Citrus Sinensis ID: 042733


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-
ILPMTEAAIEANNHNKRGMVLLFEPHYISLNEIVYSVDMPQIGDLNSLSGAFRPGGAGKTTLMDVLAGRKPGGYITRNITVSGYPEKQETFARILGYCEQNDIHSPHDTLYDFTHCLYMFIEEGMELVELNPFRQALFEQRKRLTVAVEFVANPSIISRDEPISGLDARAATTVIRMVRNTVDMGRTVVCTIHQPSIDIFYSFDELFLLKQVGQEISVGPLGPSSIHLISYFEKIFGVSKIKDGYNLATWLLEVTALSQERAFGVDFSDIYRNSELYKRAKAVITELSKPAPVSKSLRFSTQYSQSICTKLFAWSWKLAQQRWTKQQHLFNVMVSMYTAVLFLLVQNAGSLQLVAAVEWTIFYRESALGTYSAMPYALRKNKFRASNSNTCKLSCNLSFYAMIGFEWTAAMFFWYLLLMLFIFFYFTFYGMMAEALSAKPQIAIIVSSSFYTIWNLFPGFVIPRPFVDNGEFQYGADGLLGISGILDLDFLHHSLEIYRTGQMKQFNNFFTNYFGFRHDFVGIVAVVVGLQ
cccccHHHHHHccccccccEEccccEEEEEEcEEEEEccccccccccccEEEccccccHHHHHHHHHccccccEEEEEEEEEccccccccccccccEEEEccccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccHHHHHHHHcccccccEEccccccccHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHcccccccEEEEcccccccHHHHHHHHHcccccccccccccHHHHHHHccccccccccccHHHHHcccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccccccEEEccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHccccccccEEEEEEEEEc
ccccccccHHccccccccEEEccccEEEEEccEEEEcccccEEEEcccccccccccccHHHHHHHHHccccccEEEEEEEEccccccccccHHHEEEEEcccccccccEHHHHHHHHHHHHHHHHHHHccHHHHHHccccccEEEEEHHHcccccEEEEccccccccHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHccccccccccccccHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccEEHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccEEccccccHHEEEEEcHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccccHEEEEEEEEEEc
ILPMTEAAIEANNHNKRGMVLLfephyislneivysvdmpqigdlnslsgafrpggagktTLMDVlagrkpggyitrnitvsgypekQETFARILGYceqndihsphdtlydFTHCLYMFIEEGMELVELNPFRQALFEQRKRLTVAVEFvanpsiisrdepisgldaRAATTVIRMVRNTVDMGRTVVCTihqpsidifysFDELFLLKQVgqeisvgplgpssiHLISYFEKIFGVSKIKDGYNLATWLLEVTALSqerafgvdfsdiyrnSELYKRAKAVITelskpapvskslrfsTQYSQSICTKLFAWSWKLAQQRWTKQQHLFNVMVSMYTAVLFLLVQNAGSLQLVAAVEWTIFYRESalgtysampyalrknkfrasnsntcklscnlSFYAMIGFEWTAAMFFWYLLLMLFIFFYFTFYGMMAEAlsakpqiaIIVSSSFYtiwnlfpgfviprpfvdngefqygadgllgisgildldFLHHSLEIYRTGQMKQFNNFFTNYFGFRHDFVGIVAVVVGLQ
ILPMTEAAIEannhnkrgMVLLFEPHYISLNEIVYSVDMPQIGDLNSLSGAFRPGGAGKTTLMDVLAGRKPGGYITRNITVSGYPEKQETFARILGYCEQNDIHSPHDTLYDFTHCLYMFIEEGMELVELNPFRQALFEQRKRLTVAVefvanpsiisrdepisgldaRAATTVIRMVRNTVDMGRTVVCTIHQPSIDIFYSFDELFLLKQVGQEISVGPLGPSSIHLISYFEKIFGVSKIKDGYNLATWLLEVTALSQERAFGVDFSDIYRNSELYKRAKAVitelskpapvskslrfSTQYSQSICTKLFAWSWKLAQQRWTKQQHLFNVMVSMYTAVLFLLVQNAGSLQLVAAVEWTIFYRESALGTYSAMPYALRKNKFRASNSNTCKLSCNLSFYAMIGFEWTAAMFFWYLLLMLFIFFYFTFYGMMAEALSAKPQIAIIVSSSFYTIWNLFPGFVIPRPFVDNGEFQYGADGLLGISGILDLDFLHHSLEIYRTGQMKQFNNFFTNYFGFRHDFVGIVAVVVGLQ
ILPMTEAAIEANNHNKRGMVLLFEPHYISLNEIVYSVDMPQIGDLNSLSGAFRPGGAGKTTLMDVLAGRKPGGYITRNITVSGYPEKQETFARILGYCEQNDIHSPHDTLYDFTHCLYMFIEEGMELVELNPFRQALFEQRKRLTVAVEFVANPSIISRDEPISGLDARAATTVIRMVRNTVDMGRTVVCTIHQPSIDIFYSFDELFLLKQVGQEISVGPLGPSSIHLISYFEKIFGVSKIKDGYNLATWLLEVTALSQERAFGVDFSDIYRNSELYKRAKAVITELSKPAPVSKSLRFSTQYSQSICTKLFAWSWKLAQQRWTKQQHLFNVMVSMYTAVLFLLVQNAGSLQLVAAVEWTIFYRESALGTYSAMPYALRKNKFRASNSNTCKLSCNLSFYAMIGFEWTAAmffwylllmlfiffyftfygmmAEALSAKPQIAIIVSSSFYTIWNLFPGFVIPRPFVDNGEFQYGAdgllgisgildldflHHSLEIYRTGQMKQFNNFFTNYFGFRHDFVGIVAVVVGLQ
****************RGMVLLFEPHYISLNEIVYSVDMPQIGDLNSLSGAFRPGGAGKTTLMDVLAGRKPGGYITRNITVSGYPEKQETFARILGYCEQNDIHSPHDTLYDFTHCLYMFIEEGMELVELNPFRQALFEQRKRLTVAVEFVANPSIISRDEPISGLDARAATTVIRMVRNTVDMGRTVVCTIHQPSIDIFYSFDELFLLKQVGQEISVGPLGPSSIHLISYFEKIFGVSKIKDGYNLATWLLEVTALSQERAFGVDFSDIYRNSELYKRAKAVITELSK***VSKSLRFSTQYSQSICTKLFAWSWKLAQQRWTKQQHLFNVMVSMYTAVLFLLVQNAGSLQLVAAVEWTIFYRESALGTYSAMPYALRKNKFRASNSNTCKLSCNLSFYAMIGFEWTAAMFFWYLLLMLFIFFYFTFYGMMAEALSAKPQIAIIVSSSFYTIWNLFPGFVIPRPFVDNGEFQYGADGLLGISGILDLDFLHHSLEIYRTGQMKQFNNFFTNYFGFRHDFVGIVAVVVG**
***********************EPHYISLNEIVYSVDMPQIGDLNSLSGAFRPGGAGKTTLMDVLAGRKPGGYITRNITVSGYPEKQETFARILGYCEQNDIHSPHDTLYDFTHCLYMFIEEGMELVELNPFRQALFEQRKRLTVAVEFVANPSIISRDEPISGLDARAATTVIRMVRNTVDMGRTVVCTIHQPSIDIFYSFDELFLLKQVGQEISVGPLGPSSIHLISYFEKIFGVSKIKDGYNLATWLLEVTALSQERAFGVDFSDIYRNSELYKRAKA********************YSQSICTKLFAWSWKLAQQRWTKQQHLFNVMVSMYTAVLFLLVQNAGSLQLVAAVEWTIFYRESALGTYSAMPYALRKNKFRASNSNTCKLSCNLSFYAMIGFEWTAAMFFWYLLLMLFIFFYFTFYGMMAEALSAKPQIAIIVSSSFYTIWNLFPGFVIPRPFVDNGEFQYGADGLLGISGILDLDFLHHSLEIYRTGQMKQFNNFFTNYFGFRHDFVGIVAVVVGLQ
ILPMTEAAIEANNHNKRGMVLLFEPHYISLNEIVYSVDMPQIGDLNSLSGAFRPGGAGKTTLMDVLAGRKPGGYITRNITVSGYPEKQETFARILGYCEQNDIHSPHDTLYDFTHCLYMFIEEGMELVELNPFRQALFEQRKRLTVAVEFVANPSIISRDEPISGLDARAATTVIRMVRNTVDMGRTVVCTIHQPSIDIFYSFDELFLLKQVGQEISVGPLGPSSIHLISYFEKIFGVSKIKDGYNLATWLLEVTALSQERAFGVDFSDIYRNSELYKRAKAVITELSKPAPVSKSLRFSTQYSQSICTKLFAWSWKLAQQRWTKQQHLFNVMVSMYTAVLFLLVQNAGSLQLVAAVEWTIFYRESALGTYSAMPYALRKNKFRASNSNTCKLSCNLSFYAMIGFEWTAAMFFWYLLLMLFIFFYFTFYGMMAEALSAKPQIAIIVSSSFYTIWNLFPGFVIPRPFVDNGEFQYGADGLLGISGILDLDFLHHSLEIYRTGQMKQFNNFFTNYFGFRHDFVGIVAVVVGLQ
***************KRGMVLLFEPHYISLNEIVYSVDMPQIGDLNSLSGAFRPGGAGKTTLMDVLAGRKPGGYITRNITVSGYPEKQETFARILGYCEQNDIHSPHDTLYDFTHCLYMFIEEGMELVELNPFRQALFEQRKRLTVAVEFVANPSIISRDEPISGLDARAATTVIRMVRNTVDMGRTVVCTIHQPSIDIFYSFDELFLLKQVGQEISVGPLGPSSIHLISYFEKIFGVSKIKDGYNLATWLLEVTALSQERAFGVDFSDIYRNSELYKRAKAVITELSKPAPVSKSLRFSTQYSQSICTKLFAWSWKLAQQRWTKQQHLFNVMVSMYTAVLFLLVQNAGSLQLVAAVEWTIFYRESALGTYSAMPYALRKNKFRASNSNTCKLSCNLSFYAMIGFEWTAAMFFWYLLLMLFIFFYFTFYGMMAEALSAKPQIAIIVSSSFYTIWNLFPGFVIPRPFVDNGEFQYGADGLLGISGILDLDFLHHSLEIYRTGQMKQFNNFFTNYFGFRHDFVGIVAVVVGLQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHi
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ILPMTEAAIEANNHNKRGMVLLFEPHYISLNEIVYSVDMPQIGDLNSLSGAFRPGGAGKTTLMDVLAGRKPGGYITRNITVSGYPEKQETFARILGYCEQNDIHSPHDTLYDFTHCLYMFIEEGMELVELNPFRQALFEQRKRLTVAVEFVANPSIISRDEPISGLDARAATTVIRMVRNTVDMGRTVVCTIHQPSIDIFYSFDELFLLKQVGQEISVGPLGPSSIHLISYFEKIFGVSKIKDGYNLATWLLEVTALSQERAFGVDFSDIYRNSELYKRAKAVITELSKPAPVSKSLRFSTQYSQSICTKLFAWSWKLAQQRWTKQQHLFNVMVSMYTAVLFLLVQNAGSLQLVAAVEWTIFYRESALGTYSAMPYALRKNKFRASNSNTCKLSCNLSFYAMIGFEWTAAMFFWYLLLMLFIFFYFTFYGMMAEALSAKPQIAIIVSSSFYTIWNLFPGFVIPRPFVDNGEFQYGADGLLGISGILDLDFLHHSLEIYRTGQMKQFNNFFTNYFGFRHDFVGIVAVVVGLQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query531 2.2.26 [Sep-21-2011]
Q76CU21434 Pleiotropic drug resistan N/A no 0.975 0.361 0.505 1e-153
Q9M9E11423 ABC transporter G family yes no 0.868 0.323 0.554 1e-153
A2WSH01457 Pleiotropic drug resistan N/A no 0.962 0.350 0.519 1e-151
Q0JLC51457 Pleiotropic drug resistan yes no 0.962 0.350 0.519 1e-151
Q8GU891450 Pleiotropic drug resistan no no 0.952 0.348 0.502 1e-148
Q7PC801468 Probable pleiotropic drug no no 0.971 0.351 0.495 1e-139
Q8GU881444 Putative pleiotropic drug no no 0.969 0.356 0.496 1e-138
Q8GU921464 Probable pleiotropic drug no no 0.971 0.352 0.502 1e-138
Q949G31436 Pleiotropic drug resistan N/A no 0.971 0.359 0.494 1e-136
O243671441 Pleiotropic drug resistan N/A no 0.958 0.353 0.479 1e-132
>sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 Back     alignment and function desciption
 Score =  543 bits (1400), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 302/598 (50%), Positives = 369/598 (61%), Gaps = 80/598 (13%)

Query: 8    AIEANNHNKRGMVLLFEPHYISLNEIVYSVDMPQ------IGD-----LNSLSGAFRPG- 55
            +I  + +NK+GMVL FEPH I+ +++VYSVDMPQ       G+     L  +SGAFRPG 
Sbjct: 817  SISESQNNKKGMVLPFEPHSITFDDVVYSVDMPQEMKEQGAGEDRLVLLKGVSGAFRPGV 876

Query: 56   --------GAGKTTLMDVLAGRKPGGYITRNITVSGYPEKQETFARILGYCEQNDIHSPH 107
                    GAGKTTLMDVLAGRK GGYI   I +SGYP+KQETFARI GYCEQNDIHSP+
Sbjct: 877  LTALMGVSGAGKTTLMDVLAGRKTGGYIDGEIKISGYPKKQETFARISGYCEQNDIHSPY 936

Query: 108  DTLYDF--------------THCLYMFIEEGMELVELNPFRQALF----------EQRKR 143
             T+Y+                    MF++E MELVEL P R AL           EQRKR
Sbjct: 937  VTVYESLVYSAWLRLPQDVDEKTRKMFVDEVMELVELGPLRSALVGLPGVNGLSTEQRKR 996

Query: 144  LTVAVEFVANPSIISRDEPISGLDARAATTVIRMVRNTVDMGRTVVCTIHQPSIDIFYSF 203
            LT+AVE VANPSII  DEP SGLDARAA  V+R VRNTVD GRTVVCTIHQPSIDIF +F
Sbjct: 997  LTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAF 1056

Query: 204  DELFLLKQVGQEISVGPLGPSSIHLISYFEKIFGVSKIKDGYNLATWLLEVTALSQERAF 263
            DELFL+K+ GQEI VGPLG  S HLI YFE   GV+KIK+GYN ATW+LEVTA +QE   
Sbjct: 1057 DELFLMKRGGQEIYVGPLGRHSCHLIKYFESNPGVAKIKEGYNPATWMLEVTASAQEMML 1116

Query: 264  GVDFSDIYRNSELYKRAKAVITELSKPAPVSKSLRFSTQYSQSICTKLFAWSWKLAQQRW 323
            G+DF+++Y+NS+LY+R KA+I+EL  P P SK L F TQYSQS  T+  A  WK     W
Sbjct: 1117 GIDFTEVYKNSDLYRRNKALISELGVPRPGSKDLHFETQYSQSFWTQCVACLWKQHWSYW 1176

Query: 324  -------------------------------TKQQHLFNVMVSMYTAVLFLLVQNAGSLQ 352
                                           +K Q L N M SMY AVLFL VQNA S+Q
Sbjct: 1177 RNPAYTAVRFIFTTFIALIFGTMFWDLGTKVSKSQDLLNAMGSMYAAVLFLGVQNASSVQ 1236

Query: 353  LVAAVEWTIFYRESALGTYSAMPYALRKNKFRASNSNTCKLSCNLSFYAMIGFEWTAAMF 412
             V A+E T+FYRE A G YSA+PYA  +            +   +  YAMIGFEW    F
Sbjct: 1237 PVVAIERTVFYRERAAGMYSAIPYAFGQVSIEIPYIFVQSVFYGIIVYAMIGFEWDVGKF 1296

Query: 413  FWYLLLMLFIFFYFTFYGMMAEALSAKPQIAIIVSSSFYTIWNLFPGFVIPRPFVDN-GE 471
            FWYL +M F   YFTFYGMM  A++    +A IV++ FY +WNLF GF+IPRP +     
Sbjct: 1297 FWYLFIMFFTLLYFTFYGMMGVAVTPNQNVASIVAAFFYGVWNLFSGFIIPRPRMPVWWR 1356

Query: 472  FQYGADGLL-GISGILDLDFLHHSLEIYRTGQMKQFNNFFTNYFGFRHDFVGIVAVVV 528
            + Y A+ +   + G++   F     ++     ++Q   F   YFGF+HDF+G+VA V+
Sbjct: 1357 WYYWANPVAWTLYGLVASQFGDIQTKLSDNETVEQ---FLRRYFGFKHDFLGVVAAVL 1411




May be a general defense protein.
Nicotiana tabacum (taxid: 4097)
>sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 Back     alignment and function description
>sp|A2WSH0|PDR3_ORYSI Pleiotropic drug resistance protein 3 OS=Oryza sativa subsp. indica GN=PDR3 PE=2 SV=1 Back     alignment and function description
>sp|Q0JLC5|PDR3_ORYSJ Pleiotropic drug resistance protein 3 OS=Oryza sativa subsp. japonica GN=PDR3 PE=2 SV=1 Back     alignment and function description
>sp|Q8GU89|PDR4_ORYSJ Pleiotropic drug resistance protein 4 OS=Oryza sativa subsp. japonica GN=PDR4 PE=2 SV=1 Back     alignment and function description
>sp|Q7PC80|PDR1_ORYSJ Probable pleiotropic drug resistance protein 1 OS=Oryza sativa subsp. japonica GN=PDR1 PE=3 SV=1 Back     alignment and function description
>sp|Q8GU88|PDR7_ORYSJ Putative pleiotropic drug resistance protein 7 OS=Oryza sativa subsp. japonica GN=PDR7 PE=3 SV=1 Back     alignment and function description
>sp|Q8GU92|PDR2_ORYSJ Probable pleiotropic drug resistance protein 2 OS=Oryza sativa subsp. japonica GN=PDR2 PE=3 SV=1 Back     alignment and function description
>sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 Back     alignment and function description
>sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrrhiza GN=TUR2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query531
356555825 1427 PREDICTED: pleiotropic drug resistance p 0.979 0.364 0.511 1e-156
357510219 1444 Pleiotropic drug resistance protein [Med 0.975 0.358 0.514 1e-155
255576883 1417 ATP-binding cassette transporter, putati 0.971 0.364 0.519 1e-155
224054164 1424 pleiotropic drug resistance, ABC transpo 0.951 0.354 0.522 1e-154
255572797 1359 ATP-binding cassette transporter, putati 0.962 0.376 0.516 1e-154
41052474 1078 PDR-type ABC transporter 2 [Nicotiana ta 0.979 0.482 0.51 1e-153
357455077 1410 Pleiotropic drug resistance protein [Med 0.979 0.368 0.506 1e-153
357510225 1483 Pleiotropic drug resistance protein [Med 0.975 0.349 0.506 1e-153
255546579 1309 ATP-binding cassette transporter, putati 0.962 0.390 0.519 1e-153
357455075 1427 Pleiotropic drug resistance protein [Med 0.979 0.364 0.506 1e-153
>gi|356555825|ref|XP_003546230.1| PREDICTED: pleiotropic drug resistance protein 1-like [Glycine max] Back     alignment and taxonomy information
 Score =  559 bits (1440), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 309/604 (51%), Positives = 375/604 (62%), Gaps = 84/604 (13%)

Query: 6    EAAIEANNHNKRGMVLLFEPHYISLNEIVYSVDMPQ-----------IGDLNSLSGAFRP 54
            ++ +E+++  K+GMVL FEPH I+ +E+VYSVDMPQ           +  L  +SGAFRP
Sbjct: 806  DSLVESSHGKKKGMVLPFEPHSITFDEVVYSVDMPQEMKEQGVQEDRLVLLKGVSGAFRP 865

Query: 55   G---------GAGKTTLMDVLAGRKPGGYITRNITVSGYPEKQETFARILGYCEQNDIHS 105
            G         GAGKTTLMDVLAGRK GGYI  +I +SGYP+KQETFARI GYCEQNDIHS
Sbjct: 866  GVLTALMGVSGAGKTTLMDVLAGRKTGGYIDGSIKISGYPKKQETFARISGYCEQNDIHS 925

Query: 106  PHDTLYDF--------------THCLYMFIEEGMELVELNPFRQALF----------EQR 141
            PH T+Y+               +    MFIEE MELVELNP R +L           EQR
Sbjct: 926  PHVTVYESLLYSAWLRLPSSVDSKTRKMFIEEVMELVELNPVRNSLVGLPGVSGLSTEQR 985

Query: 142  KRLTVAVEFVANPSIISRDEPISGLDARAATTVIRMVRNTVDMGRTVVCTIHQPSIDIFY 201
            KRLT+AVE VANPSII  DEP SGLDARAA  V+R VRNTVD GRTVVCTIHQPSIDIF 
Sbjct: 986  KRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFE 1045

Query: 202  SFDELFLLKQVGQEISVGPLGPSSIHLISYFEKIFGVSKIKDGYNLATWLLEVTALSQER 261
            +FDELFL+K+ GQEI VGPLG  S HLI YFE I GVSKIKDGYN ATW+LEVTA +QE 
Sbjct: 1046 AFDELFLMKRGGQEIYVGPLGRHSSHLIKYFESIEGVSKIKDGYNPATWMLEVTATAQEL 1105

Query: 262  AFGVDFSDIYRNSELYKRAKAVITELSKPAPVSKSLRFSTQYSQSICTKLFAWSWKLAQQ 321
            + GVDF+D+Y+NS+LY+R K +I EL +PAP SK L F TQYSQS   +  A  WK   Q
Sbjct: 1106 SLGVDFTDLYKNSDLYRRNKQLIQELGQPAPGSKDLHFPTQYSQSFLVQCQACLWK---Q 1162

Query: 322  RW----------------------------------TKQQHLFNVMVSMYTAVLFLLVQN 347
            RW                                  + +  L N + SMYTAVLFL VQN
Sbjct: 1163 RWSYWRNPPYTAVRFFFTTFIALMFGTIFWDLGGKHSTRGDLLNAIGSMYTAVLFLGVQN 1222

Query: 348  AGSLQLVAAVEWTIFYRESALGTYSAMPYALRKNKFRASNSNTCKLSCNLSFYAMIGFEW 407
            A S+Q V A+E T+FYRE A G YSA+PYA  +            ++  +  YAMIGFEW
Sbjct: 1223 ASSVQPVVAIERTVFYREKAAGMYSALPYAFAQILVELPYVFVQAVTYGVIVYAMIGFEW 1282

Query: 408  TAAMFFWYLLLMLFIFFYFTFYGMMAEALSAKPQIAIIVSSSFYTIWNLFPGFVIPRPFV 467
            TA  FFWYL  M F   Y+TFYGMM   L+    IA IV+++FY +WNLF GFV+ RP +
Sbjct: 1283 TAEKFFWYLFFMYFTLLYYTFYGMMTVGLTPNHHIASIVAAAFYAVWNLFSGFVVTRPSI 1342

Query: 468  DN--GEFQYGADGLLGISGILDLDFLHHSLEIYRTGQMKQFNNFFTNYFGFRHDFVGIVA 525
                  + +       I G++   F   +  +   GQ K   +F  +Y+G +HDF+G+ A
Sbjct: 1343 PVWWRWYYWACPVAWTIYGLVASQFGDLTEPMTSEGQ-KIVKDFLEDYYGIKHDFIGVSA 1401

Query: 526  VVVG 529
            VVV 
Sbjct: 1402 VVVA 1405




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|357510219|ref|XP_003625398.1| Pleiotropic drug resistance protein [Medicago truncatula] gi|355500413|gb|AES81616.1| Pleiotropic drug resistance protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|255576883|ref|XP_002529327.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223531198|gb|EEF33044.1| ATP-binding cassette transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224054164|ref|XP_002298123.1| pleiotropic drug resistance, ABC transporter family protein [Populus trichocarpa] gi|222845381|gb|EEE82928.1| pleiotropic drug resistance, ABC transporter family protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255572797|ref|XP_002527331.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223533331|gb|EEF35083.1| ATP-binding cassette transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|41052474|dbj|BAD07484.1| PDR-type ABC transporter 2 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|357455077|ref|XP_003597819.1| Pleiotropic drug resistance protein [Medicago truncatula] gi|355486867|gb|AES68070.1| Pleiotropic drug resistance protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357510225|ref|XP_003625401.1| Pleiotropic drug resistance protein [Medicago truncatula] gi|355500416|gb|AES81619.1| Pleiotropic drug resistance protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|255546579|ref|XP_002514349.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223546805|gb|EEF48303.1| ATP-binding cassette transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357455075|ref|XP_003597818.1| Pleiotropic drug resistance protein [Medicago truncatula] gi|355486866|gb|AES68069.1| Pleiotropic drug resistance protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query531
TAIR|locus:21965931423 ABCG40 "ATP-binding cassette G 0.421 0.157 0.610 1.8e-123
TAIR|locus:20196931454 ABCG39 "ATP-binding cassette G 0.427 0.156 0.533 2.4e-106
TAIR|locus:20259311469 PEN3 "PENETRATION 3" [Arabidop 0.444 0.160 0.478 3.7e-96
TAIR|locus:20949521416 ABCG29 "ATP-binding cassette G 0.418 0.156 0.510 5.4e-95
TAIR|locus:20456831426 ABCG31 "ATP-binding cassette G 0.419 0.156 0.483 1e-93
TAIR|locus:20448931453 ABCG34 "ATP-binding cassette G 0.549 0.200 0.477 6e-85
TAIR|locus:20395231420 ABCG32 "ATP-binding cassette G 0.421 0.157 0.525 3.8e-82
TAIR|locus:20377031442 ABCG35 "ATP-binding cassette G 0.421 0.155 0.5 2.5e-74
TAIR|locus:20840811450 ABCG37 "ATP-binding cassette G 0.419 0.153 0.468 9.8e-69
TAIR|locus:20498671413 ABCG33 "ATP-binding cassette G 0.433 0.162 0.462 5.8e-51
TAIR|locus:2196593 ABCG40 "ATP-binding cassette G40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 683 (245.5 bits), Expect = 1.8e-123, Sum P(3) = 1.8e-123
 Identities = 146/239 (61%), Positives = 170/239 (71%)

Query:   119 MFIEEGMELVELNPFRQALF----------EQRKRLTVAVEFVANPSIISRDEPISGLDA 168
             +FIEE MELVEL P RQAL           EQRKRLT+AVE VANPSII  DEP SGLDA
Sbjct:   950 IFIEEVMELVELTPLRQALVGLPGESGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDA 1009

Query:   169 RAATTVIRMVRNTVDMGRTVVCTIHQPSIDIFYSFDELFLLKQVGQEISVGPLGPSSIHL 228
             RAA  V+R VRNTVD GRTVVCTIHQPSIDIF +FDELFLLK+ G+EI VGPLG  S HL
Sbjct:  1010 RAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLLKRGGEEIYVGPLGHESTHL 1069

Query:   229 ISYFEKIFGVSKIKDGYNLATWLLEVTALSQERAFGVDFSDIYRNSELYKRAKAVITELS 288
             I+YFE I G++KI +GYN ATW+LEV+  SQE A GVDF+ +Y+NSELYKR K +I ELS
Sbjct:  1070 INYFESIQGINKITEGYNPATWMLEVSTTSQEAALGVDFAQVYKNSELYKRNKELIKELS 1129

Query:   289 KPAPVSKSLRFSTQYSQSICTKLFAWSWKLAQQRW-----TKQQHLFNVMVSMYTAVLF 342
             +PAP SK L F TQYSQS  T+  A  WK     W     T  + LF + +++    +F
Sbjct:  1130 QPAPGSKDLYFPTQYSQSFLTQCMASLWKQHWSYWRNPPYTAVRFLFTIGIALMFGTMF 1188


GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0016887 "ATPase activity" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0042626 "ATPase activity, coupled to transmembrane movement of substances" evidence=ISS
GO:0005886 "plasma membrane" evidence=IDA
GO:0015692 "lead ion transport" evidence=IMP
GO:0006855 "drug transmembrane transport" evidence=ISS
GO:0009723 "response to ethylene stimulus" evidence=RCA;TAS
GO:0009751 "response to salicylic acid stimulus" evidence=TAS
GO:0009753 "response to jasmonic acid stimulus" evidence=RCA;TAS
GO:0010193 "response to ozone" evidence=IEP
GO:0046865 "terpenoid transport" evidence=IDA
GO:0080168 "abscisic acid transport" evidence=IDA
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0007165 "signal transduction" evidence=RCA
GO:0009414 "response to water deprivation" evidence=RCA
GO:0009595 "detection of biotic stimulus" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
GO:0009733 "response to auxin stimulus" evidence=RCA
GO:0009737 "response to abscisic acid stimulus" evidence=RCA
GO:0009738 "abscisic acid mediated signaling pathway" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010200 "response to chitin" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0042538 "hyperosmotic salinity response" evidence=RCA
GO:0042742 "defense response to bacterium" evidence=RCA
GO:0043069 "negative regulation of programmed cell death" evidence=RCA
GO:0043900 "regulation of multi-organism process" evidence=RCA
GO:0050832 "defense response to fungus" evidence=RCA
TAIR|locus:2019693 ABCG39 "ATP-binding cassette G39" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025931 PEN3 "PENETRATION 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094952 ABCG29 "ATP-binding cassette G29" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045683 ABCG31 "ATP-binding cassette G31" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044893 ABCG34 "ATP-binding cassette G34" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039523 ABCG32 "ATP-binding cassette G32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037703 ABCG35 "ATP-binding cassette G35" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084081 ABCG37 "ATP-binding cassette G37" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2049867 ABCG33 "ATP-binding cassette G33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00031482
hypothetical protein (799 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query531
PLN031401470 PLN03140, PLN03140, ABC transporter G family membe 1e-164
TIGR009561394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 5e-97
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 2e-65
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 2e-47
TIGR00955617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 1e-32
cd03234226 cd03234, ABCG_White, White pigment protein homolog 4e-30
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 1e-23
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 2e-20
PLN03211659 PLN03211, PLN03211, ABC transporter G-25; Provisio 3e-17
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 8e-14
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 4e-13
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 9e-13
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 1e-12
pfam01061210 pfam01061, ABC2_membrane, ABC-2 type transporter 2e-12
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 3e-12
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 7e-11
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 1e-10
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 2e-10
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 6e-10
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 1e-09
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 2e-09
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 2e-09
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 8e-09
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 2e-08
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 3e-08
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 8e-08
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 1e-07
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transpor 2e-07
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 2e-07
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding sub 3e-07
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 1e-06
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 2e-06
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 2e-06
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 2e-06
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 2e-06
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 3e-06
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 3e-06
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 3e-06
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 4e-06
COG4604252 COG4604, CeuD, ABC-type enterochelin transport sys 8e-06
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 1e-05
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 1e-05
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 2e-05
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 3e-05
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 4e-05
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 4e-05
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 5e-05
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 5e-05
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 5e-05
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 6e-05
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter Nod 6e-05
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 6e-05
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 7e-05
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 9e-05
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantib 1e-04
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 1e-04
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 1e-04
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; 2e-04
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter A 2e-04
COG1123539 COG1123, COG1123, ATPase components of various ABC 2e-04
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 2e-04
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 3e-04
COG4988559 COG4988, CydD, ABC-type transport system involved 3e-04
COG4133209 COG4133, CcmA, ABC-type transport system involved 3e-04
PLN03140 1470 PLN03140, PLN03140, ABC transporter G family membe 4e-04
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 4e-04
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding sub 5e-04
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 5e-04
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 5e-04
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 6e-04
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 6e-04
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 6e-04
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 6e-04
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate es 7e-04
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transpo 8e-04
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 9e-04
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 0.001
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding sub 0.001
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 0.001
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 0.002
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 0.002
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine tran 0.002
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit 0.002
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 0.003
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protei 0.003
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 0.003
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 0.003
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 0.003
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP 0.004
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system 0.004
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/orni 0.004
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
 Score =  502 bits (1294), Expect = e-164
 Identities = 256/548 (46%), Positives = 330/548 (60%), Gaps = 99/548 (18%)

Query: 6    EAAIEANN--HNKRGMVLLFEPHYISLNEIVYSVDMP-----------QIGDLNSLSGAF 52
            ++++EA N    KRGMVL F P  +S +++ Y VDMP           ++  L  ++GAF
Sbjct: 844  DSSLEAANGVAPKRGMVLPFTPLAMSFDDVNYFVDMPAEMKEQGVTEDRLQLLREVTGAF 903

Query: 53   RPG---------GAGKTTLMDVLAGRKPGGYITRNITVSGYPEKQETFARILGYCEQNDI 103
            RPG         GAGKTTLMDVLAGRK GGYI  +I +SG+P+KQETFARI GYCEQNDI
Sbjct: 904  RPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIRISGFPKKQETFARISGYCEQNDI 963

Query: 104  HSPHDTLYD---FTHCL-----------YMFIEEGMELVELNPFRQALF----------E 139
            HSP  T+ +   ++  L            MF++E MELVEL+  + A+           E
Sbjct: 964  HSPQVTVRESLIYSAFLRLPKEVSKEEKMMFVDEVMELVELDNLKDAIVGLPGVTGLSTE 1023

Query: 140  QRKRLTVAVEFVANPSIISRDEPISGLDARAATTVIRMVRNTVDMGRTVVCTIHQPSIDI 199
            QRKRLT+AVE VANPSII  DEP SGLDARAA  V+R VRNTVD GRTVVCTIHQPSIDI
Sbjct: 1024 QRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI 1083

Query: 200  FYSFDELFLLKQVGQEISVGPLGPSSIHLISYFEKIFGVSKIKDGYNLATWLLEVTALSQ 259
            F +FDEL L+K+ GQ I  GPLG +S  +I YFE I GV KIK+ YN ATW+LEV++L+ 
Sbjct: 1084 FEAFDELLLMKRGGQVIYSGPLGRNSHKIIEYFEAIPGVPKIKEKYNPATWMLEVSSLAA 1143

Query: 260  ERAFGVDFSDIYRNSELYKRAKAVITELSKPAPVSKSLRFSTQYSQSICTKLFAWSWKLA 319
            E   G+DF++ Y++S LY+R KA++ ELS P P +  L F+TQYSQS   +  +  WK  
Sbjct: 1144 EVKLGIDFAEHYKSSSLYQRNKALVKELSTPPPGASDLYFATQYSQSTWGQFKSCLWK-- 1201

Query: 320  QQRWT----------------------------------KQQHLFNVMVSMYTAVLFLLV 345
             Q WT                                      L  V+ +MY AVLF+ +
Sbjct: 1202 -QWWTYWRSPDYNLVRFFFTLAAALMVGTIFWKVGTKRSNANDLTMVIGAMYAAVLFVGI 1260

Query: 346  QNAGSLQLVAAVEWTIFYRESALGTYSAMPYALRKNKFRASNSNTCKLS--------CNL 397
             N  ++Q + AVE T+FYRE A G YSA+PYA+ +          C++           L
Sbjct: 1261 NNCSTVQPMVAVERTVFYRERAAGMYSALPYAIAQ--------VVCEIPYVLIQTTYYTL 1312

Query: 398  SFYAMIGFEWTAAMFFWYLLLMLFIFFYFTFYGMMAEALSAKPQIAIIVSSSFYTIWNLF 457
              YAM+ FEWTAA FFW+  +  F F YFT+YGMM  +L+   Q+A I +++FY ++NLF
Sbjct: 1313 IVYAMVAFEWTAAKFFWFYFISFFSFLYFTYYGMMTVSLTPNQQVAAIFAAAFYGLFNLF 1372

Query: 458  PGFVIPRP 465
             GF IPRP
Sbjct: 1373 SGFFIPRP 1380


Length = 1470

>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|216273 pfam01061, ABC2_membrane, ABC-2 type transporter Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|184129 PRK13543, PRK13543, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 531
KOG00651391 consensus Pleiotropic drug resistance proteins (PD 100.0
PLN031401470 ABC transporter G family member; Provisional 100.0
KOG0061613 consensus Transporter, ABC superfamily (Breast can 100.0
TIGR009561394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
TIGR00955617 3a01204 The Eye Pigment Precursor Transporter (EPP 100.0
PLN03211659 ABC transporter G-25; Provisional 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
PLN03140 1470 ABC transporter G family member; Provisional 100.0
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
COG3842352 PotA ABC-type spermidine/putrescine transport syst 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 100.0
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 100.0
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
PRK11607377 potG putrescine transporter ATP-binding subunit; P 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
COG4152300 ABC-type uncharacterized transport system, ATPase 100.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
cd03234226 ABCG_White The White subfamily represents ABC tran 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 100.0
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 100.0
PRK09984262 phosphonate/organophosphate ester transporter subu 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG0411250 LivG ABC-type branched-chain amino acid transport 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 100.0
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 100.0
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 100.0
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
PRK10070400 glycine betaine transporter ATP-binding subunit; P 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 100.0
COG4175386 ProV ABC-type proline/glycine betaine transport sy 100.0
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 100.0
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 100.0
COG4598256 HisP ABC-type histidine transport system, ATPase c 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 100.0
PRK14241258 phosphate transporter ATP-binding protein; Provisi 100.0
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
COG4559259 ABC-type hemin transport system, ATPase component 100.0
PRK09473330 oppD oligopeptide transporter ATP-binding componen 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 100.0
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 100.0
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 100.0
cd03299235 ABC_ModC_like Archeal protein closely related to M 100.0
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 100.0
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 100.0
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 99.98
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 99.98
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.98
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 99.98
PRK14240250 phosphate transporter ATP-binding protein; Provisi 99.98
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 99.98
COG0410237 LivF ABC-type branched-chain amino acid transport 99.98
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 99.98
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.98
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 99.98
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 99.98
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 99.98
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 99.98
PRK14236272 phosphate transporter ATP-binding protein; Provisi 99.98
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 99.98
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 99.98
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 99.98
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 99.98
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.98
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 99.98
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.98
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 99.98
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 99.98
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 99.98
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 99.98
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.97
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.97
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 99.97
cd03246173 ABCC_Protease_Secretion This family represents the 99.97
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 99.97
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 99.97
PRK14238271 phosphate transporter ATP-binding protein; Provisi 99.97
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 99.97
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 99.97
COG4525259 TauB ABC-type taurine transport system, ATPase com 99.97
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 99.97
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 99.97
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.97
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.97
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 99.97
PRK09580248 sufC cysteine desulfurase ATPase component; Review 99.97
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 99.97
cd03215182 ABC_Carb_Monos_II This family represents domain II 99.97
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 99.97
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 99.97
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.97
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 99.97
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.97
PRK03695248 vitamin B12-transporter ATPase; Provisional 99.97
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 99.97
PRK14243264 phosphate transporter ATP-binding protein; Provisi 99.97
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 99.97
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 99.97
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.97
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.97
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 99.97
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.97
COG4148352 ModC ABC-type molybdate transport system, ATPase c 99.97
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 99.97
COG1123539 ATPase components of various ABC-type transport sy 99.97
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.97
PRK10790592 putative multidrug transporter membrane\ATP-bindin 99.97
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.97
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 99.97
COG4988559 CydD ABC-type transport system involved in cytochr 99.97
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.97
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 99.97
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 99.97
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.97
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.97
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 99.97
PRK10938490 putative molybdenum transport ATP-binding protein 99.97
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 99.97
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.97
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 99.97
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 99.97
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.97
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.97
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 99.97
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.97
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.97
COG1123539 ATPase components of various ABC-type transport sy 99.97
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.97
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.97
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 99.97
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 99.97
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.97
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.97
COG4181228 Predicted ABC-type transport system involved in ly 99.97
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 99.97
COG4161242 ArtP ABC-type arginine transport system, ATPase co 99.97
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 99.97
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.97
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.97
COG4987573 CydC ABC-type transport system involved in cytochr 99.97
PRK13546264 teichoic acids export protein ATP-binding subunit; 99.97
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.97
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.97
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.97
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 99.97
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 99.97
PRK13545549 tagH teichoic acids export protein ATP-binding sub 99.97
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 99.97
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.97
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 99.97
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 99.97
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.97
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.97
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 99.97
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 99.97
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.97
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.97
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 99.97
PRK10789569 putative multidrug transporter membrane\ATP-bindin 99.97
COG4586325 ABC-type uncharacterized transport system, ATPase 99.97
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.97
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.96
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.96
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 99.96
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 99.96
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.96
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 99.96
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 99.96
COG4172534 ABC-type uncharacterized transport system, duplica 99.96
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 99.96
PRK10535 648 macrolide transporter ATP-binding /permease protei 99.96
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.96
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.96
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.96
PLN032321495 ABC transporter C family member; Provisional 99.96
PLN031301622 ABC transporter C family member; Provisional 99.96
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.96
PRK10938490 putative molybdenum transport ATP-binding protein 99.96
PRK10522547 multidrug transporter membrane component/ATP-bindi 99.96
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.96
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 99.96
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.96
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.96
COG4618580 ArpD ABC-type protease/lipase transport system, AT 99.96
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 99.96
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.96
PTZ002651466 multidrug resistance protein (mdr1); Provisional 99.96
PTZ002431560 ABC transporter; Provisional 99.96
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 99.96
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.96
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.96
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 99.96
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.95
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.95
PRK13409590 putative ATPase RIL; Provisional 99.95
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.95
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 99.95
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 99.95
COG4674249 Uncharacterized ABC-type transport system, ATPase 99.95
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.95
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.95
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.95
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.95
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 99.95
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.95
KOG0059885 consensus Lipid exporter ABCA1 and related protein 99.95
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.95
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 99.94
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 99.94
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 99.94
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.94
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.94
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.94
PRK11147635 ABC transporter ATPase component; Reviewed 99.94
COG4619223 ABC-type uncharacterized transport system, ATPase 99.94
COG4167267 SapF ABC-type antimicrobial peptide transport syst 99.94
PLN03073718 ABC transporter F family; Provisional 99.93
PLN03232 1495 ABC transporter C family member; Provisional 99.93
COG4172534 ABC-type uncharacterized transport system, duplica 99.93
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.93
PRK11147635 ABC transporter ATPase component; Reviewed 99.93
PLN03130 1622 ABC transporter C family member; Provisional 99.93
COG1101263 PhnK ABC-type uncharacterized transport system, AT 99.93
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 99.93
PRK13409590 putative ATPase RIL; Provisional 99.93
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 99.92
COG4133209 CcmA ABC-type transport system involved in cytochr 99.92
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 99.92
COG0488530 Uup ATPase components of ABC transporters with dup 99.91
KOG00541381 consensus Multidrug resistance-associated protein/ 99.91
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 99.91
PLN03073718 ABC transporter F family; Provisional 99.91
COG4136213 ABC-type uncharacterized transport system, ATPase 99.9
PTZ00243 1560 ABC transporter; Provisional 99.9
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 99.89
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.89
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 99.89
KOG0054 1381 consensus Multidrug resistance-associated protein/ 99.89
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 99.88
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 99.88
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.87
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.87
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.87
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 99.87
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 99.87
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 99.86
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 99.86
COG0488530 Uup ATPase components of ABC transporters with dup 99.86
COG4178604 ABC-type uncharacterized transport system, permeas 99.82
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 99.81
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 99.8
COG4615546 PvdE ABC-type siderophore export system, fused ATP 99.78
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.78
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.77
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.76
COG4170330 SapD ABC-type antimicrobial peptide transport syst 99.76
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.75
KOG2355291 consensus Predicted ABC-type transport, ATPase com 99.75
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.72
cd03239178 ABC_SMC_head The structural maintenance of chromos 99.71
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.71
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.71
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 99.68
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein 99.68
PF01061210 ABC2_membrane: ABC-2 type transporter; InterPro: I 99.68
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 99.67
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.67
KOG0062582 consensus ATPase component of ABC transporters wit 99.65
KOG0062582 consensus ATPase component of ABC transporters wit 99.63
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.61
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC ( 99.6
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 99.59
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 99.57
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.54
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 99.53
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 99.53
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.51
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, 99.45
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 99.45
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.44
KOG0064728 consensus Peroxisomal long-chain acyl-CoA transpor 99.41
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.4
cd03242270 ABC_RecF RecF is a recombinational DNA repair ATPa 99.4
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 99.39
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 99.31
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 99.3
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 99.25
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 99.25
KOG0063592 consensus RNAse L inhibitor, ABC superfamily [RNA 99.16
PF02463220 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: 99.1
TIGR00634563 recN DNA repair protein RecN. All proteins in this 99.04
PHA02562562 46 endonuclease subunit; Provisional 99.03
TIGR01069771 mutS2 MutS2 family protein. Function of MutS2 is u 99.02
PRK10869553 recombination and repair protein; Provisional 98.98
TIGR03062208 pip_yhgE_Cterm YhgE/Pip C-terminal domain. This fa 98.98
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 98.98
TIGR006181042 sbcc exonuclease SbcC. This family is based on the 98.95
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 98.95
TIGR01247236 drrB daunorubicin resistance ABC transporter membr 98.95
KOG0063592 consensus RNAse L inhibitor, ABC superfamily [RNA 98.91
COG3910233 Predicted ATPase [General function prediction only 98.88
PRK08533230 flagellar accessory protein FlaH; Reviewed 98.83
PRK00409782 recombination and DNA strand exchange inhibitor pr 98.8
PRK03918880 chromosome segregation protein; Provisional 98.79
TIGR00025232 Mtu_efflux ABC transporter efflux protein, DrrB fa 98.77
cd01124187 KaiC KaiC is a circadian clock protein primarily f 98.74
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.74
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS 98.72
PRK01156895 chromosome segregation protein; Provisional 98.71
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 98.68
PRK102461047 exonuclease subunit SbcC; Provisional 98.68
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, 98.65
PRK07721438 fliI flagellum-specific ATP synthase; Validated 98.63
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 98.62
PRK13695174 putative NTPase; Provisional 98.62
cd01128249 rho_factor Transcription termination factor rho is 98.61
TIGR03861253 phenyl_ABC_PedC alcohol ABC transporter, permease 98.6
TIGR006061311 rad50 rad50. This family is based on the phylogeno 98.59
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 98.57
TIGR01291253 nodJ ABC-2 type transporter, NodJ family. Nearly a 98.55
PRK00064361 recF recombination protein F; Reviewed 98.52
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 98.5
TIGR01248152 drrC daunorubicin resistance protein C. The model 98.43
PRK02224880 chromosome segregation protein; Provisional 98.36
TIGR00611365 recf recF protein. All proteins in this family for 98.35
PRK06067234 flagellar accessory protein FlaH; Validated 98.3
TIGR021691164 SMC_prok_A chromosome segregation protein SMC, pri 98.29
PRK14079349 recF recombination protein F; Provisional 98.23
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 98.19
smart00382148 AAA ATPases associated with a variety of cellular 98.14
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 98.14
PRK15066257 inner membrane transport permease; Provisional 98.14
PF13304303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 98.05
PRK06793432 fliI flagellum-specific ATP synthase; Validated 98.03
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 97.95
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 97.94
COG0842286 ABC-type multidrug transport system, permease comp 97.94
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 97.89
PRK13830818 conjugal transfer protein TrbE; Provisional 97.68
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.66
PRK05399854 DNA mismatch repair protein MutS; Provisional 97.64
TIGR026801353 conserved hypothetical protein TIGR02680. Members 97.62
PF12698344 ABC2_membrane_3: ABC-2 family transporter protein; 97.56
PF00488235 MutS_V: MutS domain V C-terminus.; InterPro: IPR00 97.5
TIGR00152188 dephospho-CoA kinase. This model produces scores i 97.5
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 97.49
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.44
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 97.37
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 97.36
PRK13764602 ATPase; Provisional 97.33
PRK14088440 dnaA chromosomal replication initiation protein; P 97.32
PRK04296190 thymidine kinase; Provisional 97.27
PF09818448 ABC_ATPase: Predicted ATPase of the ABC class; Int 97.14
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 97.1
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 97.05
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 97.05
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 97.02
PF1355890 SbcCD_C: Putative exonuclease SbcCD, C subunit; PD 96.95
TIGR01026440 fliI_yscN ATPase FliI/YscN family. This family of 96.86
PRK13891852 conjugal transfer protein TrbE; Provisional 96.83
PRK06893229 DNA replication initiation factor; Validated 96.82
PF1355562 AAA_29: P-loop containing region of AAA domain 96.81
PRK00454196 engB GTP-binding protein YsxC; Reviewed 96.69
PF13175415 AAA_15: AAA ATPase domain 96.64
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 96.61
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 96.59
cd01881176 Obg_like The Obg-like subfamily consists of five w 96.57
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 96.46
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 96.46
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
Probab=100.00  E-value=7e-93  Score=794.98  Aligned_cols=512  Identities=43%  Similarity=0.698  Sum_probs=467.7

Q ss_pred             CCCccccccceEEEEEeEEEEEe--------CCCccccccEEEEEcCC---------CchHHHHHHHHhCCCCCceEEEE
Q 042733           16 KRGMVLLFEPHYISLNEIVYSVD--------MPQIGDLNSLSGAFRPG---------GAGKTTLMDVLAGRKPGGYITRN   78 (531)
Q Consensus        16 ~~~~~~~~~~~~l~~~~ls~~~~--------~~~~~iL~~vs~~i~~g---------GaGKTTLLk~L~G~~~~g~~~G~   78 (531)
                      ++++..|..+..++.+||.+..+        .+++++|+||+|.++||         ||||||||++|+||...|.++|+
T Consensus       770 ~~~~~~~~~~~~~~~~~V~~w~dl~~~~~~qG~~~qLL~~V~G~~kPG~LTALMG~SGAGKTTLLdvLA~R~t~G~I~Gd  849 (1391)
T KOG0065|consen  770 KNKMVLPFTPLSLTFKDVFYWVDLPYEMPIQGGTRQLLNNVSGAFKPGVLTALMGESGAGKTTLLDVLAGRKTGGYIEGD  849 (1391)
T ss_pred             cccccCCCccccccccceEEEEeCCccccccccceEhhhcCceEecCCceeehhcCCCCchHHHHHHHhcCcccceEEeE
Confidence            34666665555555555544432        23458999999999999         99999999999999999999999


Q ss_pred             EEEcCcccchhhhcceEEEEecCCCCCCCCcHHhH--------------HHHHHHHHHHHHHhcCCchhhhccH------
Q 042733           79 ITVSGYPEKQETFARILGYCEQNDIHSPHDTLYDF--------------THCLYMFIEEGMELVELNPFRQALF------  138 (531)
Q Consensus        79 i~~~g~~~~~~~~~~~igyv~Q~~~~~~~ltv~e~--------------~~~~~~~~~~~l~~l~l~~~~~~~~------  138 (531)
                      |.++|.|.++..++|.+|||.|+|.|.+.+||+|.              .+++.+.++++++.++|++++|..+      
T Consensus       850 i~i~G~p~~q~tF~R~~GYvqQ~DiH~~~~TVrESL~fSA~LRlp~~v~~~ek~~yVe~Vi~lleL~~~~daiVG~~G~G  929 (1391)
T KOG0065|consen  850 ILISGFPKDQETFARVSGYVEQQDIHSPELTVRESLRFSAALRLPKEVSDEEKYEYVEEVIELLELKEYADALVGLPGSG  929 (1391)
T ss_pred             EEECCeeCchhhhccccceeecccccCcccchHHHHHHHHHHcCCCcCCHHHHHHHHHHHHHHhCchhhhhhhccCCCCC
Confidence            99999998878899999999999999999999997              3455588999999999999999988      


Q ss_pred             ---HHHHHHHHHHHHhhCC-CeEEEeCCCCCCCHHHHHHHHHHHHHHHHcCCeEEEEecCCchHHHhccCeEEEEccCce
Q 042733          139 ---EQRKRLTVAVEFVANP-SIISRDEPISGLDARAATTVIRMVRNTVDMGRTVVCTIHQPSIDIFYSFDELFLLKQVGQ  214 (531)
Q Consensus       139 ---GerqRv~iA~aL~~~p-~lllLDEPtsgLD~~~~~~i~~~L~~l~~~g~tvi~~~H~~~~~i~~~~d~v~lL~~~G~  214 (531)
                         +||||++||.+|+.+| .||+|||||||||+.++..+++.+|+++++|+||+||+|||+.++++.||++++|++||+
T Consensus       930 Ls~eQRKrLTIgVELvA~P~~ilFLDEPTSGLDsqaA~~i~~~lrkla~tGqtIlCTIHQPS~~ife~FD~LLLLkrGGq 1009 (1391)
T KOG0065|consen  930 LSTEQRKRLTIGVELVANPSSILFLDEPTSGLDSQAAAIVMRFLRKLADTGQTILCTIHQPSIDIFEAFDELLLLKRGGQ 1009 (1391)
T ss_pred             CCHHHhceeeEEEEEecCCceeEEecCCCCCccHHHHHHHHHHHHHHHhcCCeEEEEecCCcHHHHHHHhHHHHHhcCCe
Confidence               4999999999999999 899999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeecCCCCCCchhHHHHHHhhcCcccCCCCCCccchhhhhhccccccccCcchHHHhhccHHHHHHHHHHHHhCCCCCC-
Q 042733          215 EISVGPLGPSSIHLISYFEKIFGVSKIKDGYNLATWLLEVTALSQERAFGVDFSDIYRNSELYKRAKAVITELSKPAPV-  293 (531)
Q Consensus       215 ~v~~G~~~~~~~~~~~~f~~~~~~~~~~~~~n~ad~~~~v~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~-  293 (531)
                      +||.||+++.++.+++||+++++++ |+...|||||++|+++...+.....||++.|++|+.+++.++++++++.+.+. 
T Consensus      1010 tVY~G~lG~~s~~li~YFes~~~~~-~~~~~NPA~~mLevi~~~~~~~~~~D~a~~w~~S~e~k~~~e~v~~l~~~~~~~ 1088 (1391)
T KOG0065|consen 1010 TVYFGPLGENSSKLIEYFESIGGVK-CISDENPAEWMLEVIGAGAEASLSVDFAEIWKNSEEYKRNKELVKELSQPPPGF 1088 (1391)
T ss_pred             EEEecCcccccHHHHHHHHhcCCcc-CCCCCChHHHHHhhcccccccccCccHHHHHhccHHHHHHHHHHHHHhcCCccC
Confidence            9999999998889999999998874 77767999999999988777777889999999999999999999999988877 


Q ss_pred             CCCCCCCCcccccHHHHHHHHHHHHHHHhh----------------------------cchHHHHHHHHHHHHHHHHHHH
Q 042733          294 SKSLRFSTQYSQSICTKLFAWSWKLAQQRW----------------------------TKQQHLFNVMVSMYTAVLFLLV  345 (531)
Q Consensus       294 ~~~~~~~~~~~~~~~~q~~~l~~R~~~~~~----------------------------~~~~~~~~~~g~lf~~~~~~~~  345 (531)
                      ..+...+++|++|+|.|++.++||+++.||                            .+.++++|.+|++|+++++.+.
T Consensus      1089 ~~~~~~~~~fa~s~~~Q~k~~l~Rq~~syWRsp~y~~ar~~~~i~~gl~iGf~F~~~g~~~q~lqn~m~a~yma~v~~~~ 1168 (1391)
T KOG0065|consen 1089 STDLEFKTRFAQSLWYQFKLCLWRQFLSYWRSPDYLMARFALTIVAGLFIGFTFWKVGHNVQGLQNAMGAAYMATVFSGP 1168 (1391)
T ss_pred             CcccccccccchhHHHHHHHHHHHHHHHHhCCcHHHHHHHHHHHHHHHhheeeeeecCCcHHHHHHHHHHHHHHHHHhhh
Confidence            666777888999999999999999999998                            5678899999999999999888


Q ss_pred             HhhhhHHHHHHHHHHHHHHhcCCCCCCchHHHHHHHHHHHHHHHHhhhhhhhheecccccccChhHHHHHHHHHHHHHHH
Q 042733          346 QNAGSLQLVAAVEWTIFYRESALGTYSAMPYALRKNKFRASNSNTCKLSCNLSFYAMIGFEWTAAMFFWYLLLMLFIFFY  425 (531)
Q Consensus       346 ~~~~~~~~~~~~er~v~~rE~~~~~Y~~~~y~la~~l~elP~~~~~~~~f~~i~Y~~~Gl~~~~~~f~~f~l~~~l~~~~  425 (531)
                      .+.....+.+..||.+++||+++|+||+.+|++|++++|+|+.++++++|.+++|+|+||.+++.+|++||+.+++..++
T Consensus      1169 ~~~~~~~~~v~~e~~y~~RE~~s~mYs~~~~~~aq~~vEiP~~l~~stl~~~~~Y~~iGF~~~a~~~~~f~~~~~~f~lY 1248 (1391)
T KOG0065|consen 1169 NNNQLQQPAVATERLYEYRERASNMYSWTPFALAQVLVEIPYNLLQSTLFFLITYYPIGFYWTASKFFWFLLFMFIFFLY 1248 (1391)
T ss_pred             hhhhhhhhHHhhhhhheeeecccCcccHHHHHHHHHHHHHHHHHHHHHHhheeeeeeccchhhHHHHHHHHHHHHHHHHH
Confidence            77776778888999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhCCCHHHHHHHHHHHHHHHHHhcccccCCCCCCceE-EEE-ecchHHHHHHHHHhhccCceeee------
Q 042733          426 FTFYGMMAEALSAKPQIAIIVSSSFYTIWNLFPGFVIPRPFVDNGE-FQY-GADGLLGISGILDLDFLHHSLEI------  497 (531)
Q Consensus       426 ~~~~~~~i~~~~~~~~~A~~~~~~~~~~~~lf~Gf~i~~~~ip~~~-W~~-isp~~y~~~~l~~nef~~~~~~~------  497 (531)
                      .+++|+|+.+++||.++|..+++++++++.+|||+++|++.||.|| ||| +||+.|.+++++..++++.+..|      
T Consensus      1249 f~~~Gmm~~s~tPn~~~Aav~~s~~~s~~~~F~G~l~p~~~iP~fW~wmy~lsP~ty~l~gli~~~~~d~~v~c~~~e~~ 1328 (1391)
T KOG0065|consen 1249 FTTLGMMLVSLTPNLQTAAVIASLFFSFWNLFSGFLQPRSLIPKFWIWMYYLSPVTYTLEGLISSQLGDVEVTCEDSEMN 1328 (1391)
T ss_pred             HHHHHHHHHHhCCChhHHHHHHHHHHHHHHHhcccccccccccceeeeeeecCcHHHHHHHHHHHHhCCCceeeecCCcc
Confidence            9999999999999999999999999999999999999999999999 999 99999999999999999887766      


Q ss_pred             -ecCCCCccHHHHHHhhcC----CccccceeeEEEE
Q 042733          498 -YRTGQMKQFNNFFTNYFG----FRHDFVGIVAVVV  528 (531)
Q Consensus       498 -~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~  528 (531)
                       .+|+++.+|++|++.++|    |.+|...+.+...
T Consensus      1329 ~~~pp~g~tcge~m~~~~~~~~Gy~~n~~a~~~c~~ 1364 (1391)
T KOG0065|consen 1329 YFDPPSGQTCGEFMEDFFGEGTGYLHNPLATTACVY 1364 (1391)
T ss_pred             ccCCCCCcCHHHHHHHHhccCcceeccCcceeEEEE
Confidence             234566899999999999    9988877666543



>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PF01061 ABC2_membrane: ABC-2 type transporter; InterPro: IPR013525 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>TIGR03062 pip_yhgE_Cterm YhgE/Pip C-terminal domain Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>TIGR00618 sbcc exonuclease SbcC Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>TIGR01247 drrB daunorubicin resistance ABC transporter membrane protein Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR00025 Mtu_efflux ABC transporter efflux protein, DrrB family Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>TIGR03861 phenyl_ABC_PedC alcohol ABC transporter, permease protein Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>TIGR01291 nodJ ABC-2 type transporter, NodJ family Back     alignment and domain information
>PRK00064 recF recombination protein F; Reviewed Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>TIGR01248 drrC daunorubicin resistance protein C Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR00611 recf recF protein Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PRK14079 recF recombination protein F; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK15066 inner membrane transport permease; Provisional Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>COG0842 ABC-type multidrug transport system, permease component [Defense mechanisms] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK13830 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK05399 DNA mismatch repair protein MutS; Provisional Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PF12698 ABC2_membrane_3: ABC-2 family transporter protein; PDB: 2P0S_B 3CNI_A Back     alignment and domain information
>PF00488 MutS_V: MutS domain V C-terminus Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PF09818 ABC_ATPase: Predicted ATPase of the ABC class; InterPro: IPR019195 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PF13558 SbcCD_C: Putative exonuclease SbcCD, C subunit; PDB: 3QG5_B 3QF7_A 3THO_A 3EUK_H 3EUJ_A 3AV0_B 3AUY_B 3AUX_A Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>PRK13891 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>PF13175 AAA_15: AAA ATPase domain Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query531
2yz2_A266 Crystal Structure Of The Abc Transporter In The Cob 6e-07
4hlu_A268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 6e-07
1oxx_K353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 1e-05
1oxs_C353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 2e-05
3gfo_A275 Structure Of Cbio1 From Clostridium Perfringens: Pa 9e-05
>pdb|2YZ2|A Chain A, Crystal Structure Of The Abc Transporter In The Cobalt Transport System Length = 266 Back     alignment and structure

Iteration: 1

Score = 52.4 bits (124), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 47/165 (28%), Positives = 76/165 (46%), Gaps = 36/165 (21%) Query: 56 GAGKTTLMDVLAG--------------RKPGGYITRNITVS-GYPEKQETFARI---LGY 97 G+GK+TL+ ++AG RK G I RNI ++ YPE Q R+ + + Sbjct: 43 GSGKSTLLQIVAGLIEPTSGDVLYDGERKKGYEIRRNIGIAFQYPEDQFFAERVFDEVAF 102 Query: 98 CEQNDIHSPHDTLYDFTHCLYMFIEEGMELVELN--------PFRQALFEQRKRLTVAVE 149 +N + D + +++ ME V L+ PF + E+R R+ +A Sbjct: 103 AVKN-FYPDRDPVP--------LVKKAMEFVGLDFDSFKDRVPFFLSGGEKR-RVAIASV 152 Query: 150 FVANPSIISRDEPISGLDARAATTVIRMVRNTVDMGRTVVCTIHQ 194 V P I+ DEP+ GLD T ++R+V +G+TV+ H Sbjct: 153 IVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHD 197
>pdb|4HLU|A Chain A, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|1OXX|K Chain K, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|1OXS|C Chain C, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|3GFO|A Chain A, Structure Of Cbio1 From Clostridium Perfringens: Part Of The Abc Transporter Complex Cbionq Length = 275 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query531
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 3e-13
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 3e-12
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 8e-10
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 9e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 4e-09
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 7e-04
1sgw_A214 Putative ABC transporter; structural genomics, P p 8e-09
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 3e-08
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 1e-07
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 4e-07
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 5e-07
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 4e-05
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 1e-04
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 2e-04
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
 Score = 68.7 bits (169), Expect = 3e-13
 Identities = 37/166 (22%), Positives = 62/166 (37%), Gaps = 36/166 (21%)

Query: 54  PGGAGKTTLMDVLAG-RKP-GGYITRNITVSGYPEKQETFA--RILGYCEQNDIHSPHDT 109
           P GAGKTT + +++   KP  G     +TV G    +E     +++ Y  +         
Sbjct: 49  PNGAGKTTTLRIISTLIKPSSG----IVTVFGKNVVEEPHEVRKLISYLPEEA------G 98

Query: 110 LYD---------FTHCLYMF--------IEEGMELVELNPFRQALFEQ-----RKRLTVA 147
            Y          F    Y          +E   E+  L    +           ++L +A
Sbjct: 99  AYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEIAGLGEKIKDRVSTYSKGMVRKLLIA 158

Query: 148 VEFVANPSIISRDEPISGLDARAATTVIRMVRNTVDMGRTVVCTIH 193
              + NP +   DEP SGLD   A  V ++++     G T++ + H
Sbjct: 159 RALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSH 204


>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query531
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 100.0
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 100.0
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 100.0
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 100.0
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 100.0
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 100.0
1b0u_A262 Histidine permease; ABC transporter, transport pro 100.0
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 100.0
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 100.0
1g6h_A257 High-affinity branched-chain amino acid transport 100.0
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 100.0
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 100.0
1ji0_A240 ABC transporter; ATP binding protein, structural g 100.0
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 100.0
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 100.0
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 100.0
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 100.0
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 100.0
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 100.0
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 100.0
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 100.0
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 100.0
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 100.0
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 100.0
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 100.0
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 100.0
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 100.0
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 100.0
1sgw_A214 Putative ABC transporter; structural genomics, P p 100.0
2ghi_A260 Transport protein; multidrug resistance protein, M 100.0
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 100.0
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 100.0
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 100.0
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 100.0
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 100.0
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 100.0
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 100.0
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 100.0
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 100.0
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 99.98
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 99.98
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 99.97
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 99.96
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 99.96
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.96
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 99.96
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.96
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.95
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 99.95
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 99.94
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.94
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 99.93
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 99.93
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 99.93
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 99.92
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 99.92
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.91
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.9
4aby_A415 DNA repair protein RECN; hydrolase, double strand 99.88
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.87
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.87
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.86
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 99.86
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 99.83
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 99.83
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 99.82
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 99.79
1e69_A322 Chromosome segregation SMC protein; structural mai 99.78
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 99.75
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 99.73
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 99.73
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 99.68
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 99.67
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 99.64
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 99.63
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 99.63
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 99.62
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 99.61
2og2_A359 Putative signal recognition particle receptor; nuc 99.6
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.57
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.57
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 99.55
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 99.54
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 99.54
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 99.54
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.53
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 99.51
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 99.5
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 99.49
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.49
4a74_A231 DNA repair and recombination protein RADA; hydrola 99.47
2eyu_A261 Twitching motility protein PILT; pilus retraction 99.46
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 99.46
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.45
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 99.42
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 99.42
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 99.4
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 99.4
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 99.39
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 99.38
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 99.37
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 99.35
3kta_B173 Chromosome segregation protein SMC; structural mai 99.32
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 99.32
2cvh_A220 DNA repair and recombination protein RADB; filamen 99.3
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 99.3
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 99.3
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 99.29
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 99.29
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 99.28
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 99.27
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 99.18
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 99.17
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 99.16
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 99.15
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.14
2ewv_A372 Twitching motility protein PILT; pilus retraction 99.11
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 99.08
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 99.06
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 99.02
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.96
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 98.93
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.92
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 98.91
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 98.88
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.87
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 98.87
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 98.85
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 98.84
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 98.83
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 98.74
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 98.7
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 98.7
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 98.57
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 98.45
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 98.43
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 98.42
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 98.39
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 98.34
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 98.29
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 98.27
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.26
2oap_1511 GSPE-2, type II secretion system protein; hexameri 98.25
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 98.24
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 98.22
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 98.19
1vma_A306 Cell division protein FTSY; TM0570, structural gen 98.18
2r6a_A454 DNAB helicase, replicative helicase; replication, 98.17
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 98.17
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 98.12
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.12
1p9r_A418 General secretion pathway protein E; bacterial typ 98.09
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 97.98
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 97.9
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.88
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 97.87
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 97.84
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.8
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 97.72
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.67
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 97.66
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 97.53
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 97.53
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 97.51
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 97.45
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 97.43
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 97.42
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 97.39
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 97.31
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 97.29
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 97.05
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 97.04
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 96.93
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 96.86
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 96.86
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 96.76
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 96.65
2z43_A324 DNA repair and recombination protein RADA; archaea 96.62
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 96.51
1u94_A356 RECA protein, recombinase A; homologous recombinat 96.41
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 96.4
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 96.34
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 96.3
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 96.24
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 96.22
3kta_A182 Chromosome segregation protein SMC; structural mai 96.18
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 96.08
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 96.05
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.05
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 96.04
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.03
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.0
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 95.89
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 95.87
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 95.77
3lxx_A239 GTPase IMAP family member 4; structural genomics c 95.61
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 95.58
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 95.55
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 95.53
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 95.45
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 95.44
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 95.36
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 95.34
3bos_A242 Putative DNA replication factor; P-loop containing 95.33
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 95.29
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 95.27
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 95.26
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 95.01
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 95.0
1kag_A173 SKI, shikimate kinase I; transferase, structural g 94.96
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 94.85
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 94.83
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 94.72
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 94.68
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 94.65
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 94.65
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 94.53
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 94.33
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 94.14
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 94.06
3io5_A333 Recombination and repair protein; storage dimer, i 94.04
3vaa_A199 Shikimate kinase, SK; structural genomics, center 93.99
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 93.73
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 93.7
2v1u_A387 Cell division control protein 6 homolog; DNA repli 93.66
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 93.53
2wji_A165 Ferrous iron transport protein B homolog; membrane 93.5
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 93.46
3lxw_A247 GTPase IMAP family member 1; immunity, structural 93.41
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 93.36
1xp8_A366 RECA protein, recombinase A; recombination, radior 93.05
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 93.0
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 92.95
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 92.93
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 92.89
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 92.81
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 92.74
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 92.74
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 92.67
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 92.6
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 92.59
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 92.5
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 92.41
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 92.29
3co5_A143 Putative two-component system transcriptional RES 92.28
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 92.25
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 92.05
2www_A349 Methylmalonic aciduria type A protein, mitochondri 91.99
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 91.94
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 91.72
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 91.59
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 91.32
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 90.96
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 90.91
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 90.83
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 90.63
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 90.57
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 90.5
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 90.26
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 90.03
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 89.87
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 89.86
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 89.81
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 89.65
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 89.6
2ged_A193 SR-beta, signal recognition particle receptor beta 89.58
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 89.45
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 89.38
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 89.32
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 89.29
1via_A175 Shikimate kinase; structural genomics, transferase 89.25
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 89.2
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 89.2
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 89.07
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 89.0
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 88.93
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 88.89
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 88.79
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 88.78
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 88.77
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 88.75
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 88.67
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 88.64
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 88.57
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 88.49
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 88.42
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 88.4
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 88.37
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 88.33
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 88.3
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 88.28
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 88.27
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 88.22
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 88.2
1xjc_A169 MOBB protein homolog; structural genomics, midwest 88.16
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 88.08
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 88.04
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 87.89
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 87.88
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 87.87
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 87.83
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 87.75
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 87.74
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 87.67
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 87.67
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 87.58
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 87.57
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 87.33
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 87.21
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 87.21
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 87.12
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 87.11
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 87.1
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 87.01
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 86.96
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 86.92
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 86.84
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 86.83
3ice_A422 Transcription termination factor RHO; transcriptio 86.82
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 86.79
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 86.73
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 86.7
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 86.68
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 86.65
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 86.53
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 86.4
3r20_A233 Cytidylate kinase; structural genomics, seattle st 86.38
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 86.38
3t1o_A198 Gliding protein MGLA; G domain containing protein, 86.32
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 86.25
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 86.24
3iby_A256 Ferrous iron transport protein B; G protein, G dom 86.16
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 86.15
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 86.14
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 86.14
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 86.11
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 86.06
1nrj_B218 SR-beta, signal recognition particle receptor beta 86.02
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 86.02
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 85.98
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 85.98
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 85.8
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 85.78
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 85.76
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 85.72
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 85.65
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 85.61
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 85.58
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 85.54
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 85.5
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 85.46
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 85.46
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 85.31
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 85.3
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 85.26
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 85.2
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 85.18
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 85.07
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 85.04
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 84.96
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 84.95
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 84.95
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 84.92
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 84.88
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 84.84
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 84.82
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 84.69
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 84.68
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 84.67
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 84.65
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 84.62
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 84.58
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 84.55
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 84.5
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 84.45
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 84.4
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 84.36
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 84.32
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 84.32
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 84.32
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 84.27
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 84.23
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 84.23
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 84.18
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 84.11
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 84.1
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 84.05
3llu_A196 RAS-related GTP-binding protein C; structural geno 84.02
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 84.01
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 83.96
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 83.95
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 83.95
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 83.91
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 83.9
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 83.86
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 83.79
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 83.78
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 83.76
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 83.75
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 83.63
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 83.41
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 83.41
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 83.33
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 83.29
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 83.26
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 83.25
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 83.25
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 83.05
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 83.03
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 83.01
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 82.95
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 82.9
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 82.89
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 82.86
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 82.8
2fh5_B214 SR-beta, signal recognition particle receptor beta 82.78
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 82.72
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 82.71
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 82.68
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 82.54
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 82.5
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 82.25
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 82.22
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 82.2
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 82.16
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 82.11
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 82.01
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 81.86
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 81.72
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 81.67
2vli_A183 Antibiotic resistance protein; transferase, tunica 81.64
1jal_A363 YCHF protein; nucleotide-binding fold, structural 81.59
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 81.59
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 81.35
2hf9_A226 Probable hydrogenase nickel incorporation protein 81.24
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 80.98
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 80.98
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 80.95
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 80.67
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 80.65
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 80.21
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
Probab=100.00  E-value=1.6e-38  Score=327.87  Aligned_cols=194  Identities=21%  Similarity=0.266  Sum_probs=167.2

Q ss_pred             ceEEEEEeEEEEEeCCC--ccccccEEEEEcCC---------CchHHHHHHHHhCCCCCceEEEEEEEcCcccch-----
Q 042733           25 PHYISLNEIVYSVDMPQ--IGDLNSLSGAFRPG---------GAGKTTLMDVLAGRKPGGYITRNITVSGYPEKQ-----   88 (531)
Q Consensus        25 ~~~l~~~~ls~~~~~~~--~~iL~~vs~~i~~g---------GaGKTTLLk~L~G~~~~g~~~G~i~~~g~~~~~-----   88 (531)
                      ...|+++||+++|+.+.  ..+|+|||+.+.+|         |||||||+|+|+|..++  .+|+|.++|.+...     
T Consensus        22 ~~mi~v~~ls~~y~~~~~~~~aL~~vsl~i~~Gei~~IiGpnGaGKSTLlr~i~GL~~p--~~G~I~i~G~~i~~~~~~~   99 (366)
T 3tui_C           22 KHMIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERP--TEGSVLVDGQELTTLSESE   99 (366)
T ss_dssp             -CCEEEEEEEEEEECSSSEEEEEEEEEEEECTTCEEEEECCTTSSHHHHHHHHHTSSCC--SEEEEEETTEECSSCCHHH
T ss_pred             CceEEEEeEEEEeCCCCCCeEEEEeeEEEEcCCCEEEEEcCCCchHHHHHHHHhcCCCC--CceEEEECCEECCcCCHHH
Confidence            34689999999997432  36899999888777         99999999999998664  47999999987532     


Q ss_pred             -hhhcceEEEEecCCCCCCCCcHHhHH-----------HHHHHHHHHHHHhcCCchhhhccH-----HHHHHHHHHHHHh
Q 042733           89 -ETFARILGYCEQNDIHSPHDTLYDFT-----------HCLYMFIEEGMELVELNPFRQALF-----EQRKRLTVAVEFV  151 (531)
Q Consensus        89 -~~~~~~igyv~Q~~~~~~~ltv~e~~-----------~~~~~~~~~~l~~l~l~~~~~~~~-----GerqRv~iA~aL~  151 (531)
                       ...++.+||++|++.+++.+||+|+.           .+..++++++++.+||.+..++.+     ||||||+|||||+
T Consensus       100 ~~~~r~~Ig~v~Q~~~l~~~~TV~env~~~~~~~~~~~~~~~~~v~~lL~~vgL~~~~~~~~~~LSGGqkQRVaIArAL~  179 (366)
T 3tui_C          100 LTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALA  179 (366)
T ss_dssp             HHHHHTTEEEECSSCCCCTTSCHHHHHHHHHHHSCCCHHHHHHHHHHHHHHHTCGGGTTCCTTTSCHHHHHHHHHHHHTT
T ss_pred             HHHHhCcEEEEeCCCccCCCCCHHHHHHHHHHhcCCCHHHHHHHHHHHHHHcCCchHhcCChhhCCHHHHHHHHHHHHHh
Confidence             12467899999999999999999982           234567889999999998877766     9999999999999


Q ss_pred             hCCCeEEEeCCCCCCCHHHHHHHHHHHHHHHHc-CCeEEEEecCCchHHHhccCeEEEEccCceeeecCCCC
Q 042733          152 ANPSIISRDEPISGLDARAATTVIRMVRNTVDM-GRTVVCTIHQPSIDIFYSFDELFLLKQVGQEISVGPLG  222 (531)
Q Consensus       152 ~~p~lllLDEPtsgLD~~~~~~i~~~L~~l~~~-g~tvi~~~H~~~~~i~~~~d~v~lL~~~G~~v~~G~~~  222 (531)
                      .+|++|||||||+|||+.++..++++|++++++ |.|||++||+++ .+...|||+++|++ |+++..|+++
T Consensus       180 ~~P~lLLlDEPTs~LD~~~~~~i~~lL~~l~~~~g~Tii~vTHdl~-~~~~~aDrv~vl~~-G~iv~~g~~~  249 (366)
T 3tui_C          180 SNPKVLLCDQATSALDPATTRSILELLKDINRRLGLTILLITHEMD-VVKRICDCVAVISN-GELIEQDTVS  249 (366)
T ss_dssp             TCCSEEEEESTTTTSCHHHHHHHHHHHHHHHHHSCCEEEEEESCHH-HHHHHCSEEEEEET-TEEEECCBHH
T ss_pred             cCCCEEEEECCCccCCHHHHHHHHHHHHHHHHhCCCEEEEEecCHH-HHHHhCCEEEEEEC-CEEEEEcCHH
Confidence            999999999999999999999999999999865 999999999987 57788999999996 9999999864



>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 531
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 4e-12
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 1e-11
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 5e-11
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 5e-11
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 1e-10
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 3e-10
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 4e-10
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 1e-09
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 1e-09
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 2e-09
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 7e-09
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 8e-09
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 2e-08
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 6e-08
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 1e-07
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 1e-07
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 2e-07
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 3e-07
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 7e-06
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 5e-05
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 1e-04
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 4e-04
g1ii8.1369 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 4e-04
d1jwyb_306 c.37.1.8 (B:) Dynamin G domain {Dictyostelium disc 0.003
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Branched chain aminoacid ABC transporter
species: Thermotoga maritima, TM1139 [TaxId: 2336]
 Score = 63.8 bits (155), Expect = 4e-12
 Identities = 39/235 (16%), Positives = 81/235 (34%), Gaps = 32/235 (13%)

Query: 4   MTEAAIEANNHNKRGMVLLFEPHYISLNEIVYSVDMPQIGDLNSLSGAFRPGGAGKTTLM 63
           +++  +E  + +       +   +  +  I   + +P+ G + +L G     GAGKTT +
Sbjct: 2   VSDIVLEVQSLHVY-----YGAIHA-IKGI--DLKVPR-GQIVTLIG---ANGAGKTTTL 49

Query: 64  DVLAG--RKPGGYITRNITVSGYPEKQETFARILGYCEQNDIHSPHDTLYDFTHCLYMF- 120
             +AG  R   G I  N                +    +     P  T+Y+         
Sbjct: 50  SAIAGLVRAQKGKIIFNGQDITNKPAHVINRMGIALVPEGRRIFPELTVYENLMMGAYNR 109

Query: 121 ---------IEEGMEL-VELNPFRQALFE-----QRKRLTVAVEFVANPSIISRDEPISG 165
                    +E    L   L    + L       +++ L +    ++ P ++  DEP  G
Sbjct: 110 KDKEGIKRDLEWIFSLFPRLKERLKQLGGTLSGGEQQMLAIGRALMSRPKLLMMDEPSLG 169

Query: 166 LDARAATTVIRMVRNTVDMGRTVVCTIHQPSIDIFYSFDELFLLKQVGQEISVGP 220
           L     + V  +++     G T++         +  +    ++L+  GQ +  G 
Sbjct: 170 LAPILVSEVFEVIQKINQEGTTILLVEQNALGALKVA-HYGYVLET-GQIVLEGK 222


>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Length = 306 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query531
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 100.0
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.98
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 99.98
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.71
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.33
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.95
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 98.75
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 98.37
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 98.19
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 97.69
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 97.42
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.19
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.12
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 94.92
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.79
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 94.72
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 94.21
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 94.19
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 93.86
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 93.7
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 93.63
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 93.62
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 93.33
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 93.15
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 93.08
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 92.83
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 92.68
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 92.62
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 92.47
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 92.37
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 92.24
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 91.95
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 91.95
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 91.91
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 91.87
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 91.8
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 91.76
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 91.53
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 91.46
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 91.41
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 91.35
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 91.34
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 91.17
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 90.99
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 90.95
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 90.88
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 90.84
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 90.65
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 90.63
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 90.51
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 90.32
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 90.13
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 89.98
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 89.91
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 89.89
d1nrjb_209 Signal recognition particle receptor beta-subunit 89.85
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 89.77
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 89.54
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 89.25
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 89.07
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 89.02
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 88.93
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 88.9
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 88.83
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 88.77
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 88.61
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 88.47
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 88.39
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 88.1
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 87.93
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 87.87
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 87.36
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 86.96
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 86.85
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 86.83
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 86.79
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 86.69
d2fh5b1207 Signal recognition particle receptor beta-subunit 86.63
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 86.44
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 86.41
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 86.36
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 86.27
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 86.19
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.13
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 86.11
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 86.07
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 85.92
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 85.9
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 85.85
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 85.73
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 85.66
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 85.58
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 85.57
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 85.47
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 85.46
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 85.25
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 85.14
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 85.0
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 84.51
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 83.98
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 83.83
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 83.68
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 83.67
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 83.46
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 83.22
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 83.02
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 82.83
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 82.69
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 82.34
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 81.87
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 81.8
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 81.76
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 81.75
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 81.49
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 81.35
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 81.33
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 81.31
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 81.16
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 81.08
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 80.97
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 80.92
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 80.86
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 80.5
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 80.48
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 80.44
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 80.38
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 80.32
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 80.26
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 80.2
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 80.18
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 80.06
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Hypothetical protein PH0022, N-terminal domain
species: Pyrococcus horikoshii [TaxId: 53953]
Probab=100.00  E-value=2.4e-43  Score=340.71  Aligned_cols=190  Identities=21%  Similarity=0.296  Sum_probs=159.6

Q ss_pred             EEEEEeEEEEEeCCCccccccEEEEEcCC---------CchHHHHHHHHhCCCCCceEEEEEEEcCcccch-hhhcceEE
Q 042733           27 YISLNEIVYSVDMPQIGDLNSLSGAFRPG---------GAGKTTLMDVLAGRKPGGYITRNITVSGYPEKQ-ETFARILG   96 (531)
Q Consensus        27 ~l~~~~ls~~~~~~~~~iL~~vs~~i~~g---------GaGKTTLLk~L~G~~~~g~~~G~i~~~g~~~~~-~~~~~~ig   96 (531)
                      .|+++||+++|+  +..+|+|||+.+.+|         |||||||+|+|+|..++  .+|+|.++|.+... ...++.+|
T Consensus         6 ~I~v~nlsk~yg--~~~al~~vsl~v~~Ge~~~liGpsGaGKSTLl~~i~Gl~~p--~sG~I~i~g~~i~~~~~~~r~ig   81 (239)
T d1v43a3           6 EVKLENLTKRFG--NFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEP--TEGRIYFGDRDVTYLPPKDRNIS   81 (239)
T ss_dssp             CEEEEEEEEEET--TEEEEEEEEEEECTTCEEEEECCTTSSHHHHHHHHHTSSCC--SEEEEEETTEECTTSCGGGGTEE
T ss_pred             eEEEEEEEEEEC--CEEEEcceeEEECCCCEEEEECCCCChHHHHHHHHHcCCCC--CCCEEEEcceecccCCcccceEE
Confidence            367777777774  456777777666665         99999999999998664  47999999987643 23456799


Q ss_pred             EEecCCCCCCCCcHHhH-----------HHHHHHHHHHHHHhcCCchhhhccH-----HHHHHHHHHHHHhhCCCeEEEe
Q 042733           97 YCEQNDIHSPHDTLYDF-----------THCLYMFIEEGMELVELNPFRQALF-----EQRKRLTVAVEFVANPSIISRD  160 (531)
Q Consensus        97 yv~Q~~~~~~~ltv~e~-----------~~~~~~~~~~~l~~l~l~~~~~~~~-----GerqRv~iA~aL~~~p~lllLD  160 (531)
                      ||+|++.++|++||+|+           +.+.+++++++++.+++++.+++.+     ||||||+|||||+.+|++|+||
T Consensus        82 ~v~Q~~~l~~~ltv~enl~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LSGGq~QRvaiAraL~~~P~iLllD  161 (239)
T d1v43a3          82 MVFQSYAVWPHMTVYENIAFPLKIKKFPKDEIDKRVRWAAELLQIEELLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMD  161 (239)
T ss_dssp             EEEC------CCCHHHHHHTTCC--CCCHHHHHHHHHHHHHHTTCGGGTTSCTTTCCSSCHHHHHHHHHHTTCCSEEEEE
T ss_pred             EEeechhhcccchHHHHHHHHHHHcCCCHHHHHHHHHHHHHHcCChhhhcCChhhCCHHHHHHHHHHhhhccCCCceeec
Confidence            99999999999999998           4556778999999999999988877     9999999999999999999999


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHc-CCeEEEEecCCchHHHhccCeEEEEccCceeeecCCCC
Q 042733          161 EPISGLDARAATTVIRMVRNTVDM-GRTVVCTIHQPSIDIFYSFDELFLLKQVGQEISVGPLG  222 (531)
Q Consensus       161 EPtsgLD~~~~~~i~~~L~~l~~~-g~tvi~~~H~~~~~i~~~~d~v~lL~~~G~~v~~G~~~  222 (531)
                      |||+||||.++.++++.|++++++ |+|||++|||++ ++.++|||+++|++ |+++..|+++
T Consensus       162 EPts~LD~~~~~~i~~ll~~l~~~~g~tii~vTHd~~-~a~~~~dri~vm~~-G~iv~~G~~~  222 (239)
T d1v43a3         162 EPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQV-EAMTMGDRIAVMNR-GQLLQIGSPT  222 (239)
T ss_dssp             STTTTSCHHHHHHHHHHHHHHHHHHTCEEEEEESCHH-HHHHHCSEEEEEET-TEEEEEECHH
T ss_pred             CCcccCCHHHHHHHHHHHHHHHHhcCCeEEEEeCCHH-HHHHhCCEEEEEEC-CEEEEEcCHH
Confidence            999999999999999999999765 999999999987 67889999999996 9999999863



>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure