Citrus Sinensis ID: 042652

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33
MVVKLMPCCPSLSQKPLPKQVQIRTQMKYTTTRRPEILTSSAAASSTSASGLRVFVLSDLHTDYSENMTWVKCLSTTRHKKDVLLVAGDVAEKYDDFVLTMSLLKDRFQRVLFVPGNHDLWCRGEENDFPDSLEKLNKLLDACRGLGVEINPVVIDGLGIIPLFSWYHESFDREKDISGIRILPLEMVIHFLFSLQDLCPEKRMLFYPNLPKIIGSDFLELRIRSIHGAMGSTSACHVFGHTHFSWDAVLDGIRYVQAPLAYPRERKRRMNGGENQLPYCVYSDGKFADKLSHCYWSDYYATNPRSPDITELAPWVARFYNRTWKSEF
ccEEcccccccccccccccHHHcHHHHHHHcccccccccccccccccccccEEEEEEEcccccccccHHHHHHHccccccccEEEEcccccccHHHHHHHHHHHHHccccEEEEcccccccccccccccccHHHHHHHHHHHHHcccEEEccEEEccEEEEccccccccccccccccccccccHHHHHHHccccccccccHHHHcccccccEEEcccccHHHHHHHcccccccccEEEEccccccccEEEccEEEEccccccHHHHHccccccccccccccccccccccccccccHHHHHHcccccccccccHHHHHHHHHHHHcccc
cEEEEcccccccccccHHcHEEEEEEEccHHHccccccccccccccccccccEEEEEEccccccHHHHHHHHHcccccccccEEEEEcccHccHHHHHHHHHHHHHHHcEEEEEcccccccccccccccccHHHHHHHHHHHHHHcccccccccccccEEEEEEEEEcccccccccHHccccccHHHHccccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHccccccEEEEEEEEEccccEEEccEEEEEEEccccHHHHccccccccccccccccccccccccccccHHHHHHHcccccccccHHHHHHHHHHHHHcccc
mvvklmpccpslsqkplpkqvQIRTQMKytttrrpeiltssaaasstsasGLRVFVLSDLhtdysenmtwvKCLSTTRHKKDVLLVAGDVAEKYDDFVLTMSLLKDRFQrvlfvpgnhdlwcrgeendfpdSLEKLNKLLDACrglgveinpvvidglgiiplfswyhesfdrekdisgirilPLEMVIHFLFSLQdlcpekrmlfypnlpkiigsdFLELRIRSIHgamgstsachvfghthfswDAVLDGIRYvqaplayprerkrrmnggenqlpycvysdgkfadklshcywsdyyatnprspditelaPWVARFYNRTWKSEF
mvvklmpccpslsqkplpkqvqIRTQMKYtttrrpeiltssaaasstsasgLRVFVLSDLHTDYSENMTWVKCLSTTRHKKDVLLVAGDVAEKYDDFVLTMSLLKDRFQRVLFVPGNHDLWCRGEENDFPDSLEKLNKLLDACRGLGVEINPVVIDGLGIIPLFSWYHESFDREKDISGIRILPLEMVIHFLFSLQDLCPEKRMLFYPNLPKIIGSDFLELRIRSIHGAMGSTSACHVFGHTHFSWDAVLDGIRYVQAPLayprerkrrmnggenqlPYCVYSDGKFADKLSHCYWSDYYATNPRSPDITELAPWVARFYNRTWKSEF
MVVKLMPCCPSLSQKPLPKQVQIRTQMKYTTTRRPEILtssaaasstsasGLRVFVLSDLHTDYSENMTWVKCLSTTRHKKDVLLVAGDVAEKYDDFVLTMSLLKDRFQRVLFVPGNHDLWCRGEENDFPDSLEKLNKLLDACRGLGVEINPVVIDGLGIIPLFSWYHESFDREKDISGIRILPLEMVIHFLFSLQDLCPEKRMLFYPNLPKIIGSDFLELRIRSIHGAMGSTSACHVFGHTHFSWDAVLDGIRYVQAPLAYPRERKRRMNGGENQLPYCVYSDGKFADKLSHCYWSDYYATNPRSPDITELAPWVARFYNRTWKSEF
**************************************************GLRVFVLSDLHTDYSENMTWVKCLSTTRHKKDVLLVAGDVAEKYDDFVLTMSLLKDRFQRVLFVPGNHDLWCRGEENDFPDSLEKLNKLLDACRGLGVEINPVVIDGLGIIPLFSWYHESFDREKDISGIRILPLEMVIHFLFSLQDLCPEKRMLFYPNLPKIIGSDFLELRIRSIHGAMGSTSACHVFGHTHFSWDAVLDGIRYVQAPLAYPR*********ENQLPYCVYSDGKFADKLSHCYWSDYYATNPRSPDITELAPWVARFYNRTW****
*******CCPSLSQKPLPKQVQIRTQMKYTT*********************RVFVLSDLHTDYSENMTWVKCLSTTRHKKDVLLVAGDVAEKYDDFVLTMSLLKDRFQRVLFVPGNHDLWCRGEENDFPDSLEKLNKLLDACRGLGVEINPVVIDGLGIIPLFSWYHESFDREKDISGIRILPLEMVIHFLFSLQDLCPEKRMLFYPNLPKIIGSDFLELRIRSIHGAMGSTSACHVFGHTHFSWDAVLDGIRYVQAPLAYPRERKRRMNGGENQLPYCVYSDGKFADKLSHCYWSDYYATNPRSPDITELAPWVARFYNRTW****
MVVKLMPCCPSLSQKPLPKQVQIRTQMKYTTTRRPEILT**********SGLRVFVLSDLHTDYSENMTWVKCLSTTRHKKDVLLVAGDVAEKYDDFVLTMSLLKDRFQRVLFVPGNHDLWCRGEENDFPDSLEKLNKLLDACRGLGVEINPVVIDGLGIIPLFSWYHESFDREKDISGIRILPLEMVIHFLFSLQDLCPEKRMLFYPNLPKIIGSDFLELRIRSIHGAMGSTSACHVFGHTHFSWDAVLDGIRYVQAPLAYPRERKRRMNGGENQLPYCVYSDGKFADKLSHCYWSDYYATNPRSPDITELAPWVARFYNRTWKSEF
MVVKLMPCCPSLSQKPLPKQVQIRTQMKYTTTRRPEILT*********ASGLRVFVLSDLHTDYSENMTWVKCLSTTRHKKDVLLVAGDVAEKYDDFVLTMSLLKDRFQRVLFVPGNHDLWCRGEENDFPDSLEKLNKLLDACRGLGVEINPVVIDGLGIIPLFSWYHESFDREKDISGIRILPLEMVIHFLFSLQDLCPEKRMLFYPNLPKIIGSDFLELRIRSIHGAMGSTSACHVFGHTHFSWDAVLDGIRYVQAPLAYPRERKRRMNGGENQLPYCVYSDGKFADKLSHCYWSDYYATNPRSPDITELAPWVARFYNRTWKSEF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVVKLMPCCPSLSQKPLPKQVQIRTQMKYTTTRRPEILTSSAAASSTSASGLRVFVLSDLHTDYSENMTWVKCLSTTRHKKDVLLVAGDVAEKYDDFVLTMSLLKDRFQRVLFVPGNHDLWCRGEENDFPDSLEKLNKLLDACRGLGVEINPVVIDGLGIIPLFSWYHESFDREKDISGIRILPLEMVIHFLFSLQDLCPEKRMLFYPNLPKIIGSDFLELRIRSIHGAMGSTSACHVFGHTHFSWDAVLDGIRYVQAPLAYPRERKRRMNGGENQLPYCVYSDGKFADKLSHCYWSDYYATNPRSPDITELAPWVARFYNRTWKSEF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query328
297737192412 unnamed protein product [Vitis vinifera] 0.969 0.771 0.600 1e-121
356559987385 PREDICTED: uncharacterized protein LOC10 0.978 0.833 0.578 1e-117
359489934330 PREDICTED: uncharacterized protein LOC10 0.850 0.845 0.634 1e-116
224116564321 predicted protein [Populus trichocarpa] 0.823 0.841 0.658 1e-116
357499015382 hypothetical protein MTR_6g069050 [Medic 0.966 0.829 0.561 1e-112
449439733376 PREDICTED: uncharacterized protein LOC10 0.957 0.835 0.565 1e-112
10140706402 unknown protein [Oryza sativa Japonica G 0.905 0.738 0.480 8e-88
326531698397 predicted protein [Hordeum vulgare subsp 0.823 0.680 0.513 5e-87
357146790396 PREDICTED: uncharacterized protein LOC10 0.823 0.681 0.520 6e-87
326526305403 predicted protein [Hordeum vulgare subsp 0.823 0.669 0.510 1e-85
>gi|297737192|emb|CBI26393.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  442 bits (1136), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 227/378 (60%), Positives = 267/378 (70%), Gaps = 60/378 (15%)

Query: 1   MVVKLMPCCPSLSQK-----PLPKQVQIRT---QMKYTTTRRPEILTSSAAASSTSASGL 52
           MV++++P C  LSQK      L KQ+  R     +K +   RP+I+ SS  A    A G 
Sbjct: 38  MVLEIVPSCLGLSQKLSHSIHLSKQIASREYERDVKNSCIIRPQIMPSSNHAE---AVGP 94

Query: 53  RVFVLSDLHTDYSENMTWVKCLSTTRHKKDVLLVAGDVAEKYDDFVLTMSLLKDRFQRVL 112
           RVF++SDLH DYSENMTW+K LST RHKKDVLLVAGDVAE Y +FVLTMSLL D+F+ V 
Sbjct: 95  RVFMISDLHADYSENMTWMKDLSTMRHKKDVLLVAGDVAETYHNFVLTMSLLTDKFEYVF 154

Query: 113 FVPGNHDLWCRGEENDFPDSLEKLNKLLDACRGLGVEINPVVIDGLGIIPLFSWYHESFD 172
           +VPGNHDLWCR EE D  +SL+KLNKLLDAC+ LGV+ +P++IDGLGIIPLFSWYHESFD
Sbjct: 155 YVPGNHDLWCRREEEDSLNSLDKLNKLLDACKRLGVQTSPMIIDGLGIIPLFSWYHESFD 214

Query: 173 REKDISGIRILPLEMVI------------------------------------------- 189
           +E+DI+ + I  LEM                                             
Sbjct: 215 KEEDITEVFIPSLEMACKDFHACKWPEELSNRDTSLALYFDAMNEKNQDLIKEIQSECSQ 274

Query: 190 -----HFLFSLQDLCPEKRMLFYPNLPKIIGSDFLELRIRSIHGAMGSTSACHVFGHTHF 244
                HFL   Q+LCPEKRMLFYPNLPKIIGSDFLE+R+RSIHGA GS SACHVFGHTHF
Sbjct: 275 IITFSHFL-PRQELCPEKRMLFYPNLPKIIGSDFLEVRLRSIHGAEGSASACHVFGHTHF 333

Query: 245 SWDAVLDGIRYVQAPLAYPRERKRRMNGGENQLPYCVYSDGKFADKLSHCYWSDYYATNP 304
            WD++LDGIRYVQAPLAYPRERKRRMNGGE+ LP+C+Y DGKFADKL  C+WS+YY+TNP
Sbjct: 334 CWDSMLDGIRYVQAPLAYPRERKRRMNGGEDWLPFCIYCDGKFADKLMACFWSEYYSTNP 393

Query: 305 RSPDITELAPWVARFYNR 322
           R+P  T+LAPWVARFY R
Sbjct: 394 RTPHNTQLAPWVARFYKR 411

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356559987|ref|XP_003548277.1| PREDICTED: uncharacterized protein LOC100804790 [Glycine max] Back     alignment and taxonomy information
>gi|359489934|ref|XP_002267038.2| PREDICTED: uncharacterized protein LOC100261372 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224116564|ref|XP_002331928.1| predicted protein [Populus trichocarpa] gi|222874600|gb|EEF11731.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357499015|ref|XP_003619796.1| hypothetical protein MTR_6g069050 [Medicago truncatula] gi|355494811|gb|AES76014.1| hypothetical protein MTR_6g069050 [Medicago truncatula] Back     alignment and taxonomy information
>gi|449439733|ref|XP_004137640.1| PREDICTED: uncharacterized protein LOC101212697 [Cucumis sativus] gi|449514872|ref|XP_004164503.1| PREDICTED: uncharacterized LOC101212697 [Cucumis sativus] Back     alignment and taxonomy information
>gi|10140706|gb|AAG13540.1|AC023240_13 unknown protein [Oryza sativa Japonica Group] gi|31432820|gb|AAP54407.1| Ser/Thr protein phosphatase family protein, expressed [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|326531698|dbj|BAJ97853.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|357146790|ref|XP_003574112.1| PREDICTED: uncharacterized protein LOC100830649 isoform 1 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|326526305|dbj|BAJ97169.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query328
UNIPROTKB|O33337324 MT2864 "Uncharacterized protei 0.356 0.361 0.336 3.2e-14
UNIPROTKB|O33337 MT2864 "Uncharacterized protein" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
 Score = 155 (59.6 bits), Expect = 3.2e-14, Sum P(2) = 3.2e-14
 Identities = 42/125 (33%), Positives = 67/125 (53%)

Query:    54 VFVLSDLHTDYSENMTWVKCLSTTRHKKDVLLVAGDVAEKYDDFVLTMSLLKDRFQRVLF 113
             ++ +SDLHT +  N    + L  +    D L+VAGDVAE+ D+   ++ LL+ RF +V++
Sbjct:    17 LWAISDLHTGHLGNKPVAESLYPSS-PDDWLIVAGDVAERTDEIRWSLDLLRRRFAKVIW 75

Query:   114 VPGNHDLWCRGEENDFPDSLEKLNKLLDACRGLGVEIN----PVVIDGLG---IIPLFSW 166
             VPGNH+LW    +        + + L++ C  +GV       PV  +  G   I+P+F  
Sbjct:    76 VPGNHELWTTNRDPMQIFGRARYDYLVNMCDEMGVVTPEHPFPVWTERGGPATIVPMFLL 135

Query:   167 YHESF 171
             Y  SF
Sbjct:   136 YDYSF 140
GO:0005886 "plasma membrane" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00013850001
SubName- Full=Chromosome chr16 scaffold_10, whole genome shotgun sequence; (396 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query328
TIGR03729239 TIGR03729, acc_ester, putative phosphoesterase 6e-08
cd07404166 cd07404, MPP_MS158, Microscilla MS158 and related 2e-07
cd00838131 cd00838, MPP_superfamily, metallophosphatase super 4e-07
cd07385223 cd07385, MPP_YkuE_C, Bacillus subtilis YkuE and re 6e-07
pfam00149185 pfam00149, Metallophos, Calcineurin-like phosphoes 9e-07
cd07392188 cd07392, MPP_PAE1087, Pyrobaculum aerophilum PAE10 7e-05
COG1409301 COG1409, Icc, Predicted phosphohydrolases [General 2e-04
cd07400144 cd07400, MPP_YydB, Bacillus subtilis YydB and rela 2e-04
cd07393232 cd07393, MPP_DR1119, Deinococcus radiodurans DR111 2e-04
COG1408284 COG1408, COG1408, Predicted phosphohydrolases [Gen 3e-04
cd00840223 cd00840, MPP_Mre11_N, Mre11 nuclease, N-terminal m 6e-04
COG0622172 COG0622, COG0622, Predicted phosphoesterase [Gener 0.003
>gnl|CDD|163441 TIGR03729, acc_ester, putative phosphoesterase Back     alignment and domain information 
 Score = 52.3 bits (126), Expect = 6e-08
 Identities = 53/251 (21%), Positives = 82/251 (32%), Gaps = 53/251 (21%)

Query: 53  RVFVLSDLHTDY----SENMTWVKCLSTTRHKKDVLLVAGDVAEKYDD---FVLTMSLLK 105
           ++   SDLH D     +E M         + K D L +AGD++  +     F+  +  LK
Sbjct: 1   KIAFSSDLHIDLNHFDTEEMLETLAQYLKKQKIDHLHIAGDISNDFQRSLPFIEKLQELK 60

Query: 106 DRFQRVLFVPGNHDLWCRGEENDFPDSLEKLNKLLDACRGLGVEINPVVIDGLGIIPLFS 165
               +V F  GNHD+       +   +   L         L      +      II    
Sbjct: 61  G--IKVTFNAGNHDMLKDLTYEEIESNDSPLY--------LHNRFIDIPNTQWRIIGNNG 110

Query: 166 WYHESFDREKDISGI-----------RIL-PLEMVIHFLFSLQDLCPEKRMLFYPNLPKI 213
           WY  SF  +K    I           RI  P+         L+ L  +K++    N   I
Sbjct: 111 WYDYSFSNDKTSKEILRWKKSFWFDRRIKRPMSDPERTAIVLKQL--KKQLNQLDNKQVI 168

Query: 214 IGS------DFLEL----RIRSIHGAMGSTSACH-----------VFGHTHFSW-DAVLD 251
             +      DF+ +    R   +  A   +               +FGH H  +    + 
Sbjct: 169 FVTHFVPHRDFIYVPMDHRRFDMFNAFLGSQHFGQLLVKYEIKDVIFGHLHRRFGPLTIG 228

Query: 252 GIRYVQAPLAY 262
           G  Y   PL Y
Sbjct: 229 GTTYHNRPLGY 239

Members of this protein family belong to the larger family pfam00149 (calcineurin-like phosphoesterase), a family largely defined by small motifs of metal-chelating residues. The subfamily in this model shows a good but imperfect co-occurrence in species with domain TIGR03715 that defines a novel class of signal peptide typical of the accessory secretory system. Length = 239
>gnl|CDD|163647 cd07404, MPP_MS158, Microscilla MS158 and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163614 cd00838, MPP_superfamily, metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163628 cd07385, MPP_YkuE_C, Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>gnl|CDD|215750 pfam00149, Metallophos, Calcineurin-like phosphoesterase Back     alignment and domain information
>gnl|CDD|163635 cd07392, MPP_PAE1087, Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|224327 COG1409, Icc, Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>gnl|CDD|163643 cd07400, MPP_YydB, Bacillus subtilis YydB and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163636 cd07393, MPP_DR1119, Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|224326 COG1408, COG1408, Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>gnl|CDD|163616 cd00840, MPP_Mre11_N, Mre11 nuclease, N-terminal metallophosphatase domain Back     alignment and domain information
>gnl|CDD|223695 COG0622, COG0622, Predicted phosphoesterase [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 328
TIGR03729239 acc_ester putative phosphoesterase. Members of thi 99.93
cd07404166 MPP_MS158 Microscilla MS158 and related proteins, 99.9
PRK11148275 cyclic 3',5'-adenosine monophosphate phosphodieste 99.88
cd07392188 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel 99.87
cd07402240 MPP_GpdQ Enterobacter aerogenes GpdQ and related p 99.87
cd07388224 MPP_Tt1561 Thermus thermophilus Tt1561 and related 99.85
COG2129226 Predicted phosphoesterases, related to the Icc pro 99.85
cd07393232 MPP_DR1119 Deinococcus radiodurans DR1119 and rela 99.82
cd07396267 MPP_Nbla03831 Homo sapiens Nbla03831 and related p 99.77
cd07395262 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, 99.76
cd07397238 MPP_DevT Myxococcus xanthus DevT and related prote 99.74
cd07379135 MPP_239FB Homo sapiens 239FB and related proteins, 99.73
PRK11340271 phosphodiesterase YaeI; Provisional 99.73
PF14582255 Metallophos_3: Metallophosphoesterase, calcineurin 99.66
cd07400144 MPP_YydB Bacillus subtilis YydB and related protei 99.64
TIGR00040158 yfcE phosphoesterase, MJ0936 family. Members of th 99.63
PRK09453182 phosphodiesterase; Provisional 99.63
COG1768230 Predicted phosphohydrolase [General function predi 99.62
cd07401256 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metal 99.61
PF12850156 Metallophos_2: Calcineurin-like phosphoesterase su 99.6
cd00841155 MPP_YfcE Escherichia coli YfcE and related protein 99.58
cd07394178 MPP_Vps29 Homo sapiens Vps29 and related proteins, 99.57
cd07385223 MPP_YkuE_C Bacillus subtilis YkuE and related prot 99.54
COG1409301 Icc Predicted phosphohydrolases [General function 99.53
COG0622172 Predicted phosphoesterase [General function predic 99.52
cd07403129 MPP_TTHA0053 Thermus thermophilus TTHA0053 and rel 99.52
PRK05340241 UDP-2,3-diacylglucosamine hydrolase; Provisional 99.51
cd07399214 MPP_YvnB Bacillus subtilis YvnB and related protei 99.5
cd00840223 MPP_Mre11_N Mre11 nuclease, N-terminal metallophos 99.49
cd00839294 MPP_PAPs purple acid phosphatases of the metalloph 99.48
cd07383199 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase 99.45
PF00149200 Metallophos: Calcineurin-like phosphoesterase; Int 99.44
cd07378277 MPP_ACP5 Homo sapiens acid phosphatase 5 and relat 99.43
cd00844262 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-t 99.39
TIGR01854231 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase. 99.38
COG1408284 Predicted phosphohydrolases [General function pred 99.32
TIGR00583405 mre11 DNA repair protein (mre11). All proteins in 99.3
cd07390168 MPP_AQ1575 Aquifex aeolicus AQ1575 and related pro 99.27
PLN02533427 probable purple acid phosphatase 99.25
cd00842296 MPP_ASMase acid sphingomyelinase and related prote 99.25
cd00838131 MPP_superfamily metallophosphatase superfamily, me 99.24
cd08163257 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related 99.23
COG4186186 Predicted phosphoesterase or phosphohydrolase [Gen 99.22
cd08165156 MPP_MPPE1 human MPPE1 and related proteins, metall 99.2
PRK04036504 DNA polymerase II small subunit; Validated 99.18
cd07398217 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and relat 99.13
cd07386243 MPP_DNA_pol_II_small_archeal_C archeal DNA polymer 99.13
COG2908237 Uncharacterized protein conserved in bacteria [Fun 99.11
PRK09968218 serine/threonine-specific protein phosphatase 2; P 99.1
KOG3947305 consensus Phosphoesterases [General function predi 99.1
TIGR00619253 sbcd exonuclease SbcD. This family is based on the 99.02
PRK10966 407 exonuclease subunit SbcD; Provisional 99.0
COG0420390 SbcD DNA repair exonuclease [DNA replication, reco 98.97
PHA02546340 47 endonuclease subunit; Provisional 98.95
PRK00166275 apaH diadenosine tetraphosphatase; Reviewed 98.92
PHA02239235 putative protein phosphatase 98.85
TIGR03767496 P_acnes_RR metallophosphoesterase, PPA1498 family. 98.84
cd07384171 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and re 98.84
cd00845252 MPP_UshA_N_like Escherichia coli UshA-like family, 98.81
cd08166195 MPP_Cdc1_like_1 uncharacterized subgroup related t 98.8
cd07410277 MPP_CpdB_N Escherichia coli CpdB and related prote 98.8
TIGR00668279 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric 98.75
PRK11439218 pphA serine/threonine protein phosphatase 1; Provi 98.73
cd07424207 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do 98.73
cd07423234 MPP_PrpE Bacillus subtilis PrpE and related protei 98.73
cd07422257 MPP_ApaH Escherichia coli ApaH and related protein 98.72
PRK13625245 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision 98.63
cd07425208 MPP_Shelphs Shewanella-like phosphatases, metallop 98.59
cd07380150 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and re 98.59
TIGR00024225 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11 98.58
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 98.58
cd07391172 MPP_PF1019 Pyrococcus furiosus PF1019 and related 98.56
PTZ00422394 glideosome-associated protein 50; Provisional 98.53
cd00144225 MPP_PPP_family phosphoprotein phosphatases of the 98.52
cd07413222 MPP_PA3087 Pseudomonas aeruginosa PA3087 and relat 98.47
cd07406257 MPP_CG11883_N Drosophila melanogaster CG11883 and 98.47
cd07412288 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and 98.45
cd07408257 MPP_SA0022_N Staphylococcus aureus SA0022 and rela 98.44
TIGR03768 492 RPA4764 metallophosphoesterase, RPA4764 family. Th 98.43
KOG2310 646 consensus DNA repair exonuclease MRE11 [Replicatio 98.4
COG1311481 HYS2 Archaeal DNA polymerase II, small subunit/DNA 98.38
cd07421304 MPP_Rhilphs Rhilph phosphatases, metallophosphatas 98.32
KOG1378452 consensus Purple acid phosphatase [Carbohydrate tr 98.32
cd07411264 MPP_SoxB_N Thermus thermophilus SoxB and related p 98.28
KOG2679336 consensus Purple (tartrate-resistant) acid phospha 98.24
KOG2863 456 consensus RNA lariat debranching enzyme [RNA proce 98.2
KOG1432379 consensus Predicted DNA repair exonuclease SIA1 [G 98.19
cd07409281 MPP_CD73_N CD73 ecto-5'-nucleotidase and related p 98.08
KOG3770 577 consensus Acid sphingomyelinase and PHM5 phosphate 98.08
COG1407235 Predicted ICC-like phosphoesterases [General funct 98.02
cd07405285 MPP_UshA_N Escherichia coli UshA and related prote 97.93
smart00156271 PP2Ac Protein phosphatase 2A homologues, catalytic 97.89
KOG3662410 consensus Cell division control protein/predicted 97.84
PRK09558 551 ushA bifunctional UDP-sugar hydrolase/5'-nucleotid 97.78
cd07407282 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and 97.76
PRK09418 780 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 97.74
cd07416305 MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca 97.73
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 97.72
cd07415285 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein 97.68
cd07420321 MPP_RdgC Drosophila melanogaster RdgC and related 97.64
cd07414293 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme 97.63
TIGR01390 626 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphod 97.59
PTZ00480320 serine/threonine-protein phosphatase; Provisional 97.55
PTZ00239303 serine/threonine protein phosphatase 2A; Provision 97.55
PHA03008234 hypothetical protein; Provisional 97.53
PRK11907 814 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 97.53
KOG3325183 consensus Membrane coat complex Retromer, subunit 97.53
cd07418377 MPP_PP7 PP7, metallophosphatase domain. PP7 is a p 97.52
cd07417316 MPP_PP5_C PP5, C-terminal metallophosphatase domai 97.52
cd07419311 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a 97.52
PTZ00244294 serine/threonine-protein phosphatase PP1; Provisio 97.49
PRK09420 649 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosp 97.36
TIGR00282266 metallophosphoesterase, MG_246/BB_0505 family. A m 97.34
cd08162313 MPP_PhoA_N Synechococcus sp. strain PCC 7942 PhoA 97.33
cd07382255 MPP_DR1281 Deinococcus radiodurans DR1281 and rela 97.29
cd07387257 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2 97.28
TIGR01530 550 nadN NAD pyrophosphatase/5'-nucleotidase NadN. Thi 97.21
cd08164193 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related 97.05
PTZ00235291 DNA polymerase epsilon subunit B; Provisional 96.62
PF04042209 DNA_pol_E_B: DNA polymerase alpha/epsilon subunit 96.56
COG0737 517 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesteras 95.13
KOG0374331 consensus Serine/threonine specific protein phosph 94.94
cd07381239 MPP_CapA CapA and related proteins, metallophospha 94.63
KOG0371319 consensus Serine/threonine protein phosphatase 2A, 94.3
KOG0373306 consensus Serine/threonine specific protein phosph 94.06
KOG0372303 consensus Serine/threonine specific protein phosph 93.49
smart00854239 PGA_cap Bacterial capsule synthesis protein PGA_ca 92.15
KOG3818525 consensus DNA polymerase epsilon, subunit B [Repli 89.52
COG1692266 Calcineurin-like phosphoesterase [General function 86.26
KOG0375 517 consensus Serine-threonine phosphatase 2B, catalyt 85.36
KOG2476 528 consensus Uncharacterized conserved protein [Funct 84.72
PF06874 640 FBPase_2: Firmicute fructose-1,6-bisphosphatase; I 82.9
>TIGR03729 acc_ester putative phosphoesterase Back     alignment and domain information 
Probab=99.93  E-value=2.3e-25  Score=203.08  Aligned_cols=191  Identities=23%  Similarity=0.358  Sum_probs=125.0

Q ss_pred             EEEEEeCCCCCCccc------HHHHHHHhhcCCCCCEEEEcccccCCchhHHHHHHHHHh-cCCcEEEECCCCCCCCCCC
Q 042652           53 RVFVLSDLHTDYSEN------MTWVKCLSTTRHKKDVLLVAGDVAEKYDDFVLTMSLLKD-RFQRVLFVPGNHDLWCRGE  125 (328)
Q Consensus        53 ri~~iSDlH~~~~~~------~~~l~~l~~~~~~~D~li~~GDi~~~~~~~~~~~~~l~~-~~~~v~~V~GNHD~~~~~~  125 (328)
                      ||+++||+|++....      .++++.+  ++.++|+||++||+++.......+++.+.+ ...|+++|+||||++....
T Consensus         1 ki~~iSDlH~~~~~~~~~~~l~~~~~~~--~~~~~d~vv~~GDl~~~~~~~~~~~~~l~~~~~~pv~~v~GNHD~~~~~~   78 (239)
T TIGR03729         1 KIAFSSDLHIDLNHFDTEEMLETLAQYL--KKQKIDHLHIAGDISNDFQRSLPFIEKLQELKGIKVTFNAGNHDMLKDLT   78 (239)
T ss_pred             CEEEEEeecCCCCCCCHHHHHHHHHHHH--HhcCCCEEEECCccccchhhHHHHHHHHHHhcCCcEEEECCCCCCCCCCC
Confidence            689999999874321      2344545  456799999999999875444555666665 3579999999999873321


Q ss_pred             CCchhhHHHHHHHHHhcccccccccceEEE--cCEEEeccCCCCCCCCCCcccc-----------------cCC------
Q 042652          126 ENDFPDSLEKLNKLLDACRGLGVEINPVVI--DGLGIIPLFSWYHESFDREKDI-----------------SGI------  180 (328)
Q Consensus       126 ~~~~~~~~~~~~~l~~~~~~l~v~~~~~~i--~g~~iiG~~~w~~~~f~~e~~i-----------------~~~------  180 (328)
                         . ..   +..   ......+++..+.+  ++++|+|+++|++++|..+...                 ...      
T Consensus        79 ---~-~~---~~~---~~~~~~l~~~~~~~~~~~~~~ig~~gw~d~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~  148 (239)
T TIGR03729        79 ---Y-EE---IES---NDSPLYLHNRFIDIPNTQWRIIGNNGWYDYSFSNDKTSKEILRWKKSFWFDRRIKRPMSDPERT  148 (239)
T ss_pred             ---H-HH---HHh---ccchhhhcccccccCCCceEEEeeccceecccccccCHHHHHHhhhcEEeecccCCCCChHHHH
Confidence               1 11   111   00112234444445  8899999999999876431110                 000      


Q ss_pred             ----cc----------CCcceeeecccCcccccc-cccccCCCCCCCCCCcHHHHHHHHHhhcccCCCccEEEEcccccC
Q 042652          181 ----RI----------LPLEMVIHFLFSLQDLCP-EKRMLFYPNLPKIIGSDFLELRIRSIHGAMGSTSACHVFGHTHFS  245 (328)
Q Consensus       181 ----~~----------~~~~lv~H~p~P~~~~~~-~~~~~~~~~~~~~~gs~~l~~~l~~~~~~~~~~v~~~i~GH~H~~  245 (328)
                          .|          .+..++|||| |....++ ......|..+....|+..+.+.|++..      +++|||||+|.+
T Consensus       149 ~~~l~~l~~~l~~~~~~~~ivvtH~p-P~~~~~~~~~~~~~~~~~~~~~~s~~l~~li~~~~------v~~~i~GH~H~~  221 (239)
T TIGR03729       149 AIVLKQLKKQLNQLDNKQVIFVTHFV-PHRDFIYVPMDHRRFDMFNAFLGSQHFGQLLVKYE------IKDVIFGHLHRR  221 (239)
T ss_pred             HHHHHHHHHHHHhcCCCCEEEEEccc-chHHHhcCCCCCcchhhhhhccChHHHHHHHHHhC------CCEEEECCccCC
Confidence                00          1233889999 9865441 000001233345778888888888763      679999999999


Q ss_pred             C-ceEECCEEEEeccccC
Q 042652          246 W-DAVLDGIRYVQAPLAY  262 (328)
Q Consensus       246 ~-~~~~~g~~~v~~~~gy  262 (328)
                      . ..+++||+|++||+||
T Consensus       222 ~~~~~i~~~~~~~~~~gy  239 (239)
T TIGR03729       222 FGPLTIGGTTYHNRPLGY  239 (239)
T ss_pred             CCCEEECCEEEEecCCCC
Confidence            8 5678999999999998

Members of this protein family belong to the larger family pfam00149 (calcineurin-like phosphoesterase), a family largely defined by small motifs of metal-chelating residues. The subfamily in this model shows a good but imperfect co-occurrence in species with domain TIGR03715 that defines a novel class of signal peptide typical of the accessory secretory system.
>cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional Back     alignment and domain information
>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only] Back     alignment and domain information
>cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK11340 phosphodiesterase YaeI; Provisional Back     alignment and domain information
>PF14582 Metallophos_3: Metallophosphoesterase, calcineurin superfamily; PDB: 1UF3_B 2YVT_A Back     alignment and domain information
>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00040 yfcE phosphoesterase, MJ0936 family Back     alignment and domain information
>PRK09453 phosphodiesterase; Provisional Back     alignment and domain information
>COG1768 Predicted phosphohydrolase [General function prediction only] Back     alignment and domain information
>cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain Back     alignment and domain information
>PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [] Back     alignment and domain information
>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>COG1409 Icc Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>COG0622 Predicted phosphoesterase [General function prediction only] Back     alignment and domain information
>cd07403 MPP_TTHA0053 Thermus thermophilus TTHA0053 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional Back     alignment and domain information
>cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain Back     alignment and domain information
>cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain Back     alignment and domain information
>PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11 Back     alignment and domain information
>cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00844 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-terminal metallophosphatase domain Back     alignment and domain information
>TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase Back     alignment and domain information
>COG1408 Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>TIGR00583 mre11 DNA repair protein (mre11) Back     alignment and domain information
>cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>cd00842 MPP_ASMase acid sphingomyelinase and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG4186 Predicted phosphoesterase or phosphohydrolase [General function prediction only] Back     alignment and domain information
>cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK04036 DNA polymerase II small subunit; Validated Back     alignment and domain information
>cd07398 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain Back     alignment and domain information
>COG2908 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional Back     alignment and domain information
>KOG3947 consensus Phosphoesterases [General function prediction only] Back     alignment and domain information
>TIGR00619 sbcd exonuclease SbcD Back     alignment and domain information
>PRK10966 exonuclease subunit SbcD; Provisional Back     alignment and domain information
>COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02546 47 endonuclease subunit; Provisional Back     alignment and domain information
>PRK00166 apaH diadenosine tetraphosphatase; Reviewed Back     alignment and domain information
>PHA02239 putative protein phosphatase Back     alignment and domain information
>TIGR03767 P_acnes_RR metallophosphoesterase, PPA1498 family Back     alignment and domain information
>cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain Back     alignment and domain information
>cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain Back     alignment and domain information
>cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) Back     alignment and domain information
>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional Back     alignment and domain information
>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional Back     alignment and domain information
>cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain Back     alignment and domain information
>cd07380 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain Back     alignment and domain information
>PTZ00422 glideosome-associated protein 50; Provisional Back     alignment and domain information
>cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07406 MPP_CG11883_N Drosophila melanogaster CG11883 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07412 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07408 MPP_SA0022_N Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>TIGR03768 RPA4764 metallophosphoesterase, RPA4764 family Back     alignment and domain information
>KOG2310 consensus DNA repair exonuclease MRE11 [Replication, recombination and repair] Back     alignment and domain information
>COG1311 HYS2 Archaeal DNA polymerase II, small subunit/DNA polymerase delta, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>cd07421 MPP_Rhilphs Rhilph phosphatases, metallophosphatase domain Back     alignment and domain information
>KOG1378 consensus Purple acid phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07411 MPP_SoxB_N Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>KOG2679 consensus Purple (tartrate-resistant) acid phosphatase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2863 consensus RNA lariat debranching enzyme [RNA processing and modification] Back     alignment and domain information
>KOG1432 consensus Predicted DNA repair exonuclease SIA1 [General function prediction only] Back     alignment and domain information
>cd07409 MPP_CD73_N CD73 ecto-5'-nucleotidase and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>KOG3770 consensus Acid sphingomyelinase and PHM5 phosphate metabolism protein [Lipid transport and metabolism] Back     alignment and domain information
>COG1407 Predicted ICC-like phosphoesterases [General function prediction only] Back     alignment and domain information
>cd07405 MPP_UshA_N Escherichia coli UshA and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>KOG3662 consensus Cell division control protein/predicted DNA repair exonuclease [Replication, recombination and repair] Back     alignment and domain information
>PRK09558 ushA bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed Back     alignment and domain information
>cd07407 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PRK09418 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>cd07416 MPP_PP2B PP2B, metallophosphatase domain Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR01390 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphodiesterase Back     alignment and domain information
>PTZ00480 serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>PTZ00239 serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>PHA03008 hypothetical protein; Provisional Back     alignment and domain information
>PRK11907 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>KOG3325 consensus Membrane coat complex Retromer, subunit VPS29/PEP11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd07418 MPP_PP7 PP7, metallophosphatase domain Back     alignment and domain information
>cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>PTZ00244 serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>PRK09420 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein; Reviewed Back     alignment and domain information
>TIGR00282 metallophosphoesterase, MG_246/BB_0505 family Back     alignment and domain information
>cd08162 MPP_PhoA_N Synechococcus sp Back     alignment and domain information
>cd07382 MPP_DR1281 Deinococcus radiodurans DR1281 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07387 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2), C-terminal domain Back     alignment and domain information
>TIGR01530 nadN NAD pyrophosphatase/5'-nucleotidase NadN Back     alignment and domain information
>cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain Back     alignment and domain information
>PTZ00235 DNA polymerase epsilon subunit B; Provisional Back     alignment and domain information
>PF04042 DNA_pol_E_B: DNA polymerase alpha/epsilon subunit B; InterPro: IPR007185 DNA polymerase epsilon is essential for cell viability and chromosomal DNA replication in budding yeast Back     alignment and domain information
>COG0737 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0374 consensus Serine/threonine specific protein phosphatase PP1, catalytic subunit [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>cd07381 MPP_CapA CapA and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG0371 consensus Serine/threonine protein phosphatase 2A, catalytic subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0373 consensus Serine/threonine specific protein phosphatase involved in cell cycle control, PP2A-related [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>KOG0372 consensus Serine/threonine specific protein phosphatase involved in glycogen accumulation, PP2A-related [Carbohydrate transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>smart00854 PGA_cap Bacterial capsule synthesis protein PGA_cap Back     alignment and domain information
>KOG3818 consensus DNA polymerase epsilon, subunit B [Replication, recombination and repair] Back     alignment and domain information
>COG1692 Calcineurin-like phosphoesterase [General function prediction only] Back     alignment and domain information
>KOG0375 consensus Serine-threonine phosphatase 2B, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG2476 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06874 FBPase_2: Firmicute fructose-1,6-bisphosphatase; InterPro: IPR009164 Fructose 1,6-bisphosphatase catalyses the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query328
1uf3_A228 Hypothetical protein TT1561; metallo-dependent pho 2e-07
3rl5_A296 Metallophosphoesterase mpped2; alpha-beta fold, me 4e-07
2yvt_A260 Hypothetical protein AQ_1956; structural genomics, 1e-05
1su1_A208 Hypothetical protein YFCE; structural genomics, ph 1e-04
3ib7_A330 ICC protein; metallophosphoesterase, alpha-beta fo 2e-04
2xmo_A443 LMO2642 protein; phosphodiesterase, hydrolase; 1.7 4e-04
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Length = 228 Back     alignment and structure
 Score = 50.1 bits (119), Expect = 2e-07
 Identities = 25/205 (12%), Positives = 63/205 (30%), Gaps = 23/205 (11%)

Query: 53  RVFVLSDLHTDYSENMTWVKCLSTTRHKKDVLLVAGDV---AEKYDDFVLTMSLLKDRFQ 109
            +   S+   D      +VK         D + + G++   A K  D+     +L +   
Sbjct: 7   YILATSNPMGDLEALEKFVKLAP--DTGADAIALIGNLMPKAAKSRDYAAFFRILSEAHL 64

Query: 110 RVLFVPGNHDLWCRGEENDFPDSLEKLNKLLDACRGLGVEINPVVIDGLGIIPLFSWYHE 169
              +VPG  D        +  +      ++ +          P ++ G+G         E
Sbjct: 65  PTAYVPGPQDAPIWEYLREAANVELVHPEMRNVHETFTFWRGPYLVAGVGGEIADEGEPE 124

Query: 170 SFDREKDISGIRILPLEMVIHFLFSLQDLCPEKRMLFYPNLPKI-----IGSDFLELRIR 224
             +  +  + +    L+       +L +L    ++  +  +P        GS  +   I+
Sbjct: 125 EHEALRYPAWVAEYRLK-------ALWELKDYPKIFLFHTMPYHKGLNEQGSHEVAHLIK 177

Query: 225 SIHGAMGSTSACHVFGHTHFSWDAV 249
           + +  +       +        + +
Sbjct: 178 THNPLL------VLVAGKGQKHEML 196
>3rl5_A Metallophosphoesterase mpped2; alpha-beta fold, metallophosphodiesterase, active site mutan nucleotide polymorphism, hydrolase; 1.26A {Rattus norvegicus} PDB: 3rl3_A* 3rl4_A* Length = 296 Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 Length = 260 Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Length = 208 Back     alignment and structure
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Length = 330 Back     alignment and structure
>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} Length = 443 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query328
3rl5_A296 Metallophosphoesterase mpped2; alpha-beta fold, me 99.87
2yvt_A260 Hypothetical protein AQ_1956; structural genomics, 99.84
3ib7_A330 ICC protein; metallophosphoesterase, alpha-beta fo 99.84
1uf3_A228 Hypothetical protein TT1561; metallo-dependent pho 99.83
3d03_A274 Phosphohydrolase; glycerophosphodiesterase, metall 99.82
2nxf_A322 Putative dimetal phosphatase; dinuclear metal cent 99.74
1z2w_A192 Vacuolar protein sorting 29; VPS29, retromer, phos 99.73
2a22_A215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha 99.71
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nu 99.69
1xm7_A195 Hypothetical protein AQ_1665; structural genomics, 99.68
1nnw_A252 Hypothetical protein; structural genomics, PSI, pr 99.68
3ck2_A176 Conserved uncharacterized protein (predicted phosp 99.67
2xmo_A443 LMO2642 protein; phosphodiesterase, hydrolase; 1.7 99.6
3qfm_A270 SAPH, putative uncharacterized protein; sandwich f 99.6
2kkn_A178 Uncharacterized protein; protein phosphatase 2A ho 99.59
1su1_A208 Hypothetical protein YFCE; structural genomics, ph 99.56
3rqz_A246 Metallophosphoesterase; PSI-biology, midwest cente 99.55
3av0_A386 DNA double-strand break repair protein MRE11; DNA 99.53
2q8u_A336 Exonuclease, putative; structural genomics, joint 99.44
3tgh_A342 Glideosome-associated protein 50; phosphatase fold 99.41
1xzw_A426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 99.4
1ute_A313 Protein (II purple acid phosphatase); tartrate res 99.38
2qfp_A424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 99.38
4fbk_A472 DNA repair and telomere maintenance protein NBS1, 99.38
1ii7_A333 MRE11 nuclease; RAD50, DNA double-strand break rep 99.37
3tho_B379 Exonuclease, putative; adenosine triphosphate, bac 99.36
3t1i_A431 Double-strand break repair protein MRE11A; DNA rep 99.33
4fbw_A417 DNA repair protein RAD32; DNA double-strand break 99.33
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 99.26
1hp1_A 516 5'-nucleotidase; metallophosphatase, dinuclear, me 98.81
2dfj_A280 Diadenosinetetraphosphatase; helices and strands m 98.79
2qjc_A262 Diadenosine tetraphosphatase, putative; putative d 98.78
3qfk_A 527 Uncharacterized protein; structural genomics, cent 98.74
2z72_A342 Protein-tyrosine-phosphatase; cold-active enzyme, 98.47
2ie4_C309 PP2A-alpha;, serine/threonine-protein phosphatase 98.44
2z1a_A 552 5'-nucleotidase; metal-binding, nucleotide-binding 98.44
3ive_A 509 Nucleotidase; structural genomics, PSI-2, protein 98.43
1fjm_A330 Protein serine/threonine phosphatase-1 (alpha ISO 98.39
3h63_A315 Serine/threonine-protein phosphatase 5; metalloenz 98.35
2wdc_A 562 SOXB, sulfur oxidation protein SOXB; sulfur-sulfur 98.34
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 98.3
3icf_A335 PPT, serine/threonine-protein phosphatase T; IRO m 98.29
3e7a_A299 PP-1A, serine/threonine-protein phosphatase PP1-al 98.22
3ztv_A 579 NAD nucleotidase, NADN; hydrolase, NAD pyrophospha 98.22
3ll8_A357 Serine/threonine-protein phosphatase 2B catalytic 98.14
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 98.07
3c9f_A 557 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, p 97.84
2yeq_A 527 Apased, PHOD, alkaline phosphatase D; hydrolase, p 97.58
3e0j_A476 DNA polymerase subunit delta-2; DNA polymerase del 97.5
1t71_A281 Phosphatase, conserved HYPO; crystal, X-RAY crysta 97.43
2z06_A252 Putative uncharacterized protein TTHA0625; metal b 97.36
1t70_A255 Phosphatase; crystal, X-RAY crystallography, struc 97.34
4h2g_A 546 5'-nucleotidase; dimer, hydrolase, phosphatase, ex 97.2
3jyf_A339 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- n 96.34
3gve_A341 YFKN protein; alpha-beta-BETA-alpha sandwich, stru 96.3
4h1s_A 530 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo 94.83
3flo_A460 DNA polymerase alpha subunit B; protein-protein co 93.57
>3rl5_A Metallophosphoesterase mpped2; alpha-beta fold, metallophosphodiesterase, active site mutan nucleotide polymorphism, hydrolase; 1.26A {Rattus norvegicus} PDB: 3rl3_A* 3rl4_A* Back     alignment and structure
Probab=99.87  E-value=3.2e-21  Score=179.27  Aligned_cols=206  Identities=18%  Similarity=0.181  Sum_probs=133.6

Q ss_pred             eeeeceeecCCcccCCCCCCCcEEEEEeCCCCCCcccHHHHHHHhhcCCCCCEEEEcccccCCc--hhHHHHHHHHHhcC
Q 042652           31 TTRRPEILTSSAAASSTSASGLRVFVLSDLHTDYSENMTWVKCLSTTRHKKDVLLVAGDVAEKY--DDFVLTMSLLKDRF  108 (328)
Q Consensus        31 ~v~~~~i~~~~~~~~~~~~~~~ri~~iSDlH~~~~~~~~~l~~l~~~~~~~D~li~~GDi~~~~--~~~~~~~~~l~~~~  108 (328)
                      .|+.+....+.+|   +..++|||+++||+|......         ...++|+||++||+++.+  ++++.++++|+++.
T Consensus        42 ~~~~~~~~~~~~p---~~~~~mri~~iSD~H~~~~~l---------~i~~~D~vi~aGDl~~~g~~~e~~~~~~~L~~l~  109 (296)
T 3rl5_A           42 HVHMVDPIPYDTP---KPAGHTRFVCISDTRSRTDGI---------QMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLP  109 (296)
T ss_dssp             TSEECCCCCTTSC---CCTTEEEEEEEBCCTTCCTTC---------CCCSCSEEEECSCCSSSCCHHHHHHHHHHHHTSC
T ss_pred             ceeecccCCCCCC---CCCCCeEEEEEeeCCCCcchh---------ccCCCCEEEECCcccCCCCHHHHHHHHHHHHhCC
Confidence            3677777778888   778899999999999976531         235799999999999975  46788899999885


Q ss_pred             -CcEEEECCCCCCCCCCCCCchhhHH-----------HHH--HH---HHh-cccccccccceEEEcCEEEeccCC--CC-
Q 042652          109 -QRVLFVPGNHDLWCRGEENDFPDSL-----------EKL--NK---LLD-ACRGLGVEINPVVIDGLGIIPLFS--WY-  167 (328)
Q Consensus       109 -~~v~~V~GNHD~~~~~~~~~~~~~~-----------~~~--~~---l~~-~~~~l~v~~~~~~i~g~~iiG~~~--w~-  167 (328)
                       .++++|+||||++....   +.+.+           .+.  ..   ... ......++++.++++|++|.|...  ++ 
T Consensus       110 ~~~v~~V~GNHD~~~d~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~L~~~~~~i~Gl~i~Gsp~tP~~~  186 (296)
T 3rl5_A          110 YEYKIVIAGNHELTFDKE---FMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFN  186 (296)
T ss_dssp             CSEEEECCCTTCGGGCHH---HHHHHTTSCGGGSHHHHTCCHHHHTTTGGGCTTSEECSSEEEEETTEEEEEECCBCC--
T ss_pred             CCeEEEEcCCcccccchh---hhhhhhcccccccccccccccchhhhHhhhcCCeEEecCCcEEECCEEEEEecCCCCCC
Confidence             56999999999975421   11110           000  00   000 011235678889999999999543  11 


Q ss_pred             CCCCCCcc--c-ccCCc-cC--CcceeeecccCcccccccccccCCCCCCCCCCcHHHHHHHH-HhhcccCCCccEEEEc
Q 042652          168 HESFDREK--D-ISGIR-IL--PLEMVIHFLFSLQDLCPEKRMLFYPNLPKIIGSDFLELRIR-SIHGAMGSTSACHVFG  240 (328)
Q Consensus       168 ~~~f~~e~--~-i~~~~-~~--~~~lv~H~p~P~~~~~~~~~~~~~~~~~~~~gs~~l~~~l~-~~~~~~~~~v~~~i~G  240 (328)
                      ...|..+.  . ...+. .+  ...+++|.| |........      .-....|++.+.+.++ +..      +++++||
T Consensus       187 ~~~f~~~~~~~~~~~~~~ip~~~dILvTH~P-P~g~~D~~~------~~~~~~G~~~L~~~i~~~~~------p~l~v~G  253 (296)
T 3rl5_A          187 GWGFNLPRGQSLLDKWNLIPEGTDILMTHGP-PLGFRDWVP------KELQRVGCVELLNTVQRRVR------PKLHVFG  253 (296)
T ss_dssp             CCTTBCCTTHHHHHHHTTSCTTCSEEEESSC-BTTSSCEEG------GGTEECSBHHHHHHHHHTTC------CSEEEEC
T ss_pred             CcCCCcchHHHHHHHHhhCCCCCeEEEECCC-ccccccccc------cccCcCChHHHHHHHHHhcC------CCEEEEC
Confidence            12232211  0 01111 11  234889999 986422110      0133679999988884 554      5699999


Q ss_pred             ccccCCce-EECCEEEEec-cccChh
Q 042652          241 HTHFSWDA-VLDGIRYVQA-PLAYPR  264 (328)
Q Consensus       241 H~H~~~~~-~~~g~~~v~~-~~gy~~  264 (328)
                      |+|.+... .++++.++|+ +.+.+.
T Consensus       254 H~H~~~~~~~~g~t~vvNpGs~~~~~  279 (296)
T 3rl5_A          254 GIHEGYGTMTDGYTTYINASTCTVSF  279 (296)
T ss_dssp             SCGGGCEEEECSSCEEEECBCSCTTS
T ss_pred             CccCCCceEEECCEEEEECCcCCcCc
Confidence            99999875 4688899887 445544
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 Back     alignment and structure
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Back     alignment and structure
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A Back     alignment and structure
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Back     alignment and structure
>1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Back     alignment and structure
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 Back     alignment and structure
>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 Back     alignment and structure
>3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A* Back     alignment and structure
>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A Back     alignment and structure
>3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A* Back     alignment and structure
>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A Back     alignment and structure
>3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C Back     alignment and structure
>3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens} Back     alignment and structure
>4fbw_A DNA repair protein RAD32; DNA double-strand break repair, nuclease, hydrolase; HET: DNA; 2.20A {Schizosaccharomyces pombe} PDB: 4fcx_B* Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Back     alignment and structure
>1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Back     alignment and structure
>3qfk_A Uncharacterized protein; structural genomics, center for structural genomics of infec diseases, csgid, phosphoesterase, hydrolase; HET: MSE AKG; 2.05A {Staphylococcus aureus subsp} Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Back     alignment and structure
>2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>3ive_A Nucleotidase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: CTN; 1.70A {Escherichia coli O6} PDB: 3ivd_A* Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Back     alignment and structure
>2wdc_A SOXB, sulfur oxidation protein SOXB; sulfur-sulfur hydrolysis, sulfur oxidation pathway, Cys S-thiosulfonate, hydrolase; 1.50A {Thermus thermophilus} PDB: 2wdd_A* 2wde_A 2wdf_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Back     alignment and structure
>3ztv_A NAD nucleotidase, NADN; hydrolase, NAD pyrophosphatase, NMN nucleotidase, periplasmi enzyme, CD73; HET: ADN; 1.30A {Haemophilus influenzae} PDB: 3zu0_A* Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Back     alignment and structure
>3c9f_A 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protein STR initiative, PSI-2, NEW YORK SGX research center for structu genomics, nysgxrc; 1.90A {Candida albicans} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>2yeq_A Apased, PHOD, alkaline phosphatase D; hydrolase, phosphodiesterase; HET: PE5; 1.93A {Bacillus subtilis} Back     alignment and structure
>3e0j_A DNA polymerase subunit delta-2; DNA polymerase delta, P66 subunit, P50 subunit, human, DNA replication, DNA-directed DNA polymerase; HET: DNA; 3.00A {Homo sapiens} Back     alignment and structure
>1t71_A Phosphatase, conserved HYPO; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129} SCOP: d.159.1.9 Back     alignment and structure
>2z06_A Putative uncharacterized protein TTHA0625; metal binding protein, structural genomics, NPPSFA; 2.20A {Thermus thermophilus} SCOP: d.159.1.10 PDB: 2cv9_A Back     alignment and structure
>1t70_A Phosphatase; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI, protein STR initiative; 2.30A {Deinococcus radiodurans} SCOP: d.159.1.9 Back     alignment and structure
>4h2g_A 5'-nucleotidase; dimer, hydrolase, phosphatase, extracellular; HET: ADN; 1.55A {Homo sapiens} PDB: 4h2f_A* 4h1y_P* 4h2i_A* 4h1s_A* 4h2b_A* Back     alignment and structure
>3jyf_A 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleotidase bifunctional periplasmic...; APC63187.2; HET: EPE TAM; 2.43A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3gve_A YFKN protein; alpha-beta-BETA-alpha sandwich, structural genomics, PSI-2, structure initiative; HET: CIT; 1.25A {Bacillus subtilis subsp} Back     alignment and structure
>4h1s_A 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>3flo_A DNA polymerase alpha subunit B; protein-protein complex, phosphoesterase fold, OB fold, zinc motif, DNA replication, nucleus; HET: DNA; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 328
d1uf3a_228 d.159.1.6 (A:) Hypothetical protein TT1561 {Thermu 3e-05
d1ii7a_333 d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus 0.004
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Length = 228 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: TT1561-like
domain: Hypothetical protein TT1561
species: Thermus thermophilus [TaxId: 274]

 Score = 42.4 bits (98), Expect = 3e-05
 Identities = 27/218 (12%), Positives = 56/218 (25%), Gaps = 17/218 (7%)

Query: 53  RVFVLSDLHTDYSENMTWVKCLSTTRHKK-DVLLVAGDVAEK---YDDFVLTMSLLKDRF 108
            +   S+   D        K +        D + + G++  K     D+     +L +  
Sbjct: 7   YILATSNPMGDLE---ALEKFVKLAPDTGADAIALIGNLMPKAAKSRDYAAFFRILSEAH 63

Query: 109 QRVLFVPGNHDLWCRGEENDFPDSLEKLNKLLDACRGLGVEINPVVIDGLGIIPLFSWYH 168
               +VPG  D        +  +      ++ +          P ++ G+G         
Sbjct: 64  LPTAYVPGPQDAPIWEYLREAANVELVHPEMRNVHETFTFWRGPYLVAGVG----GEIAD 119

Query: 169 ESFDREKDISGIRILPLEMVIHFLFSLQDLCPEKRMLFYPNLPKIIGSDFLELRIRSIHG 228
           E    E +         E  +  L+ L+D  P+  +       K +           I  
Sbjct: 120 EGEPEEHEALRYPAWVAEYRLKALWELKD-YPKIFLFHTMPYHKGLNEQGSHEVAHLIKT 178

Query: 229 AMGSTSACHVFGHTHFSWDAVLDGIRYVQAPLAYPRER 266
                             + +  G  +V  P       
Sbjct: 179 HNPLLVLV---AGKGQKHEML--GASWVVVPGDLSEGE 211
>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 333 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query328
d2hy1a1256 Rv0805 cyclic nucleotide phosphodiesterase {Mycoba 99.87
d3d03a1271 Glycerophosphodiesterase GpdQ {Enterobacter aeroge 99.83
d1uf3a_228 Hypothetical protein TT1561 {Thermus thermophilus 99.81
d2yvta1257 Uncharacterized protein Aq_1956 {Aquifex aeolicus 99.81
d1z2wa1182 Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus 99.7
d1s3la_165 Putative phosphodiesterase MJ0936 {Methanococcus j 99.68
d2a22a1193 Vacuolar protein sorting 29, VPS29 {Cryptosporidiu 99.65
d1nnwa_251 Hypothetical protein PF1291 {Archaeon Pyrococcus f 99.62
d3ck2a1173 Uncharacterized protein SP1879 {Streptococcus pneu 99.59
d2nxfa1320 Uncharacterized C17orf48 homolog zgc:64213 {Zebraf 99.55
d1su1a_184 Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 99.51
d1xm7a_188 Hypothetical protein aq_1666 {Aquifex aeolicus [Ta 99.48
d1ii7a_333 Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.46
d2qfra2312 Plant purple acid phosphatase, catalytic domain {K 99.3
d1utea_302 Mammalian purple acid phosphatase {Pig (Sus scrofa 99.0
d1g5ba_219 lambda ser/thr protein phosphatase {Bacteriophage 98.63
d1usha2337 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 98.32
d3c9fa2322 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 97.91
d3c5wc1288 Protein phosphatase 2A catalytic subunit alpha iso 97.01
d1jk7a_294 Protein phosphatase-1 (PP-1) {Human (Homo sapiens) 96.97
d1s95a_324 Serine/threonine protein phosphatase 5, PP5 {Human 96.87
d1auia_ 473 Protein phosphatase-2B (PP-2B, calcineurin A subun 96.84
d2z1aa2302 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 95.77
>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: GpdQ-like
domain: Rv0805 cyclic nucleotide phosphodiesterase
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=99.87  E-value=6.1e-22  Score=177.51  Aligned_cols=215  Identities=21%  Similarity=0.239  Sum_probs=124.9

Q ss_pred             CcEEEEEeCCCCCCcc------------cHHHHHHHhhcCCCCCEEEEcccccCCc--hhHHHHHHHHH----hcCCcEE
Q 042652           51 GLRVFVLSDLHTDYSE------------NMTWVKCLSTTRHKKDVLLVAGDVAEKY--DDFVLTMSLLK----DRFQRVL  112 (328)
Q Consensus        51 ~~ri~~iSDlH~~~~~------------~~~~l~~l~~~~~~~D~li~~GDi~~~~--~~~~~~~~~l~----~~~~~v~  112 (328)
                      .|||++|||+|+....            .+++++.+.+...++|+||++||+++.+  ++++.+.+.++    ++..|++
T Consensus         4 ~~~i~~iSD~Hl~~~~~~~~~~~~~~~~l~~~i~~i~~~~~~pD~vl~~GDl~~~g~~~~~~~~~~~l~~~~~~~~~p~~   83 (256)
T d2hy1a1           4 DYVLLHISDTHLIGGDRRLYGAVDADDRLGELLEQLNQSGLRPDAIVFTGDLADKGEPAAYRKLRGLVEPFAAQLGAELV   83 (256)
T ss_dssp             SEEEEEECCCCBC----------CHHHHHHHHHHHHHHHTCCCSEEEECSCCBSSCCHHHHHHHHHHHHHHHHHHTCEEE
T ss_pred             CEEEEEEeeCccCCCCcccccCcCHHHHHHHHHHHHHhcCCCCCEEEECCCCCCCCChhHHHHHHHHhhhhhhhcCCCEE
Confidence            5999999999985421            1233444433467899999999999875  34444444443    4578999


Q ss_pred             EECCCCCCCCCCCCCchhhHHHHHHHHHhcccccccccceEEEcCEEEeccCCCCC-CCCC--Cc-------ccccCCcc
Q 042652          113 FVPGNHDLWCRGEENDFPDSLEKLNKLLDACRGLGVEINPVVIDGLGIIPLFSWYH-ESFD--RE-------KDISGIRI  182 (328)
Q Consensus       113 ~V~GNHD~~~~~~~~~~~~~~~~~~~l~~~~~~l~v~~~~~~i~g~~iiG~~~w~~-~~f~--~e-------~~i~~~~~  182 (328)
                      +|+||||..         ..+.+  .+.+.....+.....+.+++++|+++++... ..++  .+       +.+....-
T Consensus        84 ~v~GNHD~~---------~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~ldt~~~~~~~g~~~~~~~~wl~~~L~~~~~  152 (256)
T d2hy1a1          84 WVMGNHDDR---------AELRK--FLLDEAPSMAPLDRVCMIDGLRIIVLDTSVPGHHHGEIRASQLGWLAEELATPAP  152 (256)
T ss_dssp             ECCCTTSCH---------HHHHH--HTTCCCCCCSCCCEEEEETTEEEEECCCBCTTCSSBCCCHHHHHHHHHHHTSCCT
T ss_pred             EEcccccch---------hhhhh--hhccccccccccceEEEecccceeeeeeeecCCcCCcccHHHHHHHHHHHHhhhc
Confidence            999999942         11111  1111122222224567889999999876322 1111  11       11221112


Q ss_pred             CCcceeeecccCcccccccccccCCCCCCCCCCcHHHHHHHHHhhcccCCCccEEEEcccccCCceEECCEEEEec-ccc
Q 042652          183 LPLEMVIHFLFSLQDLCPEKRMLFYPNLPKIIGSDFLELRIRSIHGAMGSTSACHVFGHTHFSWDAVLDGIRYVQA-PLA  261 (328)
Q Consensus       183 ~~~~lv~H~p~P~~~~~~~~~~~~~~~~~~~~gs~~l~~~l~~~~~~~~~~v~~~i~GH~H~~~~~~~~g~~~v~~-~~g  261 (328)
                      .+..+++||| |.........      .....+++.+.+.+++.      ++++++|||+|......++|++++++ +.+
T Consensus       153 ~~~iv~~Hhp-p~~~~~~~~~------~~~~~~~~~~~~i~~~~------~v~~~~~GH~H~~~~~~~~gi~~~~~~s~~  219 (256)
T d2hy1a1         153 DGTILALHHP-PIPSVLDMAV------TVELRDQAALGRVLRGT------DVRAILAGHLHYSTNATFVGIPVSVASATC  219 (256)
T ss_dssp             TCEEEECSSC-SSCCSSHHHH------TTSBCCHHHHHHHHTTS------SEEEEEECSSSSCEEEEETTEEEEECCCCC
T ss_pred             cCceeeeecC-Cccccccccc------ccccccHHHHHHHHhcc------CceEEEccccchhhceEECCEEEEEcCCcc
Confidence            2345889999 8764433211      01123445555554443      58899999999999999999998865 556


Q ss_pred             Chhh---h---hcccCCCCCCcceEEecCCcccc
Q 042652          262 YPRE---R---KRRMNGGENQLPYCVYSDGKFAD  289 (328)
Q Consensus       262 y~~~---~---~~~~~~~~g~~~~~l~~dg~~~~  289 (328)
                      |+..   .   ..-....+||+.+.|++||-+.+
T Consensus       220 ~~~~~~~~~~~~~~~~~~~g~~lv~v~~d~~~~~  253 (256)
T d2hy1a1         220 YTQDLTVAAGGTRGRDGAQGCNLVHVYPDTVVHS  253 (256)
T ss_dssp             -------------------CEEEEEECSSCEEEE
T ss_pred             ccccccCCCCCcccccCCCCEEEEEEECCCEEEE
Confidence            6543   1   11223477999999999995544
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d1usha2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c9fa2 d.159.1.2 (A:16-337) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Candida albicans [TaxId: 5476]} Back     information, alignment and structure
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Back     information, alignment and structure
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z1aa2 d.159.1.2 (A:28-329) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure