Citrus Sinensis ID: 042656

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
TNRCEIHYTGPISDPSLTVGASSRSLHNSLLPLAVHTNICKYQGLPFRYFGQLIGHDPPFKEDSVRLPFPNFYYAVEDIAASYSPAVTYSVHRSSIIIGASSRSLNNSLLTLAVYATICRHQGLPFRYLAIHGSSLSGNKYTWEHFCDMSDSRVLAEQQIWAATTDRAKNQAFNCTNGDVFTWKSLWKLLSEIFDVEFVPFDEKEKFDVVEMMEEKGEIWDEIVEKHGLYKTKMEEITCFEALNTVLHLQFQHVSSMNKSREFGFFGFVDTMKSIRTWVKKLREMKIIP
ccccEEEEEccccccHHHHHHHHHHHHHHHHHHccccccEEEcccccEEEcccccccccccccccccccccccHHHHHHHHHcccccccEEEccccEEEcccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHccccccccHHHHHHHcccccccHHHHHHHHHHHHHHccccc
ccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHccEEEccccHHHHccccccccccccccccccccccHHHHHHHHHHHHcccEEEEEcccEEEEcccccHHHHHHHHHHHHHHHHHccccEEEcccccccccccHHHHHHHHHHccHHHHHHHHHHHHccHHHHcccEEccccccEcHHHHHHHHHHHcccccccccccccccHHHHHHccHHHHHHHHHHcccccccHHHHHcccHHccccccccHHcccHHHHHHcccccccccHHHHHHHHHHHHHccccc
tnrceihytgpisdpsltvgassrslhnSLLPLAVHTnickyqglpfryfgqlighdppfkedsvrlpfpnfyyAVEDiaasyspavtysvHRSSIIIGASSRSLNNSLLTLAVYATICrhqglpfrylaihgsslsgnkytwehfcdmsdsRVLAEQQIWAATTDRaknqafnctngdvfTWKSLWKLLSEIfdvefvpfdekekFDVVEMMEEKGEIWDEIVEKHGLYKTKMEEITCFEALNTVLHLQFQHVSsmnksrefgffGFVDTMKSIRTWVKKLREMKIIP
tnrceihytgpisdpsltVGASSRSLHNSLLPLAVHTNICKYQGLPFRYFGQLIGHDPPFKEDSVRLPFPNFYYAVEDIAASYSPAVTYSVHRSSIIIGASSRSLNNSLLTLAVYATICRHQGLPFRYLAIHGSSLSGNKYTWEHFCDMSDSRVLAEQQIWAATTDRAKNQAFNCTNGDVFTWKSLWKLLSEIFdvefvpfdeKEKFDVVEMMEEKGEIWDEIVEKHGLYKTKMEEITCFEALNTVLHLQFQHVSSMNKSREFGFFGFVDTMKSIRTWVKKlremkiip
TNRCEIHYTGPISDPSLTVGASSRSLHNSLLPLAVHTNICKYQGLPFRYFGQLIGHDPPFKEDSVRLPFPNFYYAVEDIAASYSPAVTYSVHrssiiigassrslnnslltlAVYATICRHQGLPFRYLAIHGSSLSGNKYTWEHFCDMSDSRVLAEQQIWAATTDRAKNQAFNCTNGDVFTWKSLWKLLSEIFDVEFVPFDEKEKFDVVEMMEEKGEIWDEIVEKHGLYKTKMEEITCFEALNTVLHLQFQHVSSMNKSREFGFFGFVDTMKSIRTWVKKLREMKIIP
*************************LHNSLLPLAVHTNICKYQGLPFRYFGQLIGHDPPFKEDSVRLPFPNFYYAVEDIAASYSPAVTYSVHRSSIIIGASSRSLNNSLLTLAVYATICRHQGLPFRYLAIHGSSLSGNKYTWEHFCDMSDSRVLAEQQIWAATTDRAKNQAFNCTNGDVFTWKSLWKLLSEIFDVEFVPFDEKEKFDVVEMMEEKGEIWDEIVEKHGLYKTKMEEITCFEALNTVLHLQFQHVSSMNKSREFGFFGFVDTMKSIRTWVKKLR******
TNRCEIHYTGPISDPSLTVGASSRSLHNSLLPLAVHTNICKYQGLPFRYFGQLIGHDPPFKEDSVRLPFPNFYYAVEDIAASYSPAVTYSVHRSSIIIGASSRSLNNSLLTLAVYATICRHQGLPFRYLAIHGSSLSGNKYTWEHFCDMSDSRVLAEQQIWAATTDRAKNQAFNCTNGDVFTWKSLWKLLSEIFDVEFVPFDEKEKFDVVEMMEEKGEIWDEIVEKHGLYKTKMEEITCFEALNTVLHLQFQHVSSMNKSREFGFFGFVDTMKSIRTWVKKLREMKIIP
TNRCEIHYTGPISDPSLTVGASSRSLHNSLLPLAVHTNICKYQGLPFRYFGQLIGHDPPFKEDSVRLPFPNFYYAVEDIAASYSPAVTYSVHRSSIIIGASSRSLNNSLLTLAVYATICRHQGLPFRYLAIHGSSLSGNKYTWEHFCDMSDSRVLAEQQIWAATTDRAKNQAFNCTNGDVFTWKSLWKLLSEIFDVEFVPFDEKEKFDVVEMMEEKGEIWDEIVEKHGLYKTKMEEITCFEALNTVLHLQFQHVSSMNKSREFGFFGFVDTMKSIRTWVKKLREMKIIP
TNRCEIHYTGPISDPSLTVGASSRSLHNSLLPLAVHTNICKYQGLPFRYFGQLIGHDPPFKEDSVRLPFPNFYYAVEDIAASYSPAVTYSVHRSSIIIGASSRSLNNSLLTLAVYATICRHQGLPFRYLAIHGSSLSGNKYTWEHFCDMSDSRVLAEQQIWAATTDRAKNQAFNCTNGDVFTWKSLWKLLSEIFDVEFVPFDEKEKFDVVEMMEEKGEIWDEIVEKHGLYKTKMEEITCFEALNTVLHLQFQHVSSMNKSREFGFFGFVDTMKSIRTWVKKLREMKIIP
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TNRCEIHYTGPISDPSLTVGASSRSLHNSLLPLAVHTNICKYQGLPFRYFGQLIGHDPPFKEDSVRLPFPNFYYAVEDIAASYSPAVTYSVHRSSIIIGASSRSLNNSLLTLAVYATICRHQGLPFRYLAIHGSSLSGNKYTWEHFCDMSDSRVLAEQQIWAATTDRAKNQAFNCTNGDVFTWKSLWKLLSEIFDVEFVPFDEKEKFDVVEMMEEKGEIWDEIVEKHGLYKTKMEEITCFEALNTVLHLQFQHVSSMNKSREFGFFGFVDTMKSIRTWVKKLREMKIIP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query289 2.2.26 [Sep-21-2011]
Q9STX2388 3-oxo-Delta(4,5)-steroid yes no 0.899 0.670 0.394 7e-52
Q6PQJ9389 3-oxo-Delta(4,5)-steroid N/A no 0.885 0.658 0.365 4e-47
O74913405 Uncharacterized protein C yes no 0.806 0.575 0.252 2e-17
>sp|Q9STX2|VEP1_ARATH 3-oxo-Delta(4,5)-steroid 5-beta-reductase OS=Arabidopsis thaliana GN=VEP1 PE=1 SV=1 Back     alignment and function desciption
 Score =  204 bits (519), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 110/279 (39%), Positives = 163/279 (58%), Gaps = 19/279 (6%)

Query: 20  GASSRSLHNSLLPLAVH-TNICKYQGLPFRYFGQLIG-----HDPPFKEDSVRLPFPNFY 73
           G+  R++  +++P A +  ++C   G    Y G         HDPPF ED  RL   NFY
Sbjct: 120 GSMLRNVLQAIIPYAPNLRHVCLQTGTK-HYLGPFTNVDGPRHDPPFTEDMPRLQIQNFY 178

Query: 74  YAVEDI---AASYSPAVTYSVHRSSIIIGASSRSLNNSLLTLAVYATICRHQGLPFRYLA 130
           Y  EDI          VT+S+HR ++I G S  SL N + TL VYA IC+H+G P  +  
Sbjct: 179 YTQEDILFEEIKKIETVTWSIHRPNMIFGFSPYSLMNIVGTLCVYAAICKHEGSPLLF-- 236

Query: 131 IHGSSLSGNKYTWEHFCDMSDSRVLAEQQIWAATTDRAKNQAFNCTNGDVFTWKSLWKLL 190
                  G+K  WE F   SD+ ++AEQQIWAA    AKN+AFNC N D+F WK LWK+L
Sbjct: 237 ------PGSKKAWEGFMTASDADLIAEQQIWAAVDPYAKNEAFNCNNADIFKWKHLWKIL 290

Query: 191 SEIFDVEFVPFDEKEKFDVVEMMEEKGEIWDEIVEKHGLYKTKMEEITCFEALNTVLHLQ 250
           +E F +E   F+E +   +VEMM+ K  +W+E+V+++ L + K+EE+  +   + +L ++
Sbjct: 291 AEQFGIEEYGFEEGKNLGLVEMMKGKERVWEEMVKENQLQEKKLEEVGVWWFADVILGVE 350

Query: 251 FQHVSSMNKSREFGFFGFVDTMKSIRTWVKKLREMKIIP 289
              + SMNKS+E+GF GF ++  S  +W+ K +  KI+P
Sbjct: 351 -GMIDSMNKSKEYGFLGFRNSNNSFISWIDKYKAFKIVP 388
Involved in vascular strand development. Catalyzes the stereospecific conversion of progesterone to 5-beta-pregnane-3,20-dione. Can use progesterone, testosterone, 21-acetyl cortexone, 2-cyclohexenone, but-1-en-3-one, ethyl acrylate, ethylmethacrylate, cortisone and canarigenone as substrates, lower activity with 3-methyl-2-cyclohexenone and 3,5,5-trimethyl-2-cyclohexenone as substrate, and no activity with canarigenin, canarigenin digitoxoside and pregnenolone. May be involved in the formation of 5-beta phytoecdysteroids.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 3EC: .EC: 1EC: .EC: 3
>sp|Q6PQJ9|5BPOR_DIGLA 3-oxo-Delta(4,5)-steroid 5-beta-reductase OS=Digitalis lanata PE=1 SV=1 Back     alignment and function description
>sp|O74913|YJ72_SCHPO Uncharacterized protein C757.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.02c PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query289
224132716377 predicted protein [Populus trichocarpa] 0.840 0.644 0.644 1e-101
224132720377 predicted protein [Populus trichocarpa] 0.840 0.644 0.644 1e-101
356521805374 PREDICTED: uncharacterized protein LOC10 0.903 0.697 0.637 1e-100
118489550377 unknown [Populus trichocarpa x Populus d 0.840 0.644 0.644 1e-99
357478899376 hypothetical protein MTR_4g121570 [Medic 0.906 0.696 0.601 8e-95
357473789376 hypothetical protein MTR_4g073090 [Medic 0.906 0.696 0.615 6e-93
359477226 470 PREDICTED: uncharacterized protein C757. 0.799 0.491 0.673 8e-92
225431890376 PREDICTED: uncharacterized protein C757. 0.795 0.611 0.672 2e-87
357478903376 hypothetical protein MTR_4g121590 [Medic 0.795 0.611 0.609 2e-86
148907132 399 unknown [Picea sitchensis] 0.778 0.563 0.493 1e-60
>gi|224132716|ref|XP_002327863.1| predicted protein [Populus trichocarpa] gi|222837272|gb|EEE75651.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 183/284 (64%), Positives = 211/284 (74%), Gaps = 41/284 (14%)

Query: 7   HYTGPISDPSLTVGASSRSLHNSLLPLAVHTNICKYQGLPFRYFGQLIGHDPPFKEDSVR 66
           HY GPI DPSL                                 GQL+  +PPFKED  R
Sbjct: 134 HYMGPIFDPSLR--------------------------------GQLVHQEPPFKEDLGR 161

Query: 67  LPFPNFYYAVEDIAASYSPAVTYSVHRSSIIIGASSRSLNNSLLTLAVYATICRHQGLPF 126
           LP+PNFYYA+ED+  SY P++T+SVHRSSIIIGASSRSLNN+LLTL+VYATICR+QGLPF
Sbjct: 162 LPYPNFYYALEDLVVSYLPSITHSVHRSSIIIGASSRSLNNTLLTLSVYATICRYQGLPF 221

Query: 127 RYLAIHGSSLSGNKYTWEHFCDMSDSRVLAEQQIWAATTDRAKNQAFNCTNGDVFTWKSL 186
            Y         GNKY WEHFCDMSD+RVLAEQQIWAA T+ AKNQAFNCTNGDVFTWKSL
Sbjct: 222 LY--------PGNKYIWEHFCDMSDARVLAEQQIWAAVTEGAKNQAFNCTNGDVFTWKSL 273

Query: 187 WKLLSEIFDVEFVPFDEK-EKFDVVEMMEEKGEIWDEIVEKHGLYKTKMEEITCFEALNT 245
           W +L E+FDVEFV ++E  EKFD + MM+ KG++WDEIVEK+GL++TKME+ITCFEALN 
Sbjct: 274 WGVLCEVFDVEFVAYEENDEKFDCLAMMKGKGKVWDEIVEKYGLFETKMEDITCFEALNV 333

Query: 246 VLHLQFQHVSSMNKSREFGFFGFVDTMKSIRTWVKKLREMKIIP 289
           VLH  FQHV SMNKSRE GF GF DT+KSI  WV +LR+MKIIP
Sbjct: 334 VLHFGFQHVCSMNKSRESGFQGFADTLKSIPMWVGRLRDMKIIP 377

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224132720|ref|XP_002327864.1| predicted protein [Populus trichocarpa] gi|222837273|gb|EEE75652.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356521805|ref|XP_003529541.1| PREDICTED: uncharacterized protein LOC100812240 [Glycine max] Back     alignment and taxonomy information
>gi|118489550|gb|ABK96577.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|357478899|ref|XP_003609735.1| hypothetical protein MTR_4g121570 [Medicago truncatula] gi|355510790|gb|AES91932.1| hypothetical protein MTR_4g121570 [Medicago truncatula] Back     alignment and taxonomy information
>gi|357473789|ref|XP_003607179.1| hypothetical protein MTR_4g073090 [Medicago truncatula] gi|355508234|gb|AES89376.1| hypothetical protein MTR_4g073090 [Medicago truncatula] Back     alignment and taxonomy information
>gi|359477226|ref|XP_002276059.2| PREDICTED: uncharacterized protein C757.02c-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225431890|ref|XP_002276159.1| PREDICTED: uncharacterized protein C757.02c-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357478903|ref|XP_003609737.1| hypothetical protein MTR_4g121590 [Medicago truncatula] gi|355510792|gb|AES91934.1| hypothetical protein MTR_4g121590 [Medicago truncatula] Back     alignment and taxonomy information
>gi|148907132|gb|ABR16709.1| unknown [Picea sitchensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query289
TAIR|locus:2135932388 VEP1 "VEIN PATTERNING 1" [Arab 0.899 0.670 0.362 9.1e-45
UNIPROTKB|Q48IK0353 PSPPH_2587 "Aldo-keto reductas 0.868 0.711 0.338 8.5e-33
UNIPROTKB|Q882D3353 PSPTO_2695 "Uncharacterized pr 0.868 0.711 0.326 1.6e-31
TAIR|locus:2178793386 AT5G58750 [Arabidopsis thalian 0.723 0.541 0.325 3.3e-24
UNIPROTKB|Q4K649386 PFL_5207 "Uncharacterized prot 0.792 0.593 0.267 1.1e-19
POMBASE|SPCC757.02c405 SPCC757.02c "epimarase (predic 0.498 0.355 0.291 1.5e-14
ASPGD|ASPL0000051603376 AN9028 [Emericella nidulans (t 0.487 0.375 0.309 4.7e-14
ASPGD|ASPL0000040978437 AN2921 [Emericella nidulans (t 0.522 0.345 0.283 1.8e-11
ASPGD|ASPL0000017248424 AN4177 [Emericella nidulans (t 0.214 0.146 0.359 3.3e-06
TAIR|locus:2135932 VEP1 "VEIN PATTERNING 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 471 (170.9 bits), Expect = 9.1e-45, P = 9.1e-45
 Identities = 101/279 (36%), Positives = 151/279 (54%)

Query:    20 GASSRSLHNSLLPLAVHT-NICKYQGLPFRYFGQLIG-----HDPPFKEDSVRLPFPNFY 73
             G+  R++  +++P A +  ++C   G    Y G         HDPPF ED  RL   NFY
Sbjct:   120 GSMLRNVLQAIIPYAPNLRHVCLQTGTK-HYLGPFTNVDGPRHDPPFTEDMPRLQIQNFY 178

Query:    74 YAVEDIA---ASYSPAVTYSVHXXXXXXXXXXXXXXXXXXXXAVYATICRHQGLPFRYLA 130
             Y  EDI          VT+S+H                     VYA IC+H+G P  +  
Sbjct:   179 YTQEDILFEEIKKIETVTWSIHRPNMIFGFSPYSLMNIVGTLCVYAAICKHEGSPLLF-- 236

Query:   131 IHGSSLSGNKYTWEHFCDMSDSRVLAEQQIWAATTDRAKNQAFNCTNGDVFTWKSLWKLL 190
                    G+K  WE F   SD+ ++AEQQIWAA    AKN+AFNC N D+F WK LWK+L
Sbjct:   237 ------PGSKKAWEGFMTASDADLIAEQQIWAAVDPYAKNEAFNCNNADIFKWKHLWKIL 290

Query:   191 SEIFDVEFVPFDEKEKFDVVEMMEEKGEIWDEIVEKHGLYKTKMEEITCFEALNTVLHLQ 250
             +E F +E   F+E +   +VEMM+ K  +W+E+V+++ L + K+EE+  +   + +L ++
Sbjct:   291 AEQFGIEEYGFEEGKNLGLVEMMKGKERVWEEMVKENQLQEKKLEEVGVWWFADVILGVE 350

Query:   251 FQHVSSMNKSREFGFFGFVDTMKSIRTWVKKLREMKIIP 289
                + SMNKS+E+GF GF ++  S  +W+ K +  KI+P
Sbjct:   351 GM-IDSMNKSKEYGFLGFRNSNNSFISWIDKYKAFKIVP 388
GO:0000166 "nucleotide binding" evidence=IEA
GO:0009611 "response to wounding" evidence=IEP
GO:0010051 "xylem and phloem pattern formation" evidence=IMP
GO:0008202 "steroid metabolic process" evidence=IDA
GO:0035671 "enone reductase activity" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
UNIPROTKB|Q48IK0 PSPPH_2587 "Aldo-keto reductase family protein" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
UNIPROTKB|Q882D3 PSPTO_2695 "Uncharacterized protein" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)] Back     alignment and assigned GO terms
TAIR|locus:2178793 AT5G58750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q4K649 PFL_5207 "Uncharacterized protein" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
POMBASE|SPCC757.02c SPCC757.02c "epimarase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000051603 AN9028 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ASPGD|ASPL0000040978 AN2921 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ASPGD|ASPL0000017248 AN4177 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_scaffold_64000091
hypothetical protein (377 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
cd08948308 cd08948, 5beta-POR_like_SDR_a, progesterone 5-beta 1e-61
cd08948308 cd08948, 5beta-POR_like_SDR_a, progesterone 5-beta 5e-04
cd05265250 cd05265, SDR_a1, atypical (a) SDRs, subgroup 1 6e-04
>gnl|CDD|187652 cd08948, 5beta-POR_like_SDR_a, progesterone 5-beta-reductase-like proteins (5beta-POR), atypical (a) SDRs Back     alignment and domain information 
 Score =  197 bits (503), Expect = 1e-61
 Identities = 78/199 (39%), Positives = 102/199 (51%), Gaps = 19/199 (9%)

Query: 40  CKYQGLPFRYFGQLIGHDPPFKEDSVRLPFPNFYYAVEDIAASYS--PAVTYSVHRSSII 97
            K+ G+    F      + P +ED  RL  PNFYY  ED+    +     T+SV R   I
Sbjct: 119 TKHYGVHLGPFKT-PRPEEPAREDPPRLLPPNFYYDQEDLLFEAAKGKGWTWSVLRPDAI 177

Query: 98  IGASSRSLNNSLLTLAVYATICRHQGLPFRYLAIHGSSLSGNKYTWEHFCDMSDSRVLAE 157
           IG +  +  N  LTLAVYA ICR  G P R+         G+   W    D +D+R+LA 
Sbjct: 178 IGFAPGNAMNLALTLAVYAAICRELGAPLRF--------PGSPAAWNALSDATDARLLAR 229

Query: 158 QQIWAATTDRAKNQAFNCTNGDVFTWKSLWKLLSEIFDVEFVPFDEKEKFDVV------E 211
             IWAAT   A N+AFN TNGDVF WK LW  L+E F +E  P + + +          E
Sbjct: 230 FTIWAATHPEAANEAFNVTNGDVFRWKELWPRLAEYFGLEGAPPEPEAEAGADKAPVWEE 289

Query: 212 MMEEKG--EIWDEIVEKHG 228
           +M + G    WDE+VE+HG
Sbjct: 290 LMADHGLQAAWDELVERHG 308

5beta-POR catalyzes the reduction of progesterone to 5beta-pregnane-3,20-dione in Digitalis plants. This subgroup of atypical-extended SDRs, shares the structure of an extended SDR, but has a different glycine-rich nucleotide binding motif (GXXGXXG) and lacks the YXXXK active site motif of classical and extended SDRs. Tyr-179 and Lys 147 are present in the active site, but not in the usual SDR configuration. Given these differences, it has been proposed that this subfamily represents a new SDR class. Other atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Length = 308
>gnl|CDD|187652 cd08948, 5beta-POR_like_SDR_a, progesterone 5-beta-reductase-like proteins (5beta-POR), atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187575 cd05265, SDR_a1, atypical (a) SDRs, subgroup 1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 289
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 99.92
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 99.87
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 99.84
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 99.82
PLN02427386 UDP-apiose/xylose synthase 99.8
KOG0747331 consensus Putative NAD+-dependent epimerases [Carb 99.8
PRK11908347 NAD-dependent epimerase/dehydratase family protein 99.79
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 99.79
PLN00016378 RNA-binding protein; Provisional 99.79
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 99.78
PLN02166436 dTDP-glucose 4,6-dehydratase 99.77
PLN02206442 UDP-glucuronate decarboxylase 99.77
PLN02653340 GDP-mannose 4,6-dehydratase 99.75
PLN02572442 UDP-sulfoquinovose synthase 99.75
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 99.75
KOG1430361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 99.75
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 99.75
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 99.75
PLN02260 668 probable rhamnose biosynthetic enzyme 99.74
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.74
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.74
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 99.73
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 99.73
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.73
PLN02214342 cinnamoyl-CoA reductase 99.73
PLN02240352 UDP-glucose 4-epimerase 99.73
PLN02695370 GDP-D-mannose-3',5'-epimerase 99.72
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 99.72
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.71
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.71
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 99.68
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.67
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.66
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.66
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 99.65
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 99.63
PLN02650351 dihydroflavonol-4-reductase 99.62
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 99.61
PLN00198338 anthocyanidin reductase; Provisional 99.6
PLN02896353 cinnamyl-alcohol dehydrogenase 99.55
PRK07201 657 short chain dehydrogenase; Provisional 99.5
KOG1371343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 99.48
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 99.47
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 99.41
PRK05865 854 hypothetical protein; Provisional 99.39
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 99.35
CHL00194317 ycf39 Ycf39; Provisional 99.34
KOG1431315 consensus GDP-L-fucose synthetase [Carbohydrate tr 99.28
PLN02686367 cinnamoyl-CoA reductase 99.27
TIGR01746367 Thioester-redct thioester reductase domain. It has 99.26
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.21
PLN02778298 3,5-epimerase/4-reductase 99.19
PLN02996491 fatty acyl-CoA reductase 99.15
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 99.12
PLN02583297 cinnamoyl-CoA reductase 99.06
PLN02260668 probable rhamnose biosynthetic enzyme 98.97
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 98.88
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 98.76
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 98.69
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 98.61
PLN02503605 fatty acyl-CoA reductase 2 98.57
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 98.34
KOG1372376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 98.23
PRK12320 699 hypothetical protein; Provisional 98.18
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 97.68
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 97.56
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 97.48
KOG3019315 consensus Predicted nucleoside-diphosphate sugar e 97.47
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 97.31
PRK09135249 pteridine reductase; Provisional 97.0
PF1395062 Epimerase_Csub: UDP-glucose 4-epimerase C-term sub 96.94
COG3320382 Putative dehydrogenase domain of multifunctional n 96.88
KOG2865391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 96.8
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 96.48
KOG1221467 consensus Acyl-CoA reductase [Lipid transport and 96.3
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 96.3
PRK06482276 short chain dehydrogenase; Provisional 95.92
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.43
KOG2774366 consensus NAD dependent epimerase [General functio 95.01
PRK05875276 short chain dehydrogenase; Provisional 94.51
PRK08263275 short chain dehydrogenase; Provisional 94.26
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 94.07
PRK07806248 short chain dehydrogenase; Provisional 93.52
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 93.32
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.26
PLN03209 576 translocon at the inner envelope of chloroplast su 93.1
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 92.83
PRK07074257 short chain dehydrogenase; Provisional 92.75
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 92.4
PRK09134258 short chain dehydrogenase; Provisional 92.26
PRK07067257 sorbitol dehydrogenase; Provisional 92.0
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 91.75
KOG4288283 consensus Predicted oxidoreductase [General functi 91.72
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.06
PRK12829264 short chain dehydrogenase; Provisional 89.94
PRK12828239 short chain dehydrogenase; Provisional 88.58
PRK07774250 short chain dehydrogenase; Provisional 88.49
PRK06914280 short chain dehydrogenase; Provisional 88.34
PRK12827249 short chain dehydrogenase; Provisional 86.79
PRK07775274 short chain dehydrogenase; Provisional 85.33
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 84.96
PRK12935247 acetoacetyl-CoA reductase; Provisional 82.68
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 82.08
PRK06196315 oxidoreductase; Provisional 81.8
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 80.65
PRK08324681 short chain dehydrogenase; Validated 80.53
PRK06123248 short chain dehydrogenase; Provisional 80.3
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information 
Probab=99.92  E-value=1.9e-24  Score=197.25  Aligned_cols=228  Identities=16%  Similarity=0.176  Sum_probs=180.3

Q ss_pred             cccccCcccccCCchhhccChHHHHHhhhhHhhhcc-Cceeeccc-ccccCccCCCCCCCCCCCCCCC-CCCChHHHHHH
Q 042656            3 RCEIHYTGPISDPSLTVGASSRSLHNSLLPLAVHTN-ICKYQGLP-FRYFGQLIGHDPPFKEDSVRLP-FPNFYYAVEDI   79 (289)
Q Consensus         3 ~~~~~v~~~~~~p~~~~~~~~~~~~~~l~~~~l~tG-~k~yg~~~-~~~~g~~~~~~~P~~E~~pr~p-~p~fyy~qEd~   79 (289)
                      .||.||.+|+.+|..++.+|+.||.+.|+. ++.-. ..+|..+| .++||++......|+|++|..| +|   |.+.|+
T Consensus        82 AAESHVDRSI~~P~~Fi~TNv~GT~~LLEa-ar~~~~~frf~HISTDEVYG~l~~~~~~FtE~tp~~PsSP---YSASKA  157 (340)
T COG1088          82 AAESHVDRSIDGPAPFIQTNVVGTYTLLEA-ARKYWGKFRFHHISTDEVYGDLGLDDDAFTETTPYNPSSP---YSASKA  157 (340)
T ss_pred             chhccccccccChhhhhhcchHHHHHHHHH-HHHhcccceEEEeccccccccccCCCCCcccCCCCCCCCC---cchhhh
Confidence            489999999999999999999999999999 55444 35898888 8999986333346999999986 55   888776


Q ss_pred             HHh-------cCCCceEEEeccCceeecCCCchhhhHHHHHHHHHHHHHhCCCeEEEeccccCCCCCcccccccccccch
Q 042656           80 AAS-------YSPAVTYSVHRSSIIIGASSRSLNNSLLTLAVYATICRHQGLPFRYLAIHGSSLSGNKYTWEHFCDMSDS  152 (289)
Q Consensus        80 L~e-------~~~g~~~~ivRP~~V~G~~~gn~~nl~~~l~vyaal~~~~g~pl~f~~~~~~~~pG~~~~~~~~~~~~~~  152 (289)
                      -++       +..|++.+|+|+++.|||-.  +-.-.+++.+.-+|   .|.|+|.        .|++.   |+||+.++
T Consensus       158 asD~lVray~~TYglp~~ItrcSNNYGPyq--fpEKlIP~~I~nal---~g~~lpv--------YGdG~---~iRDWl~V  221 (340)
T COG1088         158 ASDLLVRAYVRTYGLPATITRCSNNYGPYQ--FPEKLIPLMIINAL---LGKPLPV--------YGDGL---QIRDWLYV  221 (340)
T ss_pred             hHHHHHHHHHHHcCCceEEecCCCCcCCCc--CchhhhHHHHHHHH---cCCCCce--------ecCCc---ceeeeEEe
Confidence            665       56799999999999999963  33444555555555   8999999        99987   99999999


Q ss_pred             HHHHHHHHHHhcCCCcCCCeeEecCCCccCHHHHHHHHHHHhCCCCCCCCCCCcccHHHHHHHhHHHHHHHHHHhCCCcc
Q 042656          153 RVLAEQQIWAATTDRAKNQAFNCTNGDVFTWKSLWKLLSEIFDVEFVPFDEKEKFDVVEMMEEKGEIWDEIVEKHGLYKT  232 (289)
Q Consensus       153 ~~la~~~i~aa~~p~a~ge~FNi~dg~~~s~~~lw~~la~~~G~~~~~~~~~~p~~l~~~~~~~~~~W~~i~~k~gl~~~  232 (289)
                      ++.|+++-..++.. ..||+|||..|...+-.++...|++.+|......     -.+.+++.                  
T Consensus       222 eDh~~ai~~Vl~kg-~~GE~YNIgg~~E~~Nlevv~~i~~~l~~~~~~~-----~~li~~V~------------------  277 (340)
T COG1088         222 EDHCRAIDLVLTKG-KIGETYNIGGGNERTNLEVVKTICELLGKDKPDY-----RDLITFVE------------------  277 (340)
T ss_pred             HhHHHHHHHHHhcC-cCCceEEeCCCccchHHHHHHHHHHHhCccccch-----hhheEecc------------------
Confidence            99999966555544 4599999999999999999999999999865421     01112222                  


Q ss_pred             ccccccchhhhhhhhcccccccccHHHHHh-cCCCCCcChHHHHHHHHHHHHHCC
Q 042656          233 KMEEITCFEALNTVLHLQFQHVSSMNKSRE-FGFFGFVDTMKSIRTWVKKLREMK  286 (289)
Q Consensus       233 ~l~~l~~w~f~d~~~~~~~~~~~d~~Kar~-~Gw~~~~dt~e~~~~~~~~lr~~~  286 (289)
                        ++          -|.+..--+|.+|+++ +||.|.++.++|+++|++||.+.+
T Consensus       278 --DR----------pGHD~RYaid~~Ki~~eLgW~P~~~fe~GlrkTv~WY~~N~  320 (340)
T COG1088         278 --DR----------PGHDRRYAIDASKIKRELGWRPQETFETGLRKTVDWYLDNE  320 (340)
T ss_pred             --CC----------CCCccceeechHHHhhhcCCCcCCCHHHHHHHHHHHHHhch
Confidence              11          1345567888999555 799999999999999999998754

>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3019 consensus Predicted nucleoside-diphosphate sugar epimerase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PF13950 Epimerase_Csub: UDP-glucose 4-epimerase C-term subunit; PDB: 1EK5_A 1I3K_B 1I3M_B 1HZJ_A 1EK6_A 1I3N_A 1I3L_A 2CNB_B 1GY8_D 1NAI_A Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG2774 consensus NAD dependent epimerase [General function prediction only] Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4288 consensus Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
2v6f_A364 Structure Of Progesterone 5beta-Reductase From Digi 3e-43
>pdb|2V6F|A Chain A, Structure Of Progesterone 5beta-Reductase From Digitalis Lanata Length = 364 Back     alignment and structure 
Iteration: 1

 Score =  171 bits (434), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 94/276 (34%), Positives = 151/276 (54%), Gaps = 20/276 (7%)
Query: 24  RSLHNSLLP-------LAVHTNICKYQGLPFRYFGQLIGHDPPFKEDSVRLPFPNFYYAV 76
           R++ ++++P       +++ T    Y G PF  +G++  HDPP+ ED  RL + NFYY +
Sbjct: 99  RNVLDAVIPNCPNLKHISLQTGRKHYMG-PFESYGKIESHDPPYTEDLPRLKYMNFYYDL 157
Query: 77  EDIA---ASYSPAVTYSVHXXXXXXXXXXXXXXXXXXXXAVYATICRHQGLPFRYLAIHG 133
           EDI          +T+SVH                     VYA IC+H+G   R+     
Sbjct: 158 EDIMLEEVEKKEGLTWSVHRPGNIFGFSPYSMMNLVGTLCVYAAICKHEGKVLRF----- 212
Query: 134 SSLSGNKYTWEHFCDMSDSRVLAEQQIWAATTDRAKNQAFNCTNGDVFTWKSLWKLLSEI 193
              +G K  W+ + D SD+ ++AE  IWAA    AKN+AFN +NGDVF WK  WK+L+E 
Sbjct: 213 ---TGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFKWKHFWKVLAEQ 269
Query: 194 FDVEFVPFDEKEKFDVVEMMEEKGEIWDEIVEKHGLYKTKMEEITCFEALNTVLHLQFQH 253
           F VE   ++E     + ++M+ K  +W+EIV ++GL  TK++++  +   + +L  +   
Sbjct: 270 FGVECGEYEEGVDLKLQDLMKGKEPVWEEIVRENGLTPTKLKDVGIWWFGDVILGNEC-F 328
Query: 254 VSSMNKSREFGFFGFVDTMKSIRTWVKKLREMKIIP 289
           + SMNKS+E GF GF ++  +  +W+ K +  KI+P
Sbjct: 329 LDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP 364

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 4e-71
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-04
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Length = 364 Back     alignment and structure
 Score =  222 bits (567), Expect = 4e-71
 Identities = 99/262 (37%), Positives = 149/262 (56%), Gaps = 12/262 (4%)

Query: 31  LPLAVHTNICKYQGLPFRYFGQLIGHDPPFKEDSVRLPFPNFYYAVEDIA---ASYSPAV 87
           L         K+   PF  +G++  HDPP+ ED  RL + NFYY +EDI          +
Sbjct: 112 LKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMNFYYDLEDIMLEEVEKKEGL 171

Query: 88  TYSVHRSSIIIGASSRSLNNSLLTLAVYATICRHQGLPFRYLAIHGSSLSGNKYTWEHFC 147
           T+SVHR   I G S  S+ N + TL VYA IC+H+G   R+        +G K  W+ + 
Sbjct: 172 TWSVHRPGNIFGFSPYSMMNLVGTLCVYAAICKHEGKVLRF--------TGCKAAWDGYS 223

Query: 148 DMSDSRVLAEQQIWAATTDRAKNQAFNCTNGDVFTWKSLWKLLSEIFDVEFVPFDEKEKF 207
           D SD+ ++AE  IWAA    AKN+AFN +NGDVF WK  WK+L+E F VE   ++E    
Sbjct: 224 DCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFKWKHFWKVLAEQFGVECGEYEEGVDL 283

Query: 208 DVVEMMEEKGEIWDEIVEKHGLYKTKMEEITCFEALNTVLHLQFQHVSSMNKSREFGFFG 267
            + ++M+ K  +W+EIV ++GL  TK++++  +   + +L      + SMNKS+E GF G
Sbjct: 284 KLQDLMKGKEPVWEEIVRENGLTPTKLKDVGIWWFGDVILG-NECFLDSMNKSKEHGFLG 342

Query: 268 FVDTMKSIRTWVKKLREMKIIP 289
           F ++  +  +W+ K +  KI+P
Sbjct: 343 FRNSKNAFISWIDKAKAYKIVP 364
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query289
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 99.98
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.88
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.88
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.87
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.86
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.86
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.85
3slg_A372 PBGP3 protein; structural genomics, seattle struct 99.85
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.84
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 99.84
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 99.83
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.83
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.83
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.82
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 99.81
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.81
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.81
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 99.81
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.81
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.8
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.8
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 99.8
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.79
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.79
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.79
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.79
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.79
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.78
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 99.78
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.78
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 99.77
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.77
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.77
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.76
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.76
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 99.76
3ius_A286 Uncharacterized conserved protein; APC63810, silic 99.76
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.76
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 99.76
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.75
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.75
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.74
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.74
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.74
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 99.74
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 99.73
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.72
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.71
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.7
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.7
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.7
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.7
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.7
4f6c_A427 AUSA reductase domain protein; thioester reductase 99.67
4f6l_B508 AUSA reductase domain protein; thioester reductase 99.66
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 99.66
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.58
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.55
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 99.54
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.52
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.48
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 99.43
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 99.33
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 99.29
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.29
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.16
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.1
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.09
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 98.94
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 98.89
1xq6_A253 Unknown protein; structural genomics, protein stru 98.89
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 98.87
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 98.85
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 98.82
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 98.8
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 98.8
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 98.74
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 98.63
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 98.61
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 98.6
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 98.55
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 98.54
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 98.41
2wm3_A299 NMRA-like family domain containing protein 1; unkn 98.39
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 98.33
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 98.02
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 97.45
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 97.12
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 96.99
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 96.9
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 96.49
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 95.45
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 95.28
1spx_A278 Short-chain reductase family member (5L265); paral 95.0
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 94.98
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 94.93
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 94.73
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 94.55
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 94.4
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 93.98
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 93.66
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 93.46
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 93.28
1xq1_A266 Putative tropinone reducatse; structural genomics, 93.21
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 92.89
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 92.68
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 92.0
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 91.88
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 91.81
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 91.74
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 91.62
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 91.23
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 91.14
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 91.12
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 90.61
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 90.57
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 90.56
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 90.26
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 90.04
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 89.83
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 89.71
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 89.49
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 89.47
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 89.34
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 89.21
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 88.48
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 88.44
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 87.97
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 87.89
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 87.85
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 87.46
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 87.26
3rih_A293 Short chain dehydrogenase or reductase; structural 87.09
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 87.08
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 86.99
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 86.66
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 86.32
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 86.08
1nff_A260 Putative oxidoreductase RV2002; directed evolution 85.78
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 85.63
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 85.52
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 85.42
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 84.83
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 84.75
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 84.61
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 84.59
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 84.47
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 84.37
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 84.32
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 83.83
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 83.78
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 83.73
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 83.54
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 83.42
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 83.26
3tox_A280 Short chain dehydrogenase; structural genomics, PS 82.88
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 82.72
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 82.61
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 82.6
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 82.46
3gem_A260 Short chain dehydrogenase; structural genomics, AP 81.95
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 81.95
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 81.32
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 80.78
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 80.3
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
Probab=99.98  E-value=6e-31  Score=244.47  Aligned_cols=266  Identities=38%  Similarity=0.709  Sum_probs=221.3

Q ss_pred             cCCchhhccChHHHHHhhhhHhhhc--cCceee-------ccc-ccccCccCCCCCCCCCCCCCCCCCCChHHHHHHHHh
Q 042656           13 SDPSLTVGASSRSLHNSLLPLAVHT--NICKYQ-------GLP-FRYFGQLIGHDPPFKEDSVRLPFPNFYYAVEDIAAS   82 (289)
Q Consensus        13 ~~p~~~~~~~~~~~~~~l~~~~l~t--G~k~yg-------~~~-~~~~g~~~~~~~P~~E~~pr~p~p~fyy~qEd~L~e   82 (289)
                      .+|.....+|+.++.+.++. +...  |+|++.       .+| ...||.......|++|++|..|.++.||.+|+.+.+
T Consensus        85 ~~~~~~~~~n~~~~~~l~~a-~~~~~~~~~~~v~~~g~~i~~Ss~~vyg~~~~~~~~~~E~~~~~~~~~~y~~~E~~~~~  163 (364)
T 2v6g_A           85 STEQENCEANSKMFRNVLDA-VIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMNFYYDLEDIMLE  163 (364)
T ss_dssp             SSHHHHHHHHHHHHHHHHHH-HTTTCTTCCEEEEECCTHHHHCCGGGTTTSCCCCSSBCTTSCCCSSCCHHHHHHHHHHH
T ss_pred             chHHHHHHHhHHHHHHHHHH-HHHhccccceEEeccCceEEEechhhccccccCCCCCCccccCCccchhhHHHHHHHHH
Confidence            35677888999999999988 5555  778874       334 556775211347899999887666889999999998


Q ss_pred             --cCCC-ceEEEeccCceeecCCCchhhhHHHHHHHHHHHHHhCCCeEEEeccccCCCCCcccccccccccchHHHHHHH
Q 042656           83 --YSPA-VTYSVHRSSIIIGASSRSLNNSLLTLAVYATICRHQGLPFRYLAIHGSSLSGNKYTWEHFCDMSDSRVLAEQQ  159 (289)
Q Consensus        83 --~~~g-~~~~ivRP~~V~G~~~gn~~nl~~~l~vyaal~~~~g~pl~f~~~~~~~~pG~~~~~~~~~~~~~~~~la~~~  159 (289)
                        +..+ +.++++||+.|||+...+.++.+.+.+++.+++++.|.|+.+        +|++..+....+.++++++|+++
T Consensus       164 ~~~~~~~~~~~ilRp~~v~G~~~~~~~~~~~~~~~~~~~~~~~g~~~~~--------~g~~~~~~~~~~~~~v~Dva~a~  235 (364)
T 2v6g_A          164 EVEKKEGLTWSVHRPGNIFGFSPYSMMNLVGTLCVYAAICKHEGKVLRF--------TGCKAAWDGYSDCSDADLIAEHH  235 (364)
T ss_dssp             HHTTSTTCEEEEEEESSEECCCTTCSSCHHHHHHHHHHHHHHHTCCBCC--------CSCHHHHHSCBCCEEHHHHHHHH
T ss_pred             HhhcCCCceEEEECCCceeCCCCCcccchHHHHHHHHHHHHhcCCceec--------CCCcccccccCCCCcHHHHHHHH
Confidence              3455 999999999999998766667667777788887778999998        89887677888999999999999


Q ss_pred             HHHhcCCCcCCCeeEecCCCccCHHHHHHHHHHHhCCCCCCCCCCCcccHHHHHHHhHHHHHHHHHHhCCCccccccccc
Q 042656          160 IWAATTDRAKNQAFNCTNGDVFTWKSLWKLLSEIFDVEFVPFDEKEKFDVVEMMEEKGEIWDEIVEKHGLYKTKMEEITC  239 (289)
Q Consensus       160 i~aa~~p~a~ge~FNi~dg~~~s~~~lw~~la~~~G~~~~~~~~~~p~~l~~~~~~~~~~W~~i~~k~gl~~~~l~~l~~  239 (289)
                      +.++.++.+.|++|||++++.+|+.|++..|++.+|.+....+...|.++.+++....+.|+.+.++.|+.+..+.++..
T Consensus       236 ~~~~~~~~~~g~~~ni~~~~~~s~~e~~~~i~~~~g~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  315 (364)
T 2v6g_A          236 IWAAVDPYAKNEAFNVSNGDVFKWKHFWKVLAEQFGVECGEYEEGVDLKLQDLMKGKEPVWEEIVRENGLTPTKLKDVGI  315 (364)
T ss_dssp             HHHHHCGGGTTEEEEECCSCCBCHHHHHHHHHHHHTCCBCCCCTTCCCCHHHHTTTCHHHHHHHHHHTTCCCCCHHHHCC
T ss_pred             HHHHhCCCCCCceEEecCCCcCCHHHHHHHHHHHhCCCCCCCCCCCCccHHHHHhhhHHHHHHHHHHhCCCccccccccc
Confidence            99999887789999999999999999999999999998654301278888888888889999999999988776666667


Q ss_pred             hhhhhhhhccccc-ccccHHHHHhcCCCCCcChHHHHHHHHHHHHHCCCCC
Q 042656          240 FEALNTVLHLQFQ-HVSSMNKSREFGFFGFVDTMKSIRTWVKKLREMKIIP  289 (289)
Q Consensus       240 w~f~d~~~~~~~~-~~~d~~Kar~~Gw~~~~dt~e~~~~~~~~lr~~~iiP  289 (289)
                      |.|.++.+.  .+ ..+|.+|+|++||+|..++++++.++++||++.|+||
T Consensus       316 ~~~~~~~~~--~~~~~~d~~k~~~lG~~p~~~~~e~l~~~~~~~~~~g~lp  364 (364)
T 2v6g_A          316 WWFGDVILG--NECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  364 (364)
T ss_dssp             HHHHHHHHT--SCCCCBCCHHHHHTTCCCCCCHHHHHHHHHHHHHHTTSCC
T ss_pred             cchhhhccc--cchhhcchHHHHhcCCCCCCCHHHHHHHHHHHHHHcCCCC
Confidence            888887664  36 6899999999999999999999999999999999998
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query289
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 99.88
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 99.88
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 99.86
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.86
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.82
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 99.81
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.79
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.79
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.78
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.77
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.77
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 99.74
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.74
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 99.74
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.69
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 99.68
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.65
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.64
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.57
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 99.55
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.55
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 99.35
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.32
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 98.86
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 98.85
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 98.84
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 97.77
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.54
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 97.4
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 96.84
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: UDP-N-acetylglucosamine 4-epimerase WbpP
species: Pseudomonas aeruginosa [TaxId: 287]

Probab=99.88  E-value=9e-23  Score=186.68  Aligned_cols=227  Identities=16%  Similarity=0.122  Sum_probs=176.7

Q ss_pred             ccccCcccccCCchhhccChHHHHHhhhhHhhhccCceeeccc-ccccCccCCCCCCCCCCCCCCCCCCChHHHHHHHHh
Q 042656            4 CEIHYTGPISDPSLTVGASSRSLHNSLLPLAVHTNICKYQGLP-FRYFGQLIGHDPPFKEDSVRLPFPNFYYAVEDIAAS   82 (289)
Q Consensus         4 ~~~~v~~~~~~p~~~~~~~~~~~~~~l~~~~l~tG~k~yg~~~-~~~~g~~~~~~~P~~E~~pr~p~p~fyy~qEd~L~e   82 (289)
                      |..++..+.++|...+..|+.++.+.++. +...|+|++...+ ...||.  ....|.+|++|..  |...|.+.+.+.|
T Consensus       100 a~~~~~~~~~~~~~~~~~Nv~gt~~ll~~-~~~~~~~~~i~~SS~~vyg~--~~~~~~~E~~~~~--p~~~Y~~sK~~~E  174 (341)
T d1sb8a_         100 ALGSVPRSINDPITSNATNIDGFLNMLIA-ARDAKVQSFTYAASSSTYGD--HPGLPKVEDTIGK--PLSPYAVTKYVNE  174 (341)
T ss_dssp             SCCCHHHHHHCHHHHHHHHTHHHHHHHHH-HHHTTCSEEEEEEEGGGGTT--CCCSSBCTTCCCC--CCSHHHHHHHHHH
T ss_pred             ccccccccccCccchhheeehhHHHHHHH-HHhcCCceEEEcccceeeCC--CCCCCccCCCCCC--CCCcchHHHHHHH
Confidence            34557778999999999999999999998 7789999998777 678886  5578999999976  5556887766666


Q ss_pred             -------cCCCceEEEeccCceeecCC--CchhhhHHHHHHHHHHHHHhCCCeEEEeccccCCCCCcccccccccccchH
Q 042656           83 -------YSPAVTYSVHRSSIIIGASS--RSLNNSLLTLAVYATICRHQGLPFRYLAIHGSSLSGNKYTWEHFCDMSDSR  153 (289)
Q Consensus        83 -------~~~g~~~~ivRP~~V~G~~~--gn~~nl~~~l~vyaal~~~~g~pl~f~~~~~~~~pG~~~~~~~~~~~~~~~  153 (289)
                             +..++.++++||+.|||+..  ...++.++...+..++   .|.|+.+        .|++.   +.+|+++++
T Consensus       175 ~~~~~~~~~~~i~~~ilR~~~v~G~~~~~~~~~~~~i~~~~~~~~---~g~~i~~--------~g~g~---~~r~~i~v~  240 (341)
T d1sb8a_         175 LYADVFSRCYGFSTIGLRYFNVFGRRQDPNGAYAAVIPKWTSSMI---QGDDVYI--------NGDGE---TSRDFCYIE  240 (341)
T ss_dssp             HHHHHHHHHHCCCCEEEEECCEECTTCCCCSTTCCHHHHHHHHHH---HTCCCEE--------ESSSC---CEECCEEHH
T ss_pred             HHHHHHHHHhCCCeEEEEeceeeccCcCCCCchhhhHHHHHHHHH---cCCceEE--------cCCCC---EEEEEEEEe
Confidence                   34589999999999999964  2334444444444444   6899988        77764   899999999


Q ss_pred             HHHHHHHHHhcCCC-cCCCeeEecCCCccCHHHHHHHHHHHhCCCCCCCCCCCcccHHHHHHHhHHHHHHHHHHhCCCcc
Q 042656          154 VLAEQQIWAATTDR-AKNQAFNCTNGDVFTWKSLWKLLSEIFDVEFVPFDEKEKFDVVEMMEEKGEIWDEIVEKHGLYKT  232 (289)
Q Consensus       154 ~la~~~i~aa~~p~-a~ge~FNi~dg~~~s~~~lw~~la~~~G~~~~~~~~~~p~~l~~~~~~~~~~W~~i~~k~gl~~~  232 (289)
                      ++|+++..++.++. ..++.||++++..+|+.++...|++.+|.+...... .+                          
T Consensus       241 D~~~a~~~~~~~~~~~~~~~~~~~~~~~~si~~i~~~i~~~~~~~~~~~~~-~~--------------------------  293 (341)
T d1sb8a_         241 NTVQANLLAATAGLDARNQVYNIAVGGRTSLNQLFFALRDGLAENGVSYHR-EP--------------------------  293 (341)
T ss_dssp             HHHHHHHHHHTCCGGGCSEEEEESCSCCEEHHHHHHHHHHHHHHTTCCCCC-CC--------------------------
T ss_pred             ccchhhhhhhhccccccceeeeecccccchHHHHHHHHHHHhccccccccc-cc--------------------------
Confidence            99999999998764 578999999999999999999999999976543210 00                          


Q ss_pred             ccccccchhhhhhhhcccccccccHHHHHh-cCCCCCcChHHHHHHHHHHHHH
Q 042656          233 KMEEITCFEALNTVLHLQFQHVSSMNKSRE-FGFFGFVDTMKSIRTWVKKLRE  284 (289)
Q Consensus       233 ~l~~l~~w~f~d~~~~~~~~~~~d~~Kar~-~Gw~~~~dt~e~~~~~~~~lr~  284 (289)
                      ..        .+.-.+.......|.+|+++ +||+|.+++++++.++++||++
T Consensus       294 ~~--------~~~~~~~~~~~~~d~~k~~~~LGw~p~~sl~~gi~~ti~wy~~  338 (341)
T d1sb8a_         294 VY--------RDFREGDVRHSLADISKAAKLLGYAPKYDVSAGVALAMPWYIM  338 (341)
T ss_dssp             EE--------ECCCTTCCSBCCBCCHHHHHHTCCCCCCCHHHHHHHHHHHHHH
T ss_pred             cc--------cCCCCCCcCeeeeCHHHHHHHHCCCcCCCHHHHHHHHHHHHHH
Confidence            00        00001222356789999999 5999999999999999999986
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure