Citrus Sinensis ID: 042632

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------66
ICELKNLVELNLSGNKFDGSLPQCLSNLTYLRVLNLSSNQLSGSLPISVFANLTSLEYLSLSDKKFQGSFSLSVLANHSRLEHCNISGTIASFLQYQYDLRYIDLSHNNLAGTIPTWLLQNNTKLEILFLFNNFLTGRLHLPDSKRDLLHLVISNNNFIGTLPDNFGVILPELVYLDMSQNSFVGSIPPSTGYMERLLFLDLSSNNFSGELPKQFLTGCVSLEFMNLSHNLFVGQIFPKYMNLTQLAWLYLSDNQFTGRLEEGLLNAPSLYILDVSNNMLSGQLPHWAGNFSNLDVLLMSRNSLEGDVSVPLSNLQVTRILDISGNKLYGPLEFSSNHSSLRHLFLHNNSLNGNIPHLINEDSNLRALLLRGNNLQGNIPEPLCHLRKLSIVDISCNNLNGSIPSCFTNISLWMEESDSFNGFVIWHGILLDASGRRLSRIKSTSRNKFMAKNRYESYKGDVLNYMTGLDLSSNELTGDIPSEIGLLQELHALNLSHNHFSGSIPRSFSILKMIESMDLSYNELSGRIPLELSELNYLAIFNVSYNDLLGPVPNSRQFANFDENNYRGNPLLCGPPVLKNCSSDLPPPLPTTPAEEDEPAIDKVAFNWSFAASYVAVILGLMAILLLNSYWRRQWFLLVDACIDSSCFYFLYKLAFYRR
ccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccEEccHHHHHcccccccccccccccHHccccccccEEEcccccccccccHHHHcccccccEEEccccccEEEcccccccccccEEEccccEEEEEccccHHcccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEccccEEEEEccccccccccccEEEccccEEEEEccccccccccccEEEcccccccccccccccccccccEEEccccccEEEccccccccccccEEEccccccEEccccccccccccEEEcccccccccccHHHHccccccEEEccccccEEcccccccccccccEEEcccccccccccHHHHHHHHHHHccccccccEEEccccccccccccccEEEccEEEEEEccccccccccccccccEEEcccccccccccHHHHccccccccccccccccccccHHHHccccccEEccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcEEEEEEEEEEEHHHHccccHHHHHHHHHHHHcEEEEEEEEEEccccc
ccccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccHHHHHccccccEEEcccccccccccHHHHHHHHHHHHccccccccHHHccccccEEEEEccccccccccHHHHHccccccEEEEccccccccccccccccccEEEEEccccccccccHHHHHHcccccEEEcccccccccccHHHccccccEEEEEccccccccccHHHHHccccccEEEEccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEccccEEEEccHHHccccccccEEEccccEEccEHHHccccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEcccHHccccccEEEEEccccccccccHHHccccccEEEEccccccccccccccccccccccEEEEccccccccccccccHHccccccEEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHcccccccHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccEEEEEEHHccc
ICELKNLVELnlsgnkfdgslpqclsnlTYLRVLNLSsnqlsgslpisVFANLtsleylslsdkkfqgsFSLSVLanhsrlehcniSGTIASFLQYQYDLRYidlshnnlagtiptwllqnnTKLEILFLFNNfltgrlhlpdskRDLLHLVISnnnfigtlpdnfgviLPELVYldmsqnsfvgsippstgyMERLLFLDlssnnfsgelpkqfLTGCVSLEfmnlshnlfvgqifpkymNLTQLAWLYLSDNQFTGRLeegllnapslyildvsnnmlsgqlphwagnfsNLDVLLMSRnslegdvsvplsnlqvtrildisgnklygplefssnhsslRHLFLhnnslngniphlinEDSNLRALLLRGnnlqgnipeplchlrkLSIVDiscnnlngsipscfTNISLWMEESDSFNGFVIWHGILLDasgrrlsrikstsrnkfmaknryesykgdvlnymtgldlssneltgdipseIGLLQELHALnlshnhfsgsiprSFSILKMIESMDLSynelsgriplelselNYLAIFNVSyndllgpvpnsrqfanfdennyrgnpllcgppvlkncssdlppplpttpaeedepaidkvafNWSFAASYVAVILGLMAILLLNSYWRRQWFLLVDAcidsscfyfLYKLAFYRR
ICELKNLVELNLsgnkfdgslPQCLSNLTYLRVLNLSSNQLSGSLPISVFANLTSLEYLSLSDKKFQGSFSLSVLANHSRLEHCNISGTIASFLQYQYDLRYIDLSHNNLAGTIPTWLLQNNTKLEILFLFNNFLTGRLHLPDSKRDLLHLVISNNNFIGTLPDNFGVILPELVYLDMSQNSFVGSIPPSTGYMERLLFLDLSSNNFSGELPKQFLTGCVSLEFMNLSHNLFVGQIFPKYMNLTQLAWLYLSDNQFTGRLEEGLLNAPSLYILDVSNNMLSGQLPHWAGNFSNLDVLLMSRNSLEGDVSVPLSNLQVTRILDISGNKLYGPLEFSSNHSSLRHLFLHNNSLNGNIPHLINEDSNLRALLLRGNNLQGNIPEPLCHLRKLSIVDISCNNLNGSIPSCFTNISLWMEESDSFNGFVIWHGILldasgrrlsrikstsrnkfmaknryesykgdVLNYMTGLDLSSNELTGDIPSEIGLLQELHALNLSHNHFSGSIPRSFSILKMIESMDLSYNELSGRIPLELSELNYLAIFNVSYNDLLGPVPNSRQFANFDENNYRGNPLLCGPPVLKNCSSDLPPPLPTTPAEEDEPAIDKVAFNWSFAASYVAVILGLMAILLLNSYWRRQWFLLVDACIDSSCFYFLYKLAFYRR
ICELKNLVELNLSGNKFDGSLPQCLSNLTYLRVlnlssnqlsgslPISVFANLTSLEYLSLSDKKFQGSFSLSVLANHSRLEHCNISGTIASFLQYQYDLRYIDLSHNNLAGTIPTWLLQNNTKLEILFLFNNFLTGRLHLPDSKRDLLHLVISNNNFIGTLPDNFGVILPELVYLDMSQNSFVGSIPPSTGYMERllfldlssnnfsGELPKQFLTGCVSLEFMNLSHNLFVGQIFPKYMNLTQLAWLYLSDNQFTGRLEEGLLNAPSLYILDVSNNMLSGQLPHWAGNFSNLDVLLMSRNSLEGDVSVPLSNLQVTRILDISGNKLYGPLEFSSNHSSLRHLFLHNNSLNGNIPHLINEDSnlralllrgnnlqgnIPEPLCHLRKLSIVDISCNNLNGSIPSCFTNISLWMEESDSFNGFVIWHGILLDASGRRLSRIKSTSRNKFMAKNRYESYKGDVLNYMTGLDLSSNELTGDIPSEIGLLQELHALNLSHNHFSGSIPRSFSILKMIESMDLSYNELSGRIPLELSELNYLAIFNVSYNDLLGPVPNSRQFANFDENNYRGNPLLCGPPVLKNCSSdlppplpttpaeedepaIDKVAFNWSFAASYVAVILGLMAILLLNSYWRRQWFLLVDACIDSSCFYFLYKLAFYRR
******LVELNLSGNKFDGSLPQCLSNLTYLRVLNLSSNQLSGSLPISVFANLTSLEYLSLSDKKFQGSFSLSVLANHSRLEHCNISGTIASFLQYQYDLRYIDLSHNNLAGTIPTWLLQNNTKLEILFLFNNFLTGRLHLPDSKRDLLHLVISNNNFIGTLPDNFGVILPELVYLDMSQNSFVGSIPPSTGYMERLLFLDLSSNNFSGELPKQFLTGCVSLEFMNLSHNLFVGQIFPKYMNLTQLAWLYLSDNQFTGRLEEGLLNAPSLYILDVSNNMLSGQLPHWAGNFSNLDVLLMSRNSLEGDVSVPLSNLQVTRILDISGNKLYGPLEFSSNHSSLRHLFLHNNSLNGNIPHLINEDSNLRALLLRGNNLQGNIPEPLCHLRKLSIVDISCNNLNGSIPSCFTNISLWMEESDSFNGFVIWHGILLDASGRRLS*********FMAKNRYESYKGDVLNYMTGLDLSSNELTGDIPSEIGLLQELHALNLSHNHFSGSIPRSFSILKMIESMDLSYNELSGRIPLELSELNYLAIFNVSYNDLLGPVPNSRQFANFDENNYRGNPLLCGPPVL**********************IDKVAFNWSFAASYVAVILGLMAILLLNSYWRRQWFLLVDACIDSSCFYFLYKLAFY**
ICELKNLVELNLSGNKFDGSLPQCLSNLTYLRVLNLSSNQLSGSLPISVFANLTSLEYLSLSDKKFQGSFSLSVLANHSRLEHCNISGTIASFLQYQYDLRYIDLSHNNLAGTIPTWLLQNNTKLEILFLFNNFLTGRLHLPDSKRDLLHLVISNNNFIGTLPDNFGVILPELVYLDMSQNSFVGSIPPSTGYMERLLFLDLSSNNFSGELPKQFLTGCVSLEFMNLSHNLFVGQIFPKYMNLTQLAWLYLSDNQFTGRLEEGLLNAPSLYILDVSNNMLSGQLPHWAGNFSNLDVLLMSRNSLEGDVSVPLSNLQVTRILDISGNKLYGPLEFSSNHSSLRHLFLHNNSLNGNIPHLINEDSNLRALLLRGNNLQGNIPEPLCHLRKLSIVDISCNNLNGSIPSCFTNISLWMEESD****FVIWHGILLDASGRRLSRIKSTSRNKFMAKNRYESYKGDVLNYMTGLDLSSNELTGDIPSEIGLLQELHALNLSHNHFSGSIPRSFSILKMIESMDLSYNELSGRIPLELSELNYLAIFNVSYNDLLGPVPNSRQFANFDENNYRGNPLLCGP*****************************AFNWSFAASYVAVILGLMAILLLNSYWRRQWFLLVDACIDSSCFYFLYKLAFYRR
ICELKNLVELNLSGNKFDGSLPQCLSNLTYLRVLNLSSNQLSGSLPISVFANLTSLEYLSLSDKKFQGSFSLSVLANHSRLEHCNISGTIASFLQYQYDLRYIDLSHNNLAGTIPTWLLQNNTKLEILFLFNNFLTGRLHLPDSKRDLLHLVISNNNFIGTLPDNFGVILPELVYLDMSQNSFVGSIPPSTGYMERLLFLDLSSNNFSGELPKQFLTGCVSLEFMNLSHNLFVGQIFPKYMNLTQLAWLYLSDNQFTGRLEEGLLNAPSLYILDVSNNMLSGQLPHWAGNFSNLDVLLMSRNSLEGDVSVPLSNLQVTRILDISGNKLYGPLEFSSNHSSLRHLFLHNNSLNGNIPHLINEDSNLRALLLRGNNLQGNIPEPLCHLRKLSIVDISCNNLNGSIPSCFTNISLWMEESDSFNGFVIWHGILLDASGRRLSRIKSTSRNKFMAKNRYESYKGDVLNYMTGLDLSSNELTGDIPSEIGLLQELHALNLSHNHFSGSIPRSFSILKMIESMDLSYNELSGRIPLELSELNYLAIFNVSYNDLLGPVPNSRQFANFDENNYRGNPLLCGPPVLKNCSSDLPPPLPTTPAEEDEPAIDKVAFNWSFAASYVAVILGLMAILLLNSYWRRQWFLLVDACIDSSCFYFLYKLAFYRR
*CELKNLVELNLSGNKFDGSLPQCLSNLTYLRVLNLSSNQLSGSLPISVFANLTSLEYLSLSDKKFQGSFSLSVLANHSRLEHCNISGTIASFLQYQYDLRYIDLSHNNLAGTIPTWLLQNNTKLEILFLFNNFLTGRLHLPDSKRDLLHLVISNNNFIGTLPDNFGVILPELVYLDMSQNSFVGSIPPSTGYMERLLFLDLSSNNFSGELPKQFLTGCVSLEFMNLSHNLFVGQIFPKYMNLTQLAWLYLSDNQFTGRLEEGLLNAPSLYILDVSNNMLSGQLPHWAGNFSNLDVLLMSRNSLEGDVSVPLSNLQVTRILDISGNKLYGPLEFSSNHSSLRHLFLHNNSLNGNIPHLINEDSNLRALLLRGNNLQGNIPEPLCHLRKLSIVDISCNNLNGSIPSCFTNISLWMEESDSFNGFVIWHGILLDASGRRLSRIKSTSRNKFMAKNRYESYKGDVLNYMTGLDLSSNELTGDIPSEIGLLQELHALNLSHNHFSGSIPRSFSILKMIESMDLSYNELSGRIPLELSELNYLAIFNVSYNDLLGPVPNSRQFANFDENNYRGNPLLCGPPVLKNC******************AIDKVAFNWSFAASYVAVILGLMAILLLNSYWRRQWFLLVDACIDSSCFYFLYKLAFY**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHoo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ICELKNLVELNLSGNKFDGSLPQCLSNLTYLRVLNLSSNQLSGSLPISVFANLTSLEYLSLSDKKFQGSFSLSVLANHSRLEHCNISGTIASFLQYQYDLRYIDLSHNNLAGTIPTWLLQNNTKLEILFLFNNFLTGRLHLPDSKRDLLHLVISNNNFIGTLPDNFGVILPELVYLDMSQNSFVGSIPPSTGYMERLLFLDLSSNNFSGELPKQFLTGCVSLEFMNLSHNLFVGQIFPKYMNLTQLAWLYLSDNQFTGRLEEGLLNAPSLYILDVSNNMLSGQLPHWAGNFSNLDVLLMSRNSLEGDVSVPLSNLQVTRILDISGNKLYGPLEFSSNHSSLRHLFLHNNSLNGNIPHLINEDSNLRALLLRGNNLQGNIPEPLCHLRKLSIVDISCNNLNGSIPSCFTNISLWMEESDSFNGFVIWHGILLDASGRRLSRIKSTSRNKFMAKNRYESYKGDVLNYMTGLDLSSNELTGDIPSEIGLLQELHALNLSHNHFSGSIPRSFSILKMIESMDLSYNELSGRIPLELSELNYLAIFNVSYNDLLGPVPNSRQFANFDENNYRGNPLLCGPPVLKNCSSDLPPPLPTTPAEEDEPAIDKVAFNWSFAASYVAVILGLMAILLLNSYWRRQWFLLVDACIDSSCFYFLYKLAFYRR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query659 2.2.26 [Sep-21-2011]
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.949 0.518 0.324 1e-59
Q8L899 1207 Systemin receptor SR160 O N/A no 0.949 0.518 0.322 2e-59
Q9C9H7847 Receptor-like protein 12 no no 0.877 0.682 0.316 2e-59
C0LGQ5 1249 LRR receptor-like serine/ no no 0.819 0.432 0.325 2e-59
Q9FL28 1173 LRR receptor-like serine/ no no 0.857 0.481 0.337 3e-58
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.849 0.447 0.307 1e-57
O22476 1196 Protein BRASSINOSTEROID I no no 0.846 0.466 0.329 5e-56
C0LGS2 1136 Probable LRR receptor-lik no no 0.869 0.504 0.324 5e-56
Q9SHI2 1101 Leucine-rich repeat recep no no 0.843 0.504 0.322 2e-55
Q9ZWC8 1166 Serine/threonine-protein no no 0.951 0.537 0.291 9e-55
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function desciption
 Score =  231 bits (590), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 225/694 (32%), Positives = 322/694 (46%), Gaps = 68/694 (9%)

Query: 6   NLVELNLSGNKFDGSLPQCLSNLTY-LRVLNLSSNQLSGS--LPISVFANLTSLEYLSLS 62
           NL  LNLS N  D    + L   T+ L+VL+LS N +SG    P         LE+ SL 
Sbjct: 161 NLKSLNLSKNFLDPPGKEMLKAATFSLQVLDLSYNNISGFNLFPWVSSMGFVELEFFSLK 220

Query: 63  DKKFQGSFSLSVLANHSRLEHC--NISGTIASFLQYQYDLRYIDLSHNNLAGTIPTWLLQ 120
             K  GS       N S L+    N S    SF     +L+++DLS N   G I + L  
Sbjct: 221 GNKLAGSIPELDFKNLSYLDLSANNFSTVFPSFKDCS-NLQHLDLSSNKFYGDIGSSL-S 278

Query: 121 NNTKLEILFLFNNFLTGRL-HLPDSKRDLLHLVISNNNFIGTLPDNFGVILPELVYLDMS 179
           +  KL  L L NN   G +  LP     L +L +  N+F G  P+    +   +V LD+S
Sbjct: 279 SCGKLSFLNLTNNQFVGLVPKLP--SESLQYLYLRGNDFQGVYPNQLADLCKTVVELDLS 336

Query: 180 QNSFVGSIPPSTGYMERLLFLDLSSNNFSGELPKQFLTGCVSLEFMNLSHNLFVGQIFPK 239
            N+F G +P S G    L  +D+S NNFSG+LP   L+   +++ M LS N FVG +   
Sbjct: 337 YNNFSGMVPESLGECSSLELVDISYNNFSGKLPVDTLSKLSNIKTMVLSFNKFVGGLPDS 396

Query: 240 YMNLTQLAWL--------------------------YLSDNQFTGRLEEGLLNAPSLYIL 273
           + NL +L  L                          YL +N F G + + L N   L  L
Sbjct: 397 FSNLLKLETLDMSSNNLTGVIPSGICKDPMNNLKVLYLQNNLFKGPIPDSLSNCSQLVSL 456

Query: 274 DVSNNMLSGQLPHWAGNFSNLDVLLMSRNSLEGDVSVPLSNLQVTRILDISGNKLYGPLE 333
           D+S N L+G +P   G+ S L  L++  N L G++   L  LQ    L +  N L GP+ 
Sbjct: 457 DLSFNYLTGSIPSSLGSLSKLKDLILWLNQLSGEIPQELMYLQALENLILDFNDLTGPIP 516

Query: 334 FS-SNHSSLRHLFLHNNSLNGNIPHLINEDSNLRALLLRGNNLQGNIPEPLCHLRKLSIV 392
            S SN + L  + L NN L+G IP  +   SNL  L L  N++ GNIP  L + + L  +
Sbjct: 517 ASLSNCTKLNWISLSNNQLSGEIPASLGRLSNLAILKLGNNSISGNIPAELGNCQSLIWL 576

Query: 393 DISCNNLNGSIPSCF----TNISLWMEESDSF-----NGFVIWHGI--LLDASGRRLSRI 441
           D++ N LNGSIP        NI++ +     +     +G    HG   LL+  G R  ++
Sbjct: 577 DLNTNFLNGSIPPPLFKQSGNIAVALLTGKRYVYIKNDGSKECHGAGNLLEFGGIRQEQL 636

Query: 442 -KSTSRNKFMAKNRYESYKGDVLNY---MTGLDLSSNELTGDIPSEIGLLQELHALNLSH 497
            + ++R+       Y        N+   M  LDLS N+L G IP E+G +  L  LNL H
Sbjct: 637 DRISTRHPCNFTRVYRGITQPTFNHNGSMIFLDLSYNKLEGSIPKELGAMYYLSILNLGH 696

Query: 498 NHFSGSIPRSFSILKMIESMDLSYNELSGRIPLELSELNYLAIFNVSYNDLLGPVPNSRQ 557
           N  SG IP+    LK +  +DLSYN  +G IP  L+ L  L   ++S N+L G +P S  
Sbjct: 697 NDLSGMIPQQLGGLKNVAILDLSYNRFNGTIPNSLTSLTLLGEIDLSNNNLSGMIPESAP 756

Query: 558 FANFDENNYRGNPLLCGPPVLKNCSSDLPPPLPTTPAEEDEPAIDKVAFNWSFAASYVA- 616
           F  F +  +  N  LCG P+   CSS      P + A + + +  + A   S A S    
Sbjct: 757 FDTFPDYRFANNS-LCGYPLPIPCSSG-----PKSDANQHQKSHRRQA---SLAGSVAMG 807

Query: 617 ------VILGLMAILLLNSYWRRQWFLLVDACID 644
                  I GL+ + +     RR+    ++A +D
Sbjct: 808 LLFSLFCIFGLIIVAIETKKRRRKKEAALEAYMD 841
Receptor with a serine/threonine-protein kinase activity. Regulates, in response to brassinosteroid binding, a signaling cascade involved in plant development, including expression of light- and stress-regulated genes, promotion of cell elongation, normal leaf and chloroplast senescence, and flowering. May be involved in a feedback regulation of brassinosteroid biosynthesis. May be also involved in the perception of systemin, a peptide hormone responsible for the systemic activation of defense genes in leaves of wounded plants.
Solanum lycopersicum (taxid: 4081)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query659
359482749 1067 PREDICTED: leucine-rich repeat receptor 0.986 0.609 0.417 1e-140
358345471 933 Receptor kinase [Medicago truncatula] gi 0.987 0.697 0.433 1e-139
357468861 1016 Receptor-like protein kinase [Medicago t 0.930 0.603 0.429 1e-138
358345693 1011 Receptor-like protein kinase [Medicago t 0.930 0.606 0.429 1e-138
297842171 966 leucine-rich repeat family protein [Arab 0.959 0.654 0.417 1e-138
359482745 1026 PREDICTED: leucine-rich repeat receptor 0.983 0.631 0.418 1e-138
359483163 1047 PREDICTED: LRR receptor-like serine/thre 0.977 0.615 0.418 1e-137
186495296 1000 receptor like protein 13 [Arabidopsis th 0.963 0.635 0.418 1e-137
12323814 1068 disease resistance protein, putative; 11 0.963 0.594 0.418 1e-137
359482735 1097 PREDICTED: receptor-like protein 12-like 0.986 0.592 0.407 1e-136
>gi|359482749|ref|XP_002262614.2| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  504 bits (1299), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 303/725 (41%), Positives = 414/725 (57%), Gaps = 75/725 (10%)

Query: 1    ICELKNLVELNLSGNKFDGSLPQCLSNLTYLRVLNLSSNQLSGSLPISVFANLTSLEYLS 60
             C+L  L EL+LS N F G+LP CL+NLT LR+L+LSSN LSG+L   +  NLTSLEY+ 
Sbjct: 333  FCQLNKLQELDLSYNLFQGTLPPCLNNLTSLRLLDLSSNHLSGNLSSPLLPNLTSLEYID 392

Query: 61   LSDKKFQGSFSLSVLANHSRLE---------------------------------HCNIS 87
            LS   F+GSFS S  ANHS+L+                                 +C ++
Sbjct: 393  LSYNHFEGSFSFSSFANHSKLQVVILGSDNNKFEVETEYPVGWVPLFQLKALFLSNCKLT 452

Query: 88   GTIASFLQYQYDLRYIDLSHNNLAGTIPTWLLQNNTKLEILFLFNNFLTGRLHLPDSKRD 147
            G I  FLQYQ+ L  +DLSHNNL G    WLL+NNT+LE L L NN L G+L        
Sbjct: 453  GDIPDFLQYQFKLEVVDLSHNNLTGRFTNWLLENNTRLEFLVLRNNSLMGQLLPLRPNTR 512

Query: 148  LLHLVISNNNFIGTLPDNFGVILPELVYLDMSQNSFVGSIPPSTGYMERLLFLDLSSNNF 207
            +L L IS+N   G L +N G ++P +V+L++S N F G +P S   M  L  LDLS+NNF
Sbjct: 513  ILSLDISHNQLDGRLQENVGHMIPNIVFLNLSNNGFEGLLPSSIAEMSSLRVLDLSANNF 572

Query: 208  SGELPKQFLTGCVSLEFMNLSHNLFVGQIFPKYMNLTQLAWLYLSDNQFTGRLEEGLLNA 267
            SGE+PKQ L     L  + LS+N F G+IF +  N+T L  LYL +NQF G L   +  +
Sbjct: 573  SGEVPKQLL-ATKDLVILKLSYNKFHGEIFSRDFNMTGLDILYLDNNQFMGTLSNVISGS 631

Query: 268  PSLYILDVSNNMLSGQLPHWAGNFSNLDVLLMSRNSLEGDVSVPLSNLQVTRILDISGNK 327
              L +LDVSNN +SG++P   GN + L  L+M  N+  G +   +S LQ  + LD+S N 
Sbjct: 632  SQLMVLDVSNNYMSGEIPSGIGNMTELRTLVMGNNNFRGKLPPEISQLQQMKFLDVSQNA 691

Query: 328  LYGPLEFSSNHSSLRHLFLHNNSLNGNIPHLINEDSNLRALLLRGNNLQGNIPEP----- 382
            L G L    +   L HL L  N   G IP      S+L  L +R N L G+IP       
Sbjct: 692  LSGSLPSLKSMEYLEHLHLQGNMFTGLIPRDFLNSSDLLTLDMRDNRLFGSIPNSISALL 751

Query: 383  -------------------LCHLRKLSIVDISCNNLNGSIPSCFTNISL--WMEESDSFN 421
                               LCHL K+S++D+S N+ +G IP CF +I      +E+D F 
Sbjct: 752  ELRILLLRGNLFSGFIPNHLCHLTKISLMDLSNNSFSGPIPKCFGDIRFGEMKKENDVFR 811

Query: 422  GFV----------IWHGILLDASGRRLSRIKSTSRNKFMAKNRYESYKGDVLNYMTGLDL 471
             F+          ++ G  +             +  +F+ KNR++SY GD+LN+M GLDL
Sbjct: 812  QFIDFGYGGDSRNLYVGFTVKKWEFDSDVYDEKNEVEFVTKNRHDSYSGDILNFMFGLDL 871

Query: 472  SSNELTGDIPSEIGLLQELHALNLSHNHFSGSIPRSFSILKMIESMDLSYNELSGRIPLE 531
            S N LTG+IP ++G L  +HALNLSHN    SIP+SFS L  IES+DLSYN+LSG IPLE
Sbjct: 872  SCNNLTGEIPHKLGKLSWIHALNLSHNQLKDSIPKSFSNLSQIESLDLSYNKLSGEIPLE 931

Query: 532  LSELNYLAIFNVSYNDLLGPVPNSR-QFANFDENNYRGNPLLCGPPVLKNCSSDLPPPLP 590
            L ELN+L +F+V+YN++ G VP+++ QF  FDE +Y GNP LCG  + + C++ + PP  
Sbjct: 932  LVELNFLEVFSVAYNNISGRVPDTKAQFGTFDERSYEGNPFLCGTLLKRKCNTSIEPPCA 991

Query: 591  TTPAEEDEPA---IDKVAFNWSFAASYVAVILGLMAILLLNSYWRRQWFLLVDACIDSSC 647
             + + E E     I+ V F  SF  SY+ ++LG + IL +N YWR +WF  ++ CI  SC
Sbjct: 992  PSQSFESEAKWYDINHVVFFASFTTSYIMILLGFVTILYINPYWRHRWFNFIEECI-YSC 1050

Query: 648  FYFLY 652
            +YF++
Sbjct: 1051 YYFVF 1055

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|358345471|ref|XP_003636801.1| Receptor kinase [Medicago truncatula] gi|355502736|gb|AES83939.1| Receptor kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|357468861|ref|XP_003604715.1| Receptor-like protein kinase [Medicago truncatula] gi|355505770|gb|AES86912.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|358345693|ref|XP_003636910.1| Receptor-like protein kinase [Medicago truncatula] gi|355502845|gb|AES84048.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|297842171|ref|XP_002888967.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297334808|gb|EFH65226.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|359482745|ref|XP_003632825.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483163|ref|XP_002263908.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|186495296|ref|NP_177557.2| receptor like protein 13 [Arabidopsis thaliana] gi|332197441|gb|AEE35562.1| receptor like protein 13 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|12323814|gb|AAG51873.1|AC079678_3 disease resistance protein, putative; 11609-15699 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|359482735|ref|XP_003632821.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query659
TAIR|locus:2155909908 RLP56 "AT5G49290" [Arabidopsis 0.952 0.691 0.389 1e-107
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.807 0.568 0.388 6.8e-79
TAIR|locus:20373131000 RLP13 "AT1G74170" [Arabidopsis 0.851 0.561 0.339 8.1e-76
TAIR|locus:2037308976 RLP14 "AT1G74180" [Arabidopsis 0.954 0.644 0.329 2.8e-73
TAIR|locus:2101943891 RLP45 "AT3G53240" [Arabidopsis 0.827 0.611 0.352 1.1e-71
TAIR|locus:2019662965 RLP15 "AT1G74190" [Arabidopsis 0.869 0.593 0.328 5.5e-70
TAIR|locus:20250121083 RLP1 "AT1G07390" [Arabidopsis 0.843 0.513 0.323 2.3e-65
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.854 0.495 0.314 1.5e-56
TAIR|locus:2137296811 RLP46 "receptor like protein 4 0.933 0.758 0.311 4.2e-56
TAIR|locus:2090754711 RLP43 "receptor like protein 4 0.860 0.797 0.303 2.6e-54
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1065 (380.0 bits), Expect = 1.0e-107, P = 1.0e-107
 Identities = 263/676 (38%), Positives = 355/676 (52%)

Query:     4 LKNLVELNLSGNKFDGSLPQCLSNLTYLRVXXXXXXXXXXXXPISVFANLTSLEYLSLSD 63
             L  L  L+LS N+  G++P   S+L  L               ++   NLT L+    S 
Sbjct:   243 LNKLRFLDLSSNQLTGNIPPSFSSLESLEYLSLSDNSFEGFFSLNPLTNLTKLKVFIFSS 302

Query:    64 KK----------FQGSFSLSVLANHSRLEHCNISGTIASFLQYQYDLRYIDLSHNNLAGT 113
             K           +Q  F LSVL     L  C++   I +FL YQ +L  +DLS N ++G 
Sbjct:   303 KDDMVQVKIESTWQPLFQLSVLV----LRLCSLE-KIPNFLMYQKNLHVVDLSGNRISGI 357

Query:   114 IPTWLLQNNTKLEILFLFNNFLTGRLHLPDSKRDLLHLVISNNNFIGTLPDNFGVILPEL 173
             IPTWLL+NN +LE+L L NN  T    +P S  +L  L  S NN  G  PDNFG +LP L
Sbjct:   358 IPTWLLENNPELEVLQLKNNSFT-IFQMPTSVHNLQVLDFSENNIGGLFPDNFGRVLPNL 416

Query:   174 VYLDMSQNSFVGSIPPSTGYMERXXXXXXXXXXXXGELPKQFLTGCVSLEFMNLSHNLFV 233
             V+++ S N F G+ P S G M              GELP+ F++ C SL  + LSHN F 
Sbjct:   417 VHMNGSNNGFQGNFPSSMGEMYNISFLDLSYNNLSGELPQSFVSSCFSLSILQLSHNKFS 476

Query:   234 GQIFPKYMNLTQLAWLYLSDNQFTGRLEEGLLNAPSLYILDVSNNMLSGQLPHWAGNFSN 293
             G   P+  N T L  L +++N FTG++  GLL    L ILD+SNN L G+LP     F  
Sbjct:   477 GHFLPRQTNFTSLIVLRINNNLFTGKIGVGLLTLVDLCILDMSNNFLEGELPPLLLVFEY 536

Query:   294 LDVLLMSRNSLEGDVSVPLSNLQVTRILDISGNKLYGPLEFSSNHSSLRHLFLHNNSLNG 353
             L+ L +S N L G  ++P S++ +  +L +  N   GP+   +   S++ L L NN L+G
Sbjct:   537 LNFLDLSGNLLSG--ALP-SHVSLDNVLFLHNNNFTGPIP-DTFLGSIQILDLRNNKLSG 592

Query:   354 NIPHLINEDSXXXXXXXXXXXXXXXIPEPLCHLRKLSIVDISCNNLNGSIPSCFTNISLW 413
             NIP  ++                  IP  LC   K+ ++D+S N LNG IPSCF N+S  
Sbjct:   593 NIPQFVDTQDISFLLLRGNSLTGY-IPSTLCEFSKMRLLDLSDNKLNGFIPSCFNNLSFG 651

Query:   414 MEESDSFNGFVIWHGILLDASGRRLSRIKSTS--RN-------------KFMAKNRYESY 458
             +   +    + +   + L++    L   KST    N             KF  K RY+SY
Sbjct:   652 LARKEEITNYYV--AVALESF--YLGFYKSTFVVENFRLDYSNYFEIDVKFATKQRYDSY 707

Query:   459 KG------DVLNYMTGLDLSSNELTGDIPSEIGLLQELHALNLSHNHFSGSIPRSFSILK 512
              G        LN M GLDLSSNEL+G IP+E+G L +L ALNLSHN  S  IP SFS L+
Sbjct:   708 IGAFQFSEGTLNSMYGLDLSSNELSGVIPAELGDLFKLRALNLSHNFLSSHIPDSFSKLQ 767

Query:   513 MIESMDLSYNELSGRIPLELSELNYLAIFNVSYNDLLGPVPNSRQFANFDENNYRGNPLL 572
              IES+DLSYN L G IP +L+ L  LAIFNVSYN+L G +P  +QF  FDEN+Y GNPLL
Sbjct:   768 DIESLDLSYNMLQGSIPHQLTNLTSLAIFNVSYNNLSGIIPQGKQFNTFDENSYLGNPLL 827

Query:   573 CGPPVLKNCSSXXXXXXXXXXXXXXXX--XIDKVAFNWSFAASYVAVILGLMAILLLNSY 630
             CGPP   +C +                   ID + F WS A +YV  ++G++ ++ ++  
Sbjct:   828 CGPPTDTSCETKKNSEENANGGEEDDKEVAIDMLVFYWSTAGTYVTALIGILVLMCVDCS 887

Query:   631 WRRQWFLLVDACIDSS 646
             WRR W  LVDA I S+
Sbjct:   888 WRRAWLRLVDAFIASA 903
GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137296 RLP46 "receptor like protein 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090754 RLP43 "receptor like protein 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00008153001
SubName- Full=Chromosome undetermined scaffold_1263, whole genome shotgun sequence; (794 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query659
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-73
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-44
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-37
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-33
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-20
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-18
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  255 bits (653), Expect = 1e-73
 Identities = 196/588 (33%), Positives = 291/588 (49%), Gaps = 47/588 (7%)

Query: 7   LVELNLSGNKFDGSLPQCLSNLTYLRVLNLSSNQLSGSLPISVFANLTSLEYLSLSDKKF 66
           +V ++LSG    G +   +  L Y++ +NLS+NQLSG +P  +F   +SL YL+LS+  F
Sbjct: 71  VVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNF 130

Query: 67  QGSFSLSVLANHSRLEHCN--ISGTIASFLQYQYDLRYIDLSHNNLAGTIPTWLLQNNTK 124
            GS     + N   L+  N  +SG I + +     L+ +DL  N L G IP  L  N T 
Sbjct: 131 TGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSL-TNLTS 189

Query: 125 LEILFLFNNFLTGRL-HLPDSKRDLLHLVISNNNFIGTLPDNFGVILPELVYLDMSQNSF 183
           LE L L +N L G++       + L  + +  NN  G +P   G  L  L +LD+  N+ 
Sbjct: 190 LEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGG-LTSLNHLDLVYNNL 248

Query: 184 VGSIPPSTGYMERLLFLDLSSNNFSGELPKQF--LTGCVSLEFMNLSHNLFVGQIFPKYM 241
            G IP S G ++ L +L L  N  SG +P     L   +SL+    S N   G+I    +
Sbjct: 249 TGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDL---SDNSLSGEIPELVI 305

Query: 242 NLTQLAWLYLSDNQFTGRLEEGLLNAPSLYILDVSNNMLSGQLPHWAGNFSNLDVLLMSR 301
            L  L  L+L  N FTG++   L + P L +L + +N  SG++P   G  +NL VL +S 
Sbjct: 306 QLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLST 365

Query: 302 NSLEGDVSVPLSNLQVTRILDISGNKLYGPLEFSSNHSSLRHLFLHNNSLNGNIPHLINE 361
           N+L G++   L +         SGN              L  L L +NSL G IP  +  
Sbjct: 366 NNLTGEIPEGLCS---------SGN--------------LFKLILFSNSLEGEIPKSLGA 402

Query: 362 DSNLRALLLRGNNLQGNIPEPLCHLRKLSIVDISCNNLNGSIPSCFTNISLWMEESDSFN 421
             +LR + L+ N+  G +P     L  +  +DIS NNL G I S   ++      S + N
Sbjct: 403 CRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARN 462

Query: 422 GFVIWHGILLDASGRRLSRIKSTSRNKF--MAKNRYESYKGDVLNYMTGLDLSSNELTGD 479
            F    G L D+ G +       SRN+F      +  S     L+ +  L LS N+L+G+
Sbjct: 463 KFF---GGLPDSFGSKRLENLDLSRNQFSGAVPRKLGS-----LSELMQLKLSENKLSGE 514

Query: 480 IPSEIGLLQELHALNLSHNHFSGSIPRSFSILKMIESMDLSYNELSGRIPLELSELNYLA 539
           IP E+   ++L +L+LSHN  SG IP SFS + ++  +DLS N+LSG IP  L  +  L 
Sbjct: 515 IPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLV 574

Query: 540 IFNVSYNDLLGPVPNSRQFANFDENNYRGNPLLCGPPVLKNCSSDLPP 587
             N+S+N L G +P++  F   + +   GN  LCG     + +S LPP
Sbjct: 575 QVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCG----GDTTSGLPP 618

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 659
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 100.0
KOG4237498 consensus Extracellular matrix protein slit, conta 99.92
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
PLN032101153 Resistant to P. syringae 6; Provisional 99.92
KOG4237498 consensus Extracellular matrix protein slit, conta 99.91
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.88
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.82
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.82
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.76
KOG0617264 consensus Ras suppressor protein (contains leucine 99.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
KOG0617264 consensus Ras suppressor protein (contains leucine 99.69
PLN03150623 hypothetical protein; Provisional 99.6
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.34
PLN03150623 hypothetical protein; Provisional 99.31
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.3
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.28
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.25
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.22
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.21
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.19
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.18
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.16
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.13
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.1
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.07
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.94
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.93
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.93
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.91
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.9
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.87
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.67
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.61
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.48
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.47
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.43
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.3
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.28
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.27
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.12
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.04
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.03
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.01
PRK15386426 type III secretion protein GogB; Provisional 97.95
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.93
PRK15386 426 type III secretion protein GogB; Provisional 97.8
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.77
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.71
KOG4341483 consensus F-box protein containing LRR [General fu 97.64
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.63
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.63
KOG4341483 consensus F-box protein containing LRR [General fu 97.59
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.49
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.1
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.04
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.61
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.58
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.52
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.47
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.36
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.35
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.64
smart0037026 LRR Leucine-rich repeats, outliers. 93.51
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.51
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.48
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.76
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.59
smart0037026 LRR Leucine-rich repeats, outliers. 91.36
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.36
KOG4308478 consensus LRR-containing protein [Function unknown 90.87
KOG4308478 consensus LRR-containing protein [Function unknown 90.84
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.66
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.76
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 87.45
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.1e-61  Score=564.97  Aligned_cols=540  Identities=33%  Similarity=0.495  Sum_probs=477.8

Q ss_pred             CCCCCEEeCCCCcCcccCCccccCCCCCCEEECCCCCCcCCCChhhhcCCCCCCEEEccCcccccccChhhhccCCC--C
Q 042632            4 LKNLVELNLSGNKFDGSLPQCLSNLTYLRVLNLSSNQLSGSLPISVFANLTSLEYLSLSDKKFQGSFSLSVLANHSR--L   81 (659)
Q Consensus         4 l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~l~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~--L   81 (659)
                      ..+++.|+|++|.+++..+.+|..+++|++|+|++|++.+.+|...+..+++|++|++++|.+++..+...+.++..  |
T Consensus        68 ~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~L  147 (968)
T PLN00113         68 SSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDL  147 (968)
T ss_pred             CCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCccccCCCCEEEC
Confidence            35789999999999999999999999999999999999989997777799999999999999998877655555544  4


Q ss_pred             ccccccccchhhhhCCCCCCEEEccCccccccCchHHhhcCCCCCEEEccCcccccc-cCCCCCCCCccEEEcccCcCcc
Q 042632           82 EHCNISGTIASFLQYQYDLRYIDLSHNNLAGTIPTWLLQNNTKLEILFLFNNFLTGR-LHLPDSKRDLLHLVISNNNFIG  160 (659)
Q Consensus        82 ~~~~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~L~~n~i~~~-~~~~~~~~~L~~L~l~~n~l~~  160 (659)
                      ++|.+++..|..++++++|++|++++|.+.+.+|..+. ++++|++|++++|.+++. +.....+++|++|++++|++.+
T Consensus       148 s~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~-~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~  226 (968)
T PLN00113        148 SNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLT-NLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSG  226 (968)
T ss_pred             cCCcccccCChHHhcCCCCCEEECccCcccccCChhhh-hCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCC
Confidence            48889888999999999999999999999888888765 899999999999998764 2333478999999999999998


Q ss_pred             cCChhhhhcCCCCcEEEcccCcccccCChhhcCCCCCCEEeCcCCcCccccChhhhhCCCCCCEEEccCccccccCCcCC
Q 042632          161 TLPDNFGVILPELVYLDMSQNSFVGSIPPSTGYMERLLFLDLSSNNFSGELPKQFLTGCVSLEFMNLSHNLFVGQIFPKY  240 (659)
Q Consensus       161 ~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~l~~n~i~~~~~~~~  240 (659)
                      .+|..+.. +++|++|++++|.+.+..|..++.+++|++|++++|.+.+.+|..+ ..+++|++|++++|.+.+..|..+
T Consensus       227 ~~p~~l~~-l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l-~~l~~L~~L~Ls~n~l~~~~p~~~  304 (968)
T PLN00113        227 EIPYEIGG-LTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSI-FSLQKLISLDLSDNSLSGEIPELV  304 (968)
T ss_pred             cCChhHhc-CCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhH-hhccCcCEEECcCCeeccCCChhH
Confidence            99998875 9999999999999998999999999999999999999987888775 688999999999999998889889


Q ss_pred             CCCCCCCEEEccCCCCCccccccccCCCCCcEEEeecccccCCCChhhhCCCCCCEEEccCCcccccCCccCCCCCCCcE
Q 042632          241 MNLTQLAWLYLSDNQFTGRLEEGLLNAPSLYILDVSNNMLSGQLPHWAGNFSNLDVLLMSRNSLEGDVSVPLSNLQVTRI  320 (659)
Q Consensus       241 ~~l~~L~~L~l~~n~i~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~  320 (659)
                      .++++|++|++++|.+.+..|..+..+++|+.|++++|.+.+..|..++.+++|+.|++++|++.+..|..+..+++|+.
T Consensus       305 ~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~  384 (968)
T PLN00113        305 IQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFK  384 (968)
T ss_pred             cCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCE
Confidence            99999999999999999999999999999999999999999899999999999999999999999889999999999999


Q ss_pred             EEccCCcCcCcCCCCC-CCCCCcEEEccCCcCCCCCchhhhcCCCCceEecCCCcccccCCccccCCCCCcEEEccCCcC
Q 042632          321 LDISGNKLYGPLEFSS-NHSSLRHLFLHNNSLNGNIPHLINEDSNLRALLLRGNNLQGNIPEPLCHLRKLSIVDISCNNL  399 (659)
Q Consensus       321 L~l~~n~l~~~~~~~~-~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l  399 (659)
                      |++++|.+.+..+... .+++|+.|++++|++++..|..+..+++|+.|++++|.+++.++..+..+++|+.|++++|++
T Consensus       385 L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~  464 (968)
T PLN00113        385 LILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKF  464 (968)
T ss_pred             EECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCcee
Confidence            9999999987766544 789999999999999999999999999999999999999998888888999999999999999


Q ss_pred             CcccchhhccccccccccCCCCCceeeccccccccCCcccccccccceEeeeccccccccccccccccEEEccCCcCccc
Q 042632          400 NGSIPSCFTNISLWMEESDSFNGFVIWHGILLDASGRRLSRIKSTSRNKFMAKNRYESYKGDVLNYMTGLDLSSNELTGD  479 (659)
Q Consensus       400 ~~~~p~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~  479 (659)
                      .+.+|..+.. ..               ...++.+++++.....              .....+++|+.|+|++|++++.
T Consensus       465 ~~~~p~~~~~-~~---------------L~~L~ls~n~l~~~~~--------------~~~~~l~~L~~L~Ls~N~l~~~  514 (968)
T PLN00113        465 FGGLPDSFGS-KR---------------LENLDLSRNQFSGAVP--------------RKLGSLSELMQLKLSENKLSGE  514 (968)
T ss_pred             eeecCccccc-cc---------------ceEEECcCCccCCccC--------------hhhhhhhccCEEECcCCcceee
Confidence            9888875532 11               1122333333221100              0012377899999999999999


Q ss_pred             CChhhhccccCCEEeCCCCcCcccCCccccccCCCCEEECcCCcccccCChhhhcCCCCCeEeccCCccccCCCCCCCCC
Q 042632          480 IPSEIGLLQELHALNLSHNHFSGSIPRSFSILKMIESMDLSYNELSGRIPLELSELNYLAIFNVSYNDLLGPVPNSRQFA  559 (659)
Q Consensus       480 ~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~l~~N~l~~~~p~~~~~~  559 (659)
                      +|+.++.+++|++|+|++|.+++.+|..|..+++|+.|+|++|++++.+|..+..+++|+.+++++|+++|.+|...++.
T Consensus       515 ~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~  594 (968)
T PLN00113        515 IPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFL  594 (968)
T ss_pred             CChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcCccCCCCCCCCCC
Q 042632          560 NFDENNYRGNPLLCGPP  576 (659)
Q Consensus       560 ~l~~~~~~~N~~~c~~~  576 (659)
                      ++....+.|||.+|+.+
T Consensus       595 ~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        595 AINASAVAGNIDLCGGD  611 (968)
T ss_pred             ccChhhhcCCccccCCc
Confidence            99999999999999854

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query659
3rgx_A768 Structural Insight Into Brassinosteroid Perception 9e-46
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-45
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-13
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 6e-10
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score =  181 bits (460), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 171/571 (29%), Positives = 251/571 (43%), Gaps = 54/571 (9%)
Query: 56  LEYLSLSDKKFQGSFSLSVLANHSRLEHCNISG----TIASFLQYQYDLRYIDLSHNNLA 111
           L++L++S  K  G   +S   N   LE  ++S     T   FL     L+++D+S N L+
Sbjct: 180 LKHLAISGNKISGDVDVSRCVN---LEFLDVSSNNFSTGIPFLGDCSALQHLDISGNKLS 236
Query: 112 GTIPTWLLQNNTKLEILFLFNNFLTGRLHLPDSKRDLLHLVISNNNFIGTLPDNFGVILP 171
           G   +  +   T+L++L + +N   G +  P   + L +L ++ N F G +PD       
Sbjct: 237 GDF-SRAISTCTELKLLNISSNQFVGPIP-PLPLKSLQYLSLAENKFTGEIPDFLSGACD 294
Query: 172 ELVYLDMSQNSFVGSIPPSTGYMERXXXXXXXXXXXXGELPKQFLTGCVSLEFMNLSHNL 231
            L  LD+S N F G++PP  G                GELP   L     L+ ++LS N 
Sbjct: 295 TLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNE 354
Query: 232 FVGQIFPKYMNLTQ---------------------------LAWLYLSDNQFTGRLEEGL 264
           F G++     NL+                            L  LYL +N FTG++   L
Sbjct: 355 FSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTL 414
Query: 265 LNAPSLYILDVSNNMLSGQLPHWAGNFSNLDVLLMSRNSLEGDVSVPLSNLQVTRILDIS 324
            N   L  L +S N LSG +P   G+ S L  L +  N LEG++   L  ++    L + 
Sbjct: 415 SNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILD 474
Query: 325 GNKLYGPLEFS-SNHSSLRHLFLHNNSLNGNIPHLINEDSXXXXXXXXXXXXXXXIPEPL 383
            N L G +    SN ++L  + L NN L G IP  I                   IP  L
Sbjct: 475 FNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAEL 534
Query: 384 CHLRKLSIVDISCNNLNGSIPSCFTNISLWME------------ESDSFNGFVIWHGILL 431
              R L  +D++ N  NG+IP+     S  +             ++D         G LL
Sbjct: 535 GDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLL 594
Query: 432 DASGRRLSRI-KSTSRNKFMAKNR----YESYKGDVLNYMTGLDLSSNELTGDIPSEIGL 486
           +  G R  ++ + ++RN     +R    + S   D    M  LD+S N L+G IP EIG 
Sbjct: 595 EFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGS 654
Query: 487 LQELHALNLSHNHFSGSIPRSFSILKMIESMDLSYNELSGRIPLELSELNYLAIFNVSYN 546
           +  L  LNL HN  SGSIP     L+ +  +DLS N+L GRIP  +S L  L   ++S N
Sbjct: 655 MPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNN 714
Query: 547 DLLGPVPNSRQFANFDENNYRGNPLLCGPPV 577
           +L GP+P   QF  F    +  NP LCG P+
Sbjct: 715 NLSGPIPEMGQFETFPPAKFLNNPGLCGYPL 745
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query659
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-144
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-109
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-58
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-33
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-30
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-74
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-56
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-40
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-34
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-32
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-64
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-56
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-50
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-45
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-62
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-58
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-45
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-20
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-59
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-54
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-48
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-33
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-58
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-45
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-42
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-31
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-31
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-30
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-55
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-50
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-18
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-53
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-44
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-41
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-28
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-25
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-46
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-20
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-41
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-26
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-35
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-29
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-24
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-23
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-35
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-32
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-09
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-22
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-31
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-30
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-11
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-24
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-28
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-16
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-15
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-27
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-05
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-24
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-24
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-22
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-22
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-07
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-18
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-17
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-07
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-17
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 9e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 9e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 7e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  437 bits (1126), Expect = e-144
 Identities = 176/610 (28%), Positives = 249/610 (40%), Gaps = 74/610 (12%)

Query: 1   ICELKNLVELNLSGNKFDGSLPQCLSNLTYLRVLNLSSNQLSGSLPISVFANLTSLEYLS 60
           + +   L  L++SGNK  G   + +S  T L++LN+SSNQ  G +P      L SL+YLS
Sbjct: 219 LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL---PLKSLQYLS 275

Query: 61  LSDKKFQGSFSLSVLANHSRLEH-----CNISGTIASFLQYQYDLRYIDLSHNNLAGTIP 115
           L++ KF G     +      L        +  G +  F      L  + LS NN +G +P
Sbjct: 276 LAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELP 335

Query: 116 TWLLQNNTKLEILFLFNNFLTGRL--HLPDSKRDLLHLVISNNNFIGTLPDNFG-VILPE 172
              L     L++L L  N  +G L   L +    LL L +S+NNF G +  N        
Sbjct: 336 MDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNT 395

Query: 173 LVYLDMSQNSFVGSIPPSTGYMERLLFLDLSSNNFSGELPKQFLTGCVSLEFMNLSHNLF 232
           L  L +  N F G IPP+      L+ L LS N  SG +P   L     L  + L  N+ 
Sbjct: 396 LQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP-SSLGSLSKLRDLKLWLNML 454

Query: 233 VGQIFPKYMNLTQLAWLYLSDNQFTGRLEEGLLNAPSLYILDVSNNMLSGQLPHWAGNFS 292
            G+I  + M +  L  L L  N  TG +  GL N  +L  + +SNN L+G++P W G   
Sbjct: 455 EGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLE 514

Query: 293 NLDVLLMSRNSLEGDVSVPLSNLQVTRILDISGNKLYG--PLEFSSNHSSLRHLFLHNNS 350
           NL +L +S NS  G++   L + +    LD++ N   G  P         +       N 
Sbjct: 515 NLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIA-----ANF 569

Query: 351 LNGNIPHLINEDSNLRALLLRGN--NLQGNIPEPLCHLRKLSIVDISCNNLNGSIPSCFT 408
           + G     I  D   +     GN    QG   E L  L   +  +I+     G     F 
Sbjct: 570 IAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFD 629

Query: 409 NISLWMEESDSFNGFVIWHGILLDASGRRLSRIKSTSRNKFMAKNRYESYKGDVLNYMTG 468
           N                                                        M  
Sbjct: 630 N-----------------------------------------------------NGSMMF 636

Query: 469 LDLSSNELTGDIPSEIGLLQELHALNLSHNHFSGSIPRSFSILKMIESMDLSYNELSGRI 528
           LD+S N L+G IP EIG +  L  LNL HN  SGSIP     L+ +  +DLS N+L GRI
Sbjct: 637 LDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRI 696

Query: 529 PLELSELNYLAIFNVSYNDLLGPVPNSRQFANFDENNYRGNPLLCGPPVLKNCSSDLPPP 588
           P  +S L  L   ++S N+L GP+P   QF  F    +  NP LCG P+ +   S+    
Sbjct: 697 PQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGY 756

Query: 589 LPTTPAEEDE 598
                +    
Sbjct: 757 AHHQRSHHHH 766
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query659
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.81
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.81
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.8
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.74
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.72
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.71
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.68
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.68
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.67
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.67
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.65
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.64
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.63
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.59
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.58
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.57
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.57
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.53
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.52
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.49
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.48
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.46
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.45
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.41
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.32
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.3
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.29
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.18
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.18
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.18
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.92
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.89
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.56
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.52
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.46
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.35
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.15
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.81
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.32
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.31
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.08
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=3.6e-69  Score=611.03  Aligned_cols=580  Identities=34%  Similarity=0.456  Sum_probs=396.7

Q ss_pred             CCCCCCCCEEeCCCCcCcccCCc--cccCCCCCCEEECCCCCCcCCCChhhhcCCCCCCEEEccCcccccccChhh--hc
Q 042632            1 ICELKNLVELNLSGNKFDGSLPQ--CLSNLTYLRVLNLSSNQLSGSLPISVFANLTSLEYLSLSDKKFQGSFSLSV--LA   76 (659)
Q Consensus         1 i~~l~~L~~L~Ls~n~l~~~~~~--~~~~l~~L~~L~Ls~n~l~~~l~~~~~~~l~~L~~L~L~~n~l~~~~~~~~--~~   76 (659)
                      |+++++|++|||++|.+++.+|.  .++++++|++|+|++|.+.+.+|...+.++++|++|++++|.+++..+...  +.
T Consensus        96 ~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~  175 (768)
T 3rgz_A           96 FKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSD  175 (768)
T ss_dssp             CCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTT
T ss_pred             hccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhc
Confidence            45778888888888888877777  788888888888888888766663333667777777777776665443221  11


Q ss_pred             ----------------------cCCC-----CccccccccchhhhhCCCCCCEEEccCccccccCchHHhhcCCCCCEEE
Q 042632           77 ----------------------NHSR-----LEHCNISGTIASFLQYQYDLRYIDLSHNNLAGTIPTWLLQNNTKLEILF  129 (659)
Q Consensus        77 ----------------------~l~~-----L~~~~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~  129 (659)
                                            ++.+     |++|++++.+|. ++++++|++|++++|.+++.+|..+ ..+++|++|+
T Consensus       176 ~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l-~~l~~L~~L~  253 (768)
T 3rgz_A          176 GCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAI-STCTELKLLN  253 (768)
T ss_dssp             CCTTCCEEECCSSEEESCCBCTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHT-TTCSSCCEEE
T ss_pred             cCCCCCEEECCCCcccccCCcccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHH-hcCCCCCEEE
Confidence                                  2222     236777776666 8888888889988888886667665 4888899999


Q ss_pred             ccCcccccccCCCCCCCCccEEEcccCcCcccCChhhhhcCCCCcEEEcccCcccccCChhhcCCCCCCEEeCcCCcCcc
Q 042632          130 LFNNFLTGRLHLPDSKRDLLHLVISNNNFIGTLPDNFGVILPELVYLDMSQNSFVGSIPPSTGYMERLLFLDLSSNNFSG  209 (659)
Q Consensus       130 L~~n~i~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~L~~n~l~~  209 (659)
                      +++|.+++..+.. .+++|++|++++|.+++.+|..++..+++|++|++++|.+++..|..++.+++|++|++++|.+.+
T Consensus       254 Ls~n~l~~~~~~~-~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~  332 (768)
T 3rgz_A          254 ISSNQFVGPIPPL-PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSG  332 (768)
T ss_dssp             CCSSCCEESCCCC-CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEE
T ss_pred             CCCCcccCccCcc-ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccC
Confidence            9888887654333 678888888888888888888777655888888888888887888888888888888888888877


Q ss_pred             ccChhhhhCCCCCCEEEccCccccccCCcCCCCCC-CCCEEEccCC--------------------------CCCccccc
Q 042632          210 ELPKQFLTGCVSLEFMNLSHNLFVGQIFPKYMNLT-QLAWLYLSDN--------------------------QFTGRLEE  262 (659)
Q Consensus       210 ~~~~~~~~~l~~L~~L~l~~n~i~~~~~~~~~~l~-~L~~L~l~~n--------------------------~i~~~~~~  262 (659)
                      .+|...+..+++|++|++++|++.+..|..+.+++ +|++|++++|                          .+++..|.
T Consensus       333 ~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~  412 (768)
T 3rgz_A          333 ELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPP  412 (768)
T ss_dssp             ECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCG
T ss_pred             cCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCH
Confidence            78877667788888888888877766666555444 4555555544                          44444555


Q ss_pred             cccCCCCCcEEEeecccccCCCChhhhCCCCCCEEEccCCcccccCCccCCCCCCCcEEEccCCcCcCcCCCCC-CCCCC
Q 042632          263 GLLNAPSLYILDVSNNMLSGQLPHWAGNFSNLDVLLMSRNSLEGDVSVPLSNLQVTRILDISGNKLYGPLEFSS-NHSSL  341 (659)
Q Consensus       263 ~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~-~~~~L  341 (659)
                      .+..+++|++|++++|.+++..|..++.+++|++|++++|.+.+..|..+..+++|++|++++|.+++..+... .+++|
T Consensus       413 ~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L  492 (768)
T 3rgz_A          413 TLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNL  492 (768)
T ss_dssp             GGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTC
T ss_pred             HHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCC
Confidence            55555555555555555555555555555555555555555555555555555556666666665555444332 55566


Q ss_pred             cEEEccCCcCCCCCchhhhcCCCCceEecCCCcccccCCccccCCCCCcEEEccCCcCCcccchhhccccccccccCCCC
Q 042632          342 RHLFLHNNSLNGNIPHLINEDSNLRALLLRGNNLQGNIPEPLCHLRKLSIVDISCNNLNGSIPSCFTNISLWMEESDSFN  421 (659)
Q Consensus       342 ~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~~~~~~~~~~  421 (659)
                      ++|++++|++++.+|.+++.+++|++|++++|++++.+|..+..+++|+.|++++|+++|.+|..+..............
T Consensus       493 ~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~  572 (768)
T 3rgz_A          493 NWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAG  572 (768)
T ss_dssp             CEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCS
T ss_pred             CEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcccc
Confidence            66666666665555666666666666666666665556666666666666666666666666655544332211110000


Q ss_pred             -Cceeec-----------cccccccCC---cccccccccceEeeeccccc---cccccccccccEEEccCCcCcccCChh
Q 042632          422 -GFVIWH-----------GILLDASGR---RLSRIKSTSRNKFMAKNRYE---SYKGDVLNYMTGLDLSSNELTGDIPSE  483 (659)
Q Consensus       422 -~~~~~~-----------~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~---~~~~~~l~~L~~L~Ls~n~l~~~~p~~  483 (659)
                       ......           ...+...+.   .+..+...... ....+.+.   ......+++|+.|||++|+++|.+|..
T Consensus       573 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~-~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~  651 (768)
T 3rgz_A          573 KRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPC-NITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKE  651 (768)
T ss_dssp             CEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCS-CTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGG
T ss_pred             ccccccccccccccccccccccccccccchhhhcccccccc-ccccceecccCchhhhccccccEEECcCCcccccCCHH
Confidence             000000           000000000   00000000000 00000000   011234788999999999999999999


Q ss_pred             hhccccCCEEeCCCCcCcccCCccccccCCCCEEECcCCcccccCChhhhcCCCCCeEeccCCccccCCCCCCCCCCCCc
Q 042632          484 IGLLQELHALNLSHNHFSGSIPRSFSILKMIESMDLSYNELSGRIPLELSELNYLAIFNVSYNDLLGPVPNSRQFANFDE  563 (659)
Q Consensus       484 l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~l~~N~l~~~~p~~~~~~~l~~  563 (659)
                      ++.+++|+.|+|++|+++|.+|..|+.+++|++|||++|+++|.+|..+..+++|++|++++|+++|.+|...+++++..
T Consensus       652 l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~  731 (768)
T 3rgz_A          652 IGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPP  731 (768)
T ss_dssp             GGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCG
T ss_pred             HhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccCCCCCCCCCCCCCCCCCCC
Q 042632          564 NNYRGNPLLCGPPVLKNCSSDL  585 (659)
Q Consensus       564 ~~~~~N~~~c~~~~~~~C~~~~  585 (659)
                      .+|.|||++||+|.. .|+...
T Consensus       732 ~~~~gN~~Lcg~~l~-~C~~~~  752 (768)
T 3rgz_A          732 AKFLNNPGLCGYPLP-RCDPSN  752 (768)
T ss_dssp             GGGCSCTEEESTTSC-CCCSCC
T ss_pred             HHhcCCchhcCCCCc-CCCCCc
Confidence            999999999999976 897654
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 659
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-20
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-10
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 5e-06
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 1e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 7e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.004
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.001
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 88.7 bits (218), Expect = 8e-20
 Identities = 63/268 (23%), Positives = 106/268 (39%), Gaps = 15/268 (5%)

Query: 321 LDISGNKLYGPLEFSSNHSSLRHLFLHNNSLNGNIPHLINED----SNLRALLLRGNNLQ 376
           LD+SG  L  P    S+ ++L +L         N+   I       + L  L +   N+ 
Sbjct: 55  LDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVS 114

Query: 377 GNIPEPLCHLRKLSIVDISCNNLNGSIPSCFTNISLWMEESDSFNGFVIWHGILLDASGR 436
           G IP+ L  ++ L  +D S N L+G++P   +++   +  +   N      G + D+ G 
Sbjct: 115 GAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRI---SGAIPDSYGS 171

Query: 437 --RLSRIKSTSRNKFMAKNRYESYKGDVLNYMTGLDLSSNELTGDIPSEIGLLQELHALN 494
             +L    + SRN+   K           N        S  +     S +    +     
Sbjct: 172 FSKLFTSMTISRNRLTGKIPPTFA-----NLNLAFVDLSRNMLEGDASVLFGSDKNTQKI 226

Query: 495 LSHNHFSGSIPRSFSILKMIESMDLSYNELSGRIPLELSELNYLAIFNVSYNDLLGPVPN 554
               +          + K +  +DL  N + G +P  L++L +L   NVS+N+L G +P 
Sbjct: 227 HLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ 286

Query: 555 SRQFANFDENNYRGNPLLCGPPVLKNCS 582
                 FD + Y  N  LCG P L  C+
Sbjct: 287 GGNLQRFDVSAYANNKCLCGSP-LPACT 313
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query659
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.84
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.84
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.8
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.8
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.62
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.61
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.55
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.49
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.49
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.43
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.42
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.3
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.27
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.51
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.41
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.87
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.78
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.36
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.19
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.97  E-value=4.3e-31  Score=264.27  Aligned_cols=256  Identities=29%  Similarity=0.497  Sum_probs=195.3

Q ss_pred             CcEEEeecccccC--CCChhhhCCCCCCEEEccC-CcccccCCccCCCCCCCcEEEccCCcCcCcCCCCC-CCCCCcEEE
Q 042632          270 LYILDVSNNMLSG--QLPHWAGNFSNLDVLLMSR-NSLEGDVSVPLSNLQVTRILDISGNKLYGPLEFSS-NHSSLRHLF  345 (659)
Q Consensus       270 L~~L~L~~n~l~~--~~~~~l~~l~~L~~L~l~~-n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~-~~~~L~~L~  345 (659)
                      ++.|+|+++.+.+  .+|..++.+++|++|++++ |++.+.+|..+.++++|++|++++|++.+..+... .+..|+.++
T Consensus        52 v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~  131 (313)
T d1ogqa_          52 VNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLD  131 (313)
T ss_dssp             EEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEE
T ss_pred             EEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccc
Confidence            3344444444333  2344444444444444443 34444444444444444444444444444333322 455666677


Q ss_pred             ccCCcCCCCCchhhhcCCCCceEecCCCcccccCCccccCCCCC-cEEEccCCcCCcccchhhccccccccccCCCCCce
Q 042632          346 LHNNSLNGNIPHLINEDSNLRALLLRGNNLQGNIPEPLCHLRKL-SIVDISCNNLNGSIPSCFTNISLWMEESDSFNGFV  424 (659)
Q Consensus       346 l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L-~~L~Ls~n~l~~~~p~~~~~l~~~~~~~~~~~~~~  424 (659)
                      +++|.+.+.+|..+..+++++++++++|.+.+.+|..+..+..+ +.+++++|++++..|..+.++              
T Consensus       132 l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l--------------  197 (313)
T d1ogqa_         132 FSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANL--------------  197 (313)
T ss_dssp             CCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGC--------------
T ss_pred             cccccccccCchhhccCcccceeecccccccccccccccccccccccccccccccccccccccccc--------------
Confidence            77777777888889999999999999999999999988888776 889999999998888776552              


Q ss_pred             eeccccccccCCcccccccccceEeeeccccccccccccccccEEEccCCcCcccCChhhhccccCCEEeCCCCcCcccC
Q 042632          425 IWHGILLDASGRRLSRIKSTSRNKFMAKNRYESYKGDVLNYMTGLDLSSNELTGDIPSEIGLLQELHALNLSHNHFSGSI  504 (659)
Q Consensus       425 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~  504 (659)
                                                              ....++++++...+.+|..++.+++++.+++++|.+++.+
T Consensus       198 ----------------------------------------~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~  237 (313)
T d1ogqa_         198 ----------------------------------------NLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDL  237 (313)
T ss_dssp             ----------------------------------------CCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBG
T ss_pred             ----------------------------------------cccccccccccccccccccccccccccccccccccccccc
Confidence                                                    2456999999999999999999999999999999999665


Q ss_pred             CccccccCCCCEEECcCCcccccCChhhhcCCCCCeEeccCCccccCCCCCCCCCCCCcCccCCCCCCCCCCCCCCC
Q 042632          505 PRSFSILKMIESMDLSYNELSGRIPLELSELNYLAIFNVSYNDLLGPVPNSRQFANFDENNYRGNPLLCGPPVLKNC  581 (659)
Q Consensus       505 p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~l~~N~l~~~~p~~~~~~~l~~~~~~~N~~~c~~~~~~~C  581 (659)
                      | .++.+++|+.|+|++|+++|.+|+.+.++++|++|+|++|+++|.+|....+++++.+++.||+.+||.|+. .|
T Consensus       238 ~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~~l~g~plp-~c  312 (313)
T d1ogqa_         238 G-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLP-AC  312 (313)
T ss_dssp             G-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSSEEESTTSS-CC
T ss_pred             c-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHHhCCCccccCCCCC-CC
Confidence            4 688999999999999999999999999999999999999999999998888999999999999999998753 45
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure