L~~l~l~~n~-~~~  342 (351)
                      +++.+|....+.+|+.+++++|+ ++|
T Consensus       280 l~g~iP~~~~L~~L~~l~l~~N~~l~g  306 (313)
T d1ogqa_         280 LCGEIPQGGNLQRFDVSAYANNKCLCG  306 (313)
T ss_dssp             EEEECCCSTTGGGSCGGGTCSSSEEES
T ss_pred             ccccCCCcccCCCCCHHHhCCCccccC
Confidence            77666654466777777777776 454
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure