Citrus Sinensis ID: 042646


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560
MQDIPLKTNSCAESTIDISSNSDLIPESTVDNNSSLIEAQYNSGLAYLENKKKVKGQQNQNRDNAPTMDSTESTVDVSSNPGLIEACDNSPLMRSGNKKNRKRRRRKRKSSAPKTDNTDADLQEVTSKTMTAPFGMALVDMITKAVSETDPLEVEASGDTSLKPVLAAAPKETNGSVDTSVKLDFPKNLSRSKRKRLRRKLHKESLHVLERDAKDCALAGDKSLKNNMLQEKHSSLQPSVDICSQNELVVKQSNGDVCLFNGHNAFENNGVIDLHMANGKQLEKKEAKCAPKVTELDLTTMRKDFPISEKQSSSSNSANRSLMENDDVHPESHPVSSETRTIIAYKRKKRVKTYIWTKKKKCSNLLVNGVDCIKEDGDSLMKNVSLLTEGHIEQKLSDKLDKIQITVHDASHGNDVSDEIPSHPKEYNISGHDRSCKLPKKQHVEVETKTTEGFPPSHLGVVESGTGLHDSSEEENHSQTLQYPPGNVCIGHSKKKLLVLDLNGLLVDIVASPYHRYRPDKMVSNKAVFKRPCCDEFLSFCFERFNVGVWSRGSRKIWTM
ccccccccccccccEEEccccccccccccccccccHHHHHHccccHHHcccccccccccccccccccccccccEEEccccccccccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccccccccccccccccccccccccccccEEEccccccEEEccccHHHccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccEEEHHHHcccccccccccccccEEccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccEEEEEccccccccccEEEccccccccccHHHHHHHHHHccEEEEEcccccccccc
cccccccccccccEEEEEccccccccccccccccHHHHHHHccHHHHHHccccccccccccccccccccccccEEEcccccccEEEccccccccccccccHHHHHHHccccccccccccccHHHHcccccccHHHHHHHHHHHHHHccccccEEEEccccccccEEEccccccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHcccccccccccEEEcccEEEEEcccccEccccccHHHHcccccccccccccccccHccccccHHEccccEEEcccccccccccccccccccHHccccccccccccccccccEEEEccccEEEEEEEEHccccccHHHccccEEEEccccccccccccccccEEEEcccHHHcEEEEEcccccccccccccccccccEEcccccccccccccccEEEEEEccccccccccccEccccccccccHHcccccEEEcccccccccccccEEEEEEcccEEEEcccccccccccccEEcccEEEcccccHHHHHHHHHHcEEEEEEccccEEEcc
mqdiplktnscaestidissnsdlipestvdnnsSLIEAQYNSGlaylenkkkvkgqqnqnrdnaptmdstestvdvssnpglieacdnsplmrsgnkknrkrrrrkrkssapktdntdadLQEVtsktmtapfGMALVDMITKAvsetdpleveasgdtslkpvlaaapketngsvdtsvkldfpknlsrSKRKRLRRKLHKESLHVLERDAKdcalagdkslknnmlqekhsslqpsvdicsqnelvvkqsngdvclfnghnafenngvidlhMANGKQLEKkeakcapkvteldlttmrkdfpisekqssssnsanrslmenddvhpeshpvssetRTIIAYKRKKRVKTYIWTKKKKCSNLLVNGVDCIKEDGDSLMKNVSLLTEGHIEQKLSDKLDKIQItvhdashgndvsdeipshpkeynisghdrscklpkkqhVEVEtkttegfppshlgvvesgtglhdsseeenhsqtlqyppgnvcighskkKLLVLDLNGLLvdivaspyhryrpdkmvsnkavfkrpccdeFLSFCFERfnvgvwsrgsrkiwtm
mqdiplktnscaestidissnsdlipESTVDNNSSLIEAQYNSGLAYLENKKkvkgqqnqnrdnaptmdstestvdvssnpglieacdnsplmrsgnkknrkrrrrkrkssapktdntdadlqevtskTMTAPFGMALVDMITKAVSETDPLEveasgdtslkpvlaaapketngsvdtsvkldfpknlsrskrkrlrrklhkeslhvlerdakdCALAGDKSLKNNMLQEKHSSLQPSVDICSQNELVVKQSNGDVCLFNGHNAFENNGVIDLHMANGKQLEKkeakcapkvteldlttmrkdfpisekqssssnsaNRSLMEnddvhpeshpvssetrtiiaykrkkrvktyiwtkkkkcsnllvNGVDCIKEDGDSLMKNVSLLTEGHIEQKLSDKLDKIQITVHDashgndvsdeipSHPKEYNISGHDRSCKLPKKQHVEVETkttegfppshlgVVESGTGLHDSSEEENHSQTLQYPPGNVCIGHSKKKLLVLDLNGLLVDIVaspyhryrpdkmvsnkavfkRPCCDEFLSFcferfnvgvwsrgsrkiwtm
MQDIPLKTNSCAESTIDISSNSDLIPESTVDNNSSLIEAQYNSGLAYLEnkkkvkgqqnqnRDNAPTMDSTESTVDVSSNPGLIEACDNSPLMRSGnkknrkrrrrkrkSSAPKTDNTDADLQEVTSKTMTAPFGMALVDMITKAVSETDPLEVEASGDTSLKPVLAAAPKETNGSVDTSVKLDFPknlsrskrkrlrrklhkeslHVLERDAKDCALAGDKSLKNNMLQEKHSSLQPSVDICSQNELVVKQSNGDVCLFNGHNAFENNGVIDLHMANGKQLEKKEAKCAPKVTELDLTTMRKDFPISEKQssssnsanrsLMENDDVHPESHPVSSETRTIIAYKRKKRVKTYIWTKKKKCSNLLVNGVDCIKEDGDSLMKNVSLLTEGHIEQKLSDKLDKIQITVHDASHGNDVSDEIPSHPKEYNISGHDRSCKLPKKQHVEVETKTTEGFPPSHLGVVESGTGLHDSSEEENHSQTLQYPPGNVCIGHSkkkllvldlngllvdIVASPYHRYRPDKMVSNKAVFKRPCCDEFLSFCFERFNVGVWSRGSRKIWTM
*************************************************************************************************************************************FGMALVDMIT*************************************************************************************************DICSQNELVVKQSNGDVCLFNGHNAFENNGVIDLHMAN**************************************************************TIIAYKRKKRVKTYIWTKKKKCSNLLVNGVDCIKEDGDSLMKNVSLLTEGHIEQKL***LDKIQIT******************************************************************************PGNVCIGHSKKKLLVLDLNGLLVDIVASPYHRYRPDKMVSNKAVFKRPCCDEFLSFCFERFNVGVWSRGSRKI***
****P***NSCAESTIDISSNSDLIPESTVDNNSSLIEAQYNSGLAY***************************VDVSSNPGLIEACD**********************************QEVTSKTMTAPFGMALVDMITKAVSE****************************VDTSV***************************LERDAKDCA****************************NELVVKQSNGDVCLFNGHNAFENNGVID**************KCAPKVTELDLTT**********************************VSS***********************************************************************************************************************************************************SKKKLLVLDLNGLLVDIVASPYHRYRPDKMVSNKAVFKRPCCDEFLSFCFERFNVGVWSRGSRKIWTM
MQDIPLKTNSCAESTIDISSNSDLIPESTVDNNSSLIEAQYNSGLAYLENKK**************************SNPGLIEACDNSPLMR*************************ADLQEVTSKTMTAPFGMALVDMITKAVSETDPLEVEASGDTSLKPVLAAAPKETNGSVDTSVKLDFPKNLSRSKRKRLRRKLHKESLHVLERDAKDCALAGDKSLKNNMLQEKHSSLQPSVDICSQNELVVKQSNGDVCLFNGHNAFENNGVIDLHMANGKQLEKKEAKCAPKVTELDLTTMRKDFP*********************************RTIIAYKRKKRVKTYIWTKKKKCSNLLVNGVDCIKEDGDSLMKNVSLLTEGHIEQKLSDKLDKIQITVHDASHGNDVSDEIPSHPKEYNISGHDRSCKLPKKQHVEVETKTTEGFPPSHLGVVES***************TLQYPPGNVCIGHSKKKLLVLDLNGLLVDIVASPYHRYRPDKMVSNKAVFKRPCCDEFLSFCFERFNVGVWSRGSRKIWTM
**DIPLKTNSCAESTIDISSNSDLIPESTVDNNSSLIEAQYNSGLAYLENKK*********************TVDVSSNPGLIEACDNSPL***************************ADLQEVTSKTMTAPFGMALVDMITKAVSETDPLEVEASGDTSLKPVLAAAP*****SVDTSVKLDFPKNLSRSKRKRLRRKLHKESLHVLERDAKDCALAGDKSLKNN****KHSSLQPSVDICSQNELVVKQSNGDVCLFNGHNAFENNGVIDLHMANGKQLEKKEAKCAPKVTELDLTTMRKDFPI************************SHPVSSETRTIIAYKRKKRVKTYIWTKKKKCSNLLVNGVDCIKEDGDSLMKNVSLLTEGHIEQKLSDKLDKIQITVHDASHGNDVSDEIPSHPKEYNISGHDRSCKLPKKQHVEVETKTTEGFPPSHLGVVESGTGLHDSSE*ENHSQTLQYPPGNVCIGHSKKKLLVLDLNGLLVDIVASPYHRYRPDKMVSNKAVFKRPCCDEFLSFCFERFNVGVWSRGSRKIWT*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQDIPLKTNSCAESTIDISSNSDLIPESTVDNNSSLIEAQYNSGLAYLENKKKVKGQQNQNRDNAPTMDSTESTVDVSSNPGLIEACDNSPLMRSGNKKNRKRRRRKRKSSAPKTDNTDADLQEVTSKTMTAPFGMALVDMITKAVSETDPLEVEASGDTSLKPVLAAAPKETNGSVDTSVKLDFPKNLSRSKRKRLRRKLHKESLHVLERDAKDCALAGDKSLKNNMLQEKHSSLQPSVDICSQNELVVKQSNGDVCLFNGHNAFENNGVIDLHMANGKQLEKKEAKCAPKVTELDLTTMRKDFPISEKQSSSSNSANRSLMENDDVHPESHPVSSETRTIIAYKRKKRVKTYIWTKKKKCSNLLVNGVDCIKEDGDSLMKNVSLLTEGHIEQKLSDKLDKIQITVHDASHGNDVSDEIPSHPKEYNISGHDRSCKLPKKQHVEVETKTTEGFPPSHLGVVESGTGLHDSSEEENHSQTLQYPPGNVCIGHSKKKLLVLDLNGLLVDIVASPYHRYRPDKMVSNKAVFKRPCCDEFLSFCFERFNVGVWSRGSRKIWTM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query560
225456581652 PREDICTED: uncharacterized protein LOC10 0.175 0.150 0.52 2e-20
449477513531 PREDICTED: uncharacterized protein LOC10 0.108 0.114 0.672 1e-16
449441105593 PREDICTED: uncharacterized protein LOC10 0.108 0.102 0.672 1e-16
449487062540 PREDICTED: uncharacterized LOC101203219 0.210 0.218 0.409 2e-16
449439657410 PREDICTED: uncharacterized protein LOC10 0.210 0.287 0.409 3e-16
356568774213 PREDICTED: uncharacterized FCP1 homology 0.123 0.323 0.583 9e-15
255547163576 conserved hypothetical protein [Ricinus 0.110 0.107 0.580 7e-14
224080213209 predicted protein [Populus trichocarpa] 0.112 0.301 0.587 3e-13
357450991 731 hypothetical protein MTR_2g060670 [Medic 0.383 0.294 0.299 3e-13
334186930 1057 haloacid dehalogenase-like hydrolase dom 0.126 0.067 0.452 9e-12
>gi|225456581|ref|XP_002265588.1| PREDICTED: uncharacterized protein LOC100263840 [Vitis vinifera] gi|297734071|emb|CBI15318.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  107 bits (266), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 67/100 (67%), Gaps = 2/100 (2%)

Query: 457 SHLGVVESGTGLHDSSEEENHSQTLQYPPGNVCIGHSKKKLLVLDLNGLLVDIVASPYHR 516
           SHLG ++    +   ++EEN   T Q  P      HS+KKLL+LD+NGLL DIV      
Sbjct: 386 SHLGAIKDDVKI--VNKEENPPHTSQSLPERAVSCHSRKKLLILDVNGLLADIVPYFVEG 443

Query: 517 YRPDKMVSNKAVFKRPCCDEFLSFCFERFNVGVWSRGSRK 556
           Y+PD +VS K+VFKRP CD+FL FCFERF+VGVWS  ++K
Sbjct: 444 YKPDIVVSRKSVFKRPFCDDFLQFCFERFDVGVWSSRTKK 483




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449477513|ref|XP_004155045.1| PREDICTED: uncharacterized protein LOC101224607 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449441105|ref|XP_004138324.1| PREDICTED: uncharacterized protein LOC101219396 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449487062|ref|XP_004157484.1| PREDICTED: uncharacterized LOC101203219 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449439657|ref|XP_004137602.1| PREDICTED: uncharacterized protein LOC101203219 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356568774|ref|XP_003552585.1| PREDICTED: uncharacterized FCP1 homology domain-containing protein C1271.03c-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|255547163|ref|XP_002514639.1| conserved hypothetical protein [Ricinus communis] gi|223546243|gb|EEF47745.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224080213|ref|XP_002306055.1| predicted protein [Populus trichocarpa] gi|222849019|gb|EEE86566.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357450991|ref|XP_003595772.1| hypothetical protein MTR_2g060670 [Medicago truncatula] gi|355484820|gb|AES66023.1| hypothetical protein MTR_2g060670 [Medicago truncatula] Back     alignment and taxonomy information
>gi|334186930|ref|NP_194349.2| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] gi|332659768|gb|AEE85168.1| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query560
TAIR|locus:2091823465 AT3G29760 "AT3G29760" [Arabido 0.080 0.096 0.489 4.2e-06
TAIR|locus:2091823 AT3G29760 "AT3G29760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 128 (50.1 bits), Expect = 4.2e-06, Sum P(2) = 4.2e-06
 Identities = 23/47 (48%), Positives = 31/47 (65%)

Query:   510 VASPYHRYRPDKMVSNKAVFKRPCCDEFLSFCFERFNVGVWSRGSRK 556
             + +P      D  +  +A+FKRP CDEFL FCF++F VG+WS  SRK
Sbjct:   320 IVTPLKDVPADINIGRRAIFKRPFCDEFLRFCFDKFEVGIWS--SRK 364


GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00000035001
SubName- Full=Chromosome chr17 scaffold_101, whole genome shotgun sequence; (652 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query560
smart00577148 smart00577, CPDc, catalytic domain of ctd-like pho 1e-09
pfam03031153 pfam03031, NIF, NLI interacting factor-like phosph 2e-08
TIGR02245 195 TIGR02245, HAD_IIID1, HAD-superfamily subfamily II 0.004
>gnl|CDD|214729 smart00577, CPDc, catalytic domain of ctd-like phosphatases Back     alignment and domain information
 Score = 56.5 bits (137), Expect = 1e-09
 Identities = 26/72 (36%), Positives = 31/72 (43%), Gaps = 9/72 (12%)

Query: 494 KKKLLVLDLNGLLVD-IVASPYHRYRPDKMVSNKA--------VFKRPCCDEFLSFCFER 544
           KKK LVLDL+  LV     S       D +V            V KRP  DEFL    E 
Sbjct: 1   KKKTLVLDLDETLVHSTHRSFKEWTNRDFIVPVLIDGHPHGVYVKKRPGVDEFLKRASEL 60

Query: 545 FNVGVWSRGSRK 556
           F + V++ G R 
Sbjct: 61  FELVVFTAGLRM 72


Length = 148

>gnl|CDD|217328 pfam03031, NIF, NLI interacting factor-like phosphatase Back     alignment and domain information
>gnl|CDD|131299 TIGR02245, HAD_IIID1, HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 560
TIGR02245 195 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase 99.71
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 99.62
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 99.59
KOG1605262 consensus TFIIF-interacting CTD phosphatase, inclu 99.48
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 99.33
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 99.25
COG5190 390 FCP1 TFIIF-interacting CTD phosphatases, including 98.55
KOG2832 393 consensus TFIIF-interacting CTD phosphatase, inclu 97.94
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 97.39
KOG0323 635 consensus TFIIF-interacting CTD phosphatases, incl 97.13
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 97.04
TIGR01684 301 viral_ppase viral phosphatase. These proteins also 96.88
COG4996164 Predicted phosphatase [General function prediction 96.82
PHA03398 303 viral phosphatase superfamily protein; Provisional 96.61
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 96.33
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 96.07
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 95.97
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 95.59
PRK08942 181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 95.1
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase. Due to 95.06
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 94.84
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 94.74
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 94.65
TIGR01533 266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 94.52
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 94.42
PRK13582 205 thrH phosphoserine phosphatase; Provisional 93.65
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 93.49
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 93.19
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 92.94
PLN02954 224 phosphoserine phosphatase 91.9
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 91.86
PF05152 297 DUF705: Protein of unknown function (DUF705); Inte 91.74
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 90.67
PHA02530300 pseT polynucleotide kinase; Provisional 90.6
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 90.32
PRK06769 173 hypothetical protein; Validated 89.93
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 89.85
PRK10187 266 trehalose-6-phosphate phosphatase; Provisional 89.52
PHA02597197 30.2 hypothetical protein; Provisional 89.19
COG1877 266 OtsB Trehalose-6-phosphatase [Carbohydrate transpo 89.12
PLN02645 311 phosphoglycolate phosphatase 89.06
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 88.82
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 88.79
PRK11587 218 putative phosphatase; Provisional 87.6
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 87.15
PLN02151 354 trehalose-phosphatase 87.05
TIGR03351 220 PhnX-like phosphonatase-like hydrolase. This clade 86.92
PRK13288214 pyrophosphatase PpaX; Provisional 86.24
PLN02580 384 trehalose-phosphatase 86.14
PTZ00174 247 phosphomannomutase; Provisional 85.74
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 85.61
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 85.55
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 85.26
PRK11590211 hypothetical protein; Provisional 85.21
PRK10976 266 putative hydrolase; Provisional 84.77
PRK13226 229 phosphoglycolate phosphatase; Provisional 84.56
PRK01158 230 phosphoglycolate phosphatase; Provisional 84.47
PRK10530 272 pyridoxal phosphate (PLP) phosphatase; Provisional 84.46
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 84.2
PRK13478 267 phosphonoacetaldehyde hydrolase; Provisional 84.07
PRK03669 271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 83.98
PRK13223 272 phosphoglycolate phosphatase; Provisional 83.96
PLN02770 248 haloacid dehalogenase-like hydrolase family protei 83.85
TIGR01422 253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 83.62
PRK10748238 flavin mononucleotide phosphatase; Provisional 83.32
PRK10513 270 sugar phosphate phosphatase; Provisional 83.26
PLN03017 366 trehalose-phosphatase 83.08
PRK15126 272 thiamin pyrimidine pyrophosphate hydrolase; Provis 82.71
PLN03243 260 haloacid dehalogenase-like hydrolase; Provisional 82.4
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 82.24
PRK13222 226 phosphoglycolate phosphatase; Provisional 82.05
PRK09449224 dUMP phosphatase; Provisional 81.88
COG2503 274 Predicted secreted acid phosphatase [General funct 81.87
PRK08238 479 hypothetical protein; Validated 81.63
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 81.54
PRK14501 726 putative bifunctional trehalose-6-phosphate syntha 81.45
TIGR01487 215 SPP-like sucrose-phosphate phosphatase-like hydrol 81.39
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 81.25
COG0546220 Gph Predicted phosphatases [General function predi 81.04
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 80.88
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 80.75
PRK10563 221 6-phosphogluconate phosphatase; Provisional 80.7
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 80.65
PRK14988224 GMP/IMP nucleotidase; Provisional 80.65
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 80.63
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 80.11
>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information
Probab=99.71  E-value=8.6e-18  Score=157.35  Aligned_cols=61  Identities=31%  Similarity=0.451  Sum_probs=52.0

Q ss_pred             CCCCCCCeEEEEecCcccccccCCCCCCCCCCeeeccceeEeCccHHHHHHHHHhccEEEEEccccccccc
Q 042646          489 CIGHSKKKLLVLDLNGLLVDIVASPYHRYRPDKMVSNKAVFKRPCCDEFLSFCFERFNVGVWSRGSRKIWT  559 (560)
Q Consensus       489 ~i~~~KKKLLVLDLDETLVHSSskpp~g~kPDfkV~~yyVyKRPhLDEFLdfVsE~FEVVVWTSS~~kYVd  559 (560)
                      ....++||||||||||||||+....          .++++++||||++||++|+++|||+||||++++||+
T Consensus        15 ~~~~~~kklLVLDLDeTLvh~~~~~----------~~~~~~kRP~l~eFL~~~~~~feIvVwTAa~~~ya~   75 (195)
T TIGR02245        15 NPPREGKKLLVLDIDYTLFDHRSPA----------ETGEELMRPYLHEFLTSAYEDYDIVIWSATSMKWIE   75 (195)
T ss_pred             CCCCCCCcEEEEeCCCceEcccccC----------CCceEEeCCCHHHHHHHHHhCCEEEEEecCCHHHHH
Confidence            4445689999999999999973211          135899999999999999999999999999999985



This family of sequences appears to belong to the Haloacid Dehalogenase (HAD) superfamily of enzymes by virtue of the presence of three catalytic domains, in this case: LLVLD(ILV)D(YH)T, I(VMG)IWS, and (DN)(VC)K(PA)Lx{15-17}T(IL)(MH)(FV)DD(IL)(GRS)(RK)N. Since this family has no large "cap" domain between motifs 1 and 2 or between 2 and 3, it is formally a "class III" HAD.

>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>KOG1605 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>KOG2832 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>KOG0323 consensus TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>COG4996 Predicted phosphatase [General function prediction only] Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>PLN02151 trehalose-phosphatase Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>PLN02580 trehalose-phosphatase Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>PLN03017 trehalose-phosphatase Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>COG2503 Predicted secreted acid phosphatase [General function prediction only] Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query560
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
3qle_A 204 TIM50P; chaperone, mitochondrion, preprotein trans 2e-06
3shq_A 320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 6e-05
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 2e-04
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 3e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 59.1 bits (142), Expect = 3e-09
 Identities = 78/579 (13%), Positives = 155/579 (26%), Gaps = 193/579 (33%)

Query: 1   MQDIPLKTNSCAESTIDISSNSDLIPESTVDNNSSLIEAQYNSGLAYLENKKK------V 54
           +QD+P    S  E  ID      +I      + +  +          L +K++      V
Sbjct: 38  VQDMPKSILSKEE--ID-----HIIMSKDAVSGTLRL-------FWTLLSKQEEMVQKFV 83

Query: 55  KG--QQN--------QNRDNAPTMDST--ESTVDVSSNPGLIEACDNSPLMRSGNKKNRK 102
           +   + N        +     P+M +       D   N       DN        K N  
Sbjct: 84  EEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYN-------DNQVF----AKYNVS 132

Query: 103 RRRRKRKSSAPKTDNTDADLQEVTSKTMTAPFGMA------LVDMI--TKAVSETDPLEV 154
           R +       P      A L E+         G+       +   +  +  V      ++
Sbjct: 133 RLQ-------PYLKLRQA-LLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDFKI 184

Query: 155 -------EASGDTSLKPV---LAAAPKETNGSVDTSVKLDFPKNLSRSKRKRL-RRKLHK 203
                    S +T L+ +   L           D S  +    +  +++ +RL + K ++
Sbjct: 185 FWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYE 244

Query: 204 ESLHVLERDAKD----------C---ALAGDKSLKN--NMLQEKHSSLQPSVDICSQNE- 247
             L VL  + ++          C        K + +  +     H SL       + +E 
Sbjct: 245 NCLLVL-LNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEV 303

Query: 248 -----LVVKQSNGD------------VCLF-----NGHNAFEN---------NGVIDLHM 276
                  +     D            + +      +G   ++N           +I+  +
Sbjct: 304 KSLLLKYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDKLTTIIESSL 363

Query: 277 ANGKQLEKKEAKCAPKVTEL--DLTTMRKDFPISEK--------------QSSSSNSANR 320
                LE  E +      ++   L+       I                     +     
Sbjct: 364 ---NVLEPAEYR------KMFDRLSVFPPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKY 414

Query: 321 SLMEND---------DVHPESHPVSSETRTIIAYKRKKRVKTYIWTKKKKCSNLLVNGVD 371
           SL+E            ++ E          +     +  V  Y   K     +L+   +D
Sbjct: 415 SLVEKQPKESTISIPSIYLELKVKLENEYAL----HRSIVDHYNIPKTFDSDDLIPPYLD 470

Query: 372 -------------CIKEDGDSLMKNVSLLTEGHIEQKL----------SDKLDKIQ---- 404
                            +  +L + V  L    +EQK+             L+ +Q    
Sbjct: 471 QYFYSHIGHHLKNIEHPERMTLFRMV-FLDFRFLEQKIRHDSTAWNASGSILNTLQQLKF 529

Query: 405 ----ITVHDASHG---NDVSDEIPSHPKEYNISGHDRSC 436
               I  +D  +    N + D +P    E N+     + 
Sbjct: 530 YKPYICDNDPKYERLVNAILDFLPKI--EENLICSKYTD 566


>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Length = 204 Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Length = 320 Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Length = 181 Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Length = 195 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query560
3qle_A 204 TIM50P; chaperone, mitochondrion, preprotein trans 99.62
3shq_A 320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 99.6
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 99.59
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 99.55
3ef1_A 442 RNA polymerase II subunit A C-terminal domain phos 99.42
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 99.41
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 96.88
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 96.66
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 96.49
2gmw_A 211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 96.43
2oda_A 196 Hypothetical protein pspto_2114; haloacid dehaloge 96.36
3ib6_A 189 Uncharacterized protein; structural genomics, unkn 96.34
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 96.19
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 96.03
2fpr_A 176 Histidine biosynthesis bifunctional protein HISB; 95.85
3m9l_A 205 Hydrolase, haloacid dehalogenase-like family; HAD 95.69
2i33_A 258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 95.49
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 95.25
1nnl_A 225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 95.08
3mmz_A 176 Putative HAD family hydrolase; structural genomics 94.88
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 94.6
1k1e_A 180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 94.58
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 94.54
3ocu_A 262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 94.49
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 94.48
3mn1_A 189 Probable YRBI family phosphatase; structural genom 94.48
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 94.42
3pct_A 260 Class C acid phosphatase; hydrolase, outer membran 94.23
3e8m_A 164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 94.19
3ij5_A 211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 93.77
2o2x_A 218 Hypothetical protein; structural genomics, joint c 93.71
3pgv_A 285 Haloacid dehalogenase-like hydrolase; structural g 93.65
3skx_A 280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 93.62
4eze_A 317 Haloacid dehalogenase-like hydrolase; magnesium bi 93.62
1l7m_A 211 Phosphoserine phosphatase; rossmann fold, four-hel 93.59
3n07_A 195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 93.55
3r4c_A 268 Hydrolase, haloacid dehalogenase-like hydrolase; h 93.31
2fue_A 262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 92.64
3n1u_A 191 Hydrolase, HAD superfamily, subfamily III A; struc 92.29
2r8e_A 188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 91.49
2hx1_A 284 Predicted sugar phosphatases of the HAD superfamil 91.47
3dao_A 283 Putative phosphatse; structural genomics, joint ce 91.3
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 91.21
3l7y_A 304 Putative uncharacterized protein SMU.1108C; hydrol 91.14
1vjr_A 271 4-nitrophenylphosphatase; TM1742, structural genom 91.08
2c4n_A 250 Protein NAGD; nucleotide phosphatase, HAD superfam 90.97
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 90.79
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 90.69
3gyg_A 289 NTD biosynthesis operon putative hydrolase NTDB; P 90.62
4ex6_A 237 ALNB; modified rossman fold, phosphatase, magnesiu 90.62
3fzq_A 274 Putative hydrolase; YP_001086940.1, putative haloa 90.59
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 90.51
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 90.43
3d6j_A 225 Putative haloacid dehalogenase-like hydrolase; str 90.37
2hcf_A 234 Hydrolase, haloacid dehalogenase-like family; NP_6 90.34
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 90.33
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 90.33
2amy_A 246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 90.18
4dw8_A 279 Haloacid dehalogenase-like hydrolase; HAD, putativ 90.15
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 90.14
1te2_A226 Putative phosphatase; structural genomics, phospha 90.06
3nuq_A 282 Protein SSM1, putative nucleotide phosphatase; sup 90.01
3dnp_A 290 Stress response protein YHAX; structural PSI-2, pr 90.01
3kd3_A 219 Phosphoserine phosphohydrolase-like protein; csgid 89.98
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 89.95
3mc1_A 226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 89.86
2oyc_A 306 PLP phosphatase, pyridoxal phosphate phosphatase; 89.79
2om6_A 235 Probable phosphoserine phosphatase; rossmann fold, 89.79
3mpo_A 279 Predicted hydrolase of the HAD superfamily; SGX, P 89.66
2pke_A 251 Haloacid delahogenase-like family hydrolase; NP_63 89.62
2p11_A 231 Hypothetical protein; putative haloacid dehalogena 89.55
2fdr_A 229 Conserved hypothetical protein; SAD, structural ge 89.54
2b30_A 301 Pvivax hypothetical protein; SGPP, structural geno 89.38
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 89.27
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 89.25
3nas_A 233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 89.21
3fvv_A 232 Uncharacterized protein; unknown function, structu 89.18
3umc_A 254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 89.17
2pq0_A 258 Hypothetical conserved protein GK1056; hyopthetica 89.13
3smv_A 240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 89.06
2x4d_A 271 HLHPP, phospholysine phosphohistidine inorganic py 89.03
1zrn_A 232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 88.91
3dv9_A 247 Beta-phosphoglucomutase; structural genomics, APC6 88.87
1swv_A 267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 88.85
3ed5_A 238 YFNB; APC60080, bacillus subtilis subsp. subtilis 88.81
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 88.78
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 88.77
3iru_A 277 Phoshonoacetaldehyde hydrolase like protein; phosp 88.77
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 88.64
2hsz_A243 Novel predicted phosphatase; structural genomics, 88.6
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 88.6
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 88.46
3u26_A 234 PF00702 domain protein; structural genomics, PSI-b 88.41
1wr8_A 231 Phosphoglycolate phosphatase; alpha / beta core do 88.37
3um9_A 230 Haloacid dehalogenase, type II; haloacid dehalogen 88.32
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 88.28
3umg_A 254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 88.24
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 88.21
3s6j_A 233 Hydrolase, haloacid dehalogenase-like family; stru 88.19
2no4_A 240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 87.85
2hoq_A 241 Putative HAD-hydrolase PH1655; haloacid dehalogena 87.81
3m1y_A 217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 87.45
3qnm_A 240 Haloacid dehalogenase-like hydrolase; structural g 87.38
3qxg_A 243 Inorganic pyrophosphatase; hydrolase, magnesium bi 87.34
3umb_A 233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 87.24
3l5k_A 250 Protein GS1, haloacid dehalogenase-like hydrolase 87.22
3pdw_A 266 Uncharacterized hydrolase YUTF; structural genomic 87.21
1rlm_A 271 Phosphatase; HAD family, rossman fold, hydrolase; 87.06
2rbk_A 261 Putative uncharacterized protein; HAD-like phospha 87.04
3kc2_A 352 Uncharacterized protein YKR070W; HAD-like, mitocho 86.94
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 86.88
2ho4_A 259 Haloacid dehalogenase-like hydrolase domain contai 86.75
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 86.61
1nf2_A 268 Phosphatase; structural proteomics, HAD NEW fold, 86.59
4eek_A 259 Beta-phosphoglucomutase-related protein; hydrolase 86.58
3sd7_A240 Putative phosphatase; structural genomics, haloaci 86.57
3qgm_A 268 P-nitrophenyl phosphatase (PHO2); structural genom 86.4
1nrw_A 288 Hypothetical protein, haloacid dehalogenase-like h 86.35
3epr_A 264 Hydrolase, haloacid dehalogenase-like family; stru 86.18
1qq5_A 253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 86.14
4gib_A 250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 86.11
2nyv_A 222 Pgpase, PGP, phosphoglycolate phosphatase; structu 85.74
2qlt_A 275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 85.7
2zg6_A220 Putative uncharacterized protein ST2620, probable 85.03
1xvi_A 275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 84.98
1rku_A 206 Homoserine kinase; phosphoserine phosphatase, phos 84.83
2gfh_A 260 Haloacid dehalogenase-like hydrolase domain conta; 84.78
3zx4_A 259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 84.71
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 84.61
3f9r_A 246 Phosphomannomutase; trypanosome glycobiology struc 84.47
1rkq_A 282 Hypothetical protein YIDA; two domain structure wi 84.23
1y8a_A 332 Hypothetical protein AF1437; structural genomics, 84.02
1u02_A 239 Trehalose-6-phosphate phosphatase related protein; 83.29
2zos_A 249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 83.26
3k1z_A 263 Haloacid dehalogenase-like hydrolase domain-conta 82.68
4g9b_A 243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 82.39
1s2o_A 244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 81.49
1yv9_A 264 Hydrolase, haloacid dehalogenase family; hypotheti 81.44
2fea_A 236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 81.42
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Back     alignment and structure
Probab=99.62  E-value=2.4e-16  Score=145.87  Aligned_cols=67  Identities=21%  Similarity=0.174  Sum_probs=54.4

Q ss_pred             CCCCCCCCCCCCeEEEEecCcccccccCCCCCCCCCCeeeccceeEeCccHHHHHHHHHhccEEEEEccccccccc
Q 042646          484 PPGNVCIGHSKKKLLVLDLNGLLVDIVASPYHRYRPDKMVSNKAVFKRPCCDEFLSFCFERFNVGVWSRGSRKIWT  559 (560)
Q Consensus       484 sP~r~~i~~~KKKLLVLDLDETLVHSSskpp~g~kPDfkV~~yyVyKRPhLDEFLdfVsE~FEVVVWTSS~~kYVd  559 (560)
                      +|.+......+++||||||||||||+...+.         .+++|++|||+++||++++++|+|+||||+.+.||+
T Consensus        23 Lp~~~~~~~~~~~tLVLDLDeTLvh~~~~~~---------~~~~v~~RPgl~eFL~~l~~~yeivI~Tas~~~ya~   89 (204)
T 3qle_A           23 LPPPPPPPYQRPLTLVITLEDFLVHSEWSQK---------HGWRTAKRPGADYFLGYLSQYYEIVLFSSNYMMYSD   89 (204)
T ss_dssp             SCCCC----CCSEEEEEECBTTTEEEEEETT---------TEEEEEECTTHHHHHHHHTTTEEEEEECSSCHHHHH
T ss_pred             CCCCCccccCCCeEEEEeccccEEeeecccc---------CceeEEeCCCHHHHHHHHHhCCEEEEEcCCcHHHHH
Confidence            4444444567899999999999999975432         356899999999999999999999999999999985



>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 560
d1ta0a_181 c.108.1.16 (A:) Carboxy-terminal domain RNA polyme 3e-09
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 181 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NLI interacting factor-like phosphatase
domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 54.3 bits (130), Expect = 3e-09
 Identities = 21/72 (29%), Positives = 28/72 (38%), Gaps = 6/72 (8%)

Query: 492 HSKKKLLVLDLNGLLVDIVASP------YHRYRPDKMVSNKAVFKRPCCDEFLSFCFERF 545
            S K  +V+DL+  LV     P            D +V    V KRP  DEFL    E F
Sbjct: 12  DSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELF 71

Query: 546 NVGVWSRGSRKI 557
              +++    K 
Sbjct: 72  ECVLFTASLAKY 83


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query560
d1ta0a_181 Carboxy-terminal domain RNA polymerase II polypept 99.76
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 97.89
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 97.62
d1xpja_124 Hypothetical protein VC0232 {Vibrio cholerae [TaxI 96.35
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 95.94
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 95.91
d1j97a_ 210 Phosphoserine phosphatase {Archaeon Methanococcus 95.54
d1yj5a1 195 5' polynucleotide kinase-3' phosphatase, middle do 95.47
d2amya1 243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 95.45
d2o2xa1 209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 93.95
d2hcfa1 228 Hypothetical protein CT1708 {Chlorobium tepidum [T 92.62
d1nnla_ 217 Phosphoserine phosphatase {Human (Homo sapiens) [T 92.3
d2fuea1 244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 92.27
d1rkua_ 206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 91.95
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 91.23
d1wzca1 243 Putative mannosyl-3-phosphoglycerate phosphatase M 90.56
d2feaa1 226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 90.27
d2b30a1 283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 90.12
d1wr8a_ 230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 90.1
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 89.84
d1nrwa_ 285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 89.25
d2fdra1 222 Hypothetical protein Atu0790 {Agrobacterium tumefa 89.23
d1s2oa1 244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 89.18
d1xvia_ 232 Putative mannosyl-3-phosphoglycerate phosphatase M 88.86
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 88.51
d1rkqa_ 271 Hypothetical protein YidA {Escherichia coli [TaxId 88.49
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 88.32
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 87.79
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 87.4
d1u02a_ 229 Trehalose-6-phosphate phosphatase related protein 86.23
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 85.82
d1nf2a_ 267 Hypothetical protein TM0651 {Thermotoga maritima [ 85.74
d1l6ra_ 225 Phosphoglycolate phosphatase, PGPase {Archaeon The 84.43
d1rlma_ 269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 84.43
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 84.11
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 84.01
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 83.71
d1vjra_ 261 Hypothetical protein TM1742 {Thermotoga maritima [ 83.13
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 83.12
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 82.51
d2rbka1 260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 82.24
d1wvia_ 253 Putative phosphatase SMU.1415c {Streptococcus muta 82.1
d2g80a1 225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 81.05
d2c4na1 250 NagD {Escherichia coli [TaxId: 562]} 80.75
d2gfha1 247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 80.51
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NLI interacting factor-like phosphatase
domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.76  E-value=1.6e-19  Score=159.00  Aligned_cols=74  Identities=28%  Similarity=0.289  Sum_probs=59.1

Q ss_pred             CCCCCCCCCCeEEEEecCcccccccCCCCCCCC------CCeeeccceeEeCccHHHHHHHHHhccEEEEEccccccccc
Q 042646          486 GNVCIGHSKKKLLVLDLNGLLVDIVASPYHRYR------PDKMVSNKAVFKRPCCDEFLSFCFERFNVGVWSRGSRKIWT  559 (560)
Q Consensus       486 ~r~~i~~~KKKLLVLDLDETLVHSSskpp~g~k------PDfkV~~yyVyKRPhLDEFLdfVsE~FEVVVWTSS~~kYVd  559 (560)
                      .+......+|++|||||||||||++..+.....      .+.....++|++|||+++||++|+++|+|+||||+++.||+
T Consensus         6 p~~~~~~~~k~~LVLDLDeTLihs~~~~~~~~~~~~~~~~~~~~~~~~v~~RP~l~eFL~~l~~~yei~I~Ta~~~~YA~   85 (181)
T d1ta0a_           6 PEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYAD   85 (181)
T ss_dssp             CCCCGGGTTSCEEEECCBTTTEEEESSCCTTCSEEEEEEETTEEEEEEEEECTTHHHHHHHHHHHSEEEEECSSCHHHHH
T ss_pred             CCCCcccCCCeEEEEeCCCCEEccccCCCCCccceeeecccceeeeeEEecCCCHHHHHHHHHhceEEEEEcCCcHHHHH
Confidence            333444458999999999999999877654221      12223567999999999999999999999999999999985



>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure