Citrus Sinensis ID: 042739

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-----

MASSSSASSLDAQNKYEVFLSFRGEDTRNGFTSHLAAALHRKQIQFFIDDEELKKGDEISPALSNAIETTDISIIIFSKGYASSKWCLNELVKTLDCKRTNGQIVIPVFYQIDPSDVRKQSESLEEAFLEHEKNFPDKVQKWRAALTEASNLSGYDPTESRNEAELVEEIVADISKKLEDMSDSTDLDGFIGINSRIEEIKSLLCLESHDARIVGIWGMGGIGKTTIASVVFHQISRYFQGNCFMANVREESNKLGVIRVRDEVISQVLGENLKVGTLTIPQNIKKGLQRMKVLIVLDDVHDEFTQLESLAGVIDRFSPGSRIIITTRDKRVLDKCEVSNIFEVKGLEHNKAFELFCRKAFGQNNRSHDLYQLSQRVVCYADGNPLALEVLGSSLYQNSIQQWEDKLHNLNLISEPNIYKVLKISYDELNSEEKGIFLDIACFFKGEDVDLLTRIQDNPTSMCHRLKILVGKSLIAISDRKRLQMHDLLQEMGQTIVRQESLKEP

cccccccccccccccccEEEcccccccccccHHHHHHHHHHcccEEEEccccccccccccHHHHHHHHHccEEEEEEcccccccHHHHHHHHHHHHcccccccEEEEEEccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHccccccEEEEEEEcccccHHHHHHHHHHHHHccccccEEEccccHHHHHcccHHHHHHHHHHHHHcccccccccccHHHHHHHHcccEEEEEEEcccccHHHHHHHHccccccccccEEEEEcccccHHHHcccccEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccHHHHHHccccccccHHHHHHHHHHHHcccccHHHHHHHHcccccccccHHHHHHHHccccccccccHHccccccccccccHHHHHccccEEEEccccEEccHHHHHHHHHHHHccccccc

cccccccccccccccEEEEEccccHcHHHHHHHHHHHHHHHccccEEEccccccccccccHHHHHHHHHccEEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEEEccHHHHHHccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccccEEEEEEEccccccHHHHHHHHHHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHcccEEEEEEcccccHHHHHHHHHccccccccccEEEEEEccHHHHHHccccEEEEEccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHEEEEcccccHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHEccEEEEEccccEEEHHHHHHHHHHHHHHccccccc

massssassldaqNKYEVFLSfrgedtrnGFTSHLAAALHRKQIQFfiddeelkkgdeispalsnaiettdISIIIFSKGYASSKWCLNELVKTldckrtngqivipvfyqidpsdvrkQSESLEEAFLEHEKNFPDKVQKWRAALTEasnlsgydptesrnEAELVEEIVADISKKLedmsdstdldgfigINSRIEEIKSLLcleshdarivgiwgmggigkTTIASVVFHQISRYFQGNCFMANVREESNKLGVIRVRDEVISQVLGenlkvgtltipQNIKKGLQRMKVLIVLDDVHDEFTQLESLAgvidrfspgsriiittrdkrvldkcevsNIFEVKGLEHNKAFELFCRKafgqnnrshdlyqLSQRVVCYADGNPLALEVLGSSLYQNSIQQWEDKLHnlnlisepniYKVLKISYDelnseekgiFLDIAcffkgedvdlltriqdnptsmCHRLKILVGKSLIAISDRKRLQMHDLLQEMGQTIVRQESLKEP

massssassldaqNKYEVFLSFRGEDTRNGFTSHLAAALHRKQIQFFIDDEELKKGDEISPalsnaiettdISIIIFSKGYASSKWCLNELVKTLDCKRTNGQIVIPVFYQIDPSDVRKQSESLEEAFLEHEKNFPDKVQKWRAALTeasnlsgydptesrneAELVEEIVADISkkledmsdstdlDGFIGINSRIEEIKSLLCLESHDARIVGIWGMGGIGKTTIASVVFHQISRYFQGNCFMANVREESNKLGVIRVRDEVISQvlgenlkvgtltipqnikkGLQRMKVLIVLDDVHDEFTQLEslagvidrfspgsriiittrdkrvldkcEVSNIfevkglehnkAFELFCRKAFGQNNRSHDLYQLSQRVVCYADGNPLALEVLGSSLYQNSIQQWEDKLHNLNLISEPNIYKVLKISYDELNSEEKGIFLDIACFFKGEDVDLLTRIQDNPTSMCHRLKILVGKSLIAISDRKRLQMHDLLQEMgqtivrqeslkep

MassssassLDAQNKYEVFLSFRGEDTRNGFTSHLAAALHRKQIQFFIDDEELKKGDEISPALSNAIETTDISIIIFSKGYASSKWCLNELVKTLDCKRTNGQIVIPVFYQIDPSDVRKQSESLEEAFLEHEKNFPDKVQKWRAALTEASNLSGYDPTESRNEAELVEEIVADISKKLEDMSDSTDLDGFIGINSRIEEIKSLLCLESHDARIVGIWGMGGIGKTTIASVVFHQISRYFQGNCFMANVREESNKLGVIRVRDEVISQVLGENLKVGTLTIPQNIKKGLQRMKVLIVLDDVHDEFTQLESLAGVIDRFSPGSRIIITTRDKRVLDKCEVSNIFEVKGLEHNKAFELFCRKAFGQNNRSHDLYQLSQRVVCYADGNPLALEVLGSSLYQNSIQQWEDKLHNLNLISEPNIYKVLKISYDELNSEEKGIFLDIACFFKGEDVDLLTRIQDNPTSMCHRLKILVGKSLIAISDRKRLQMHDLLQEMGQTIVRQESLKEP

***************YEVFLSFRGEDTRNGFTSHLAAALHRKQIQFFIDDEELKKGDEISPALSNAIETTDISIIIFSKGYASSKWCLNELVKTLDCKRTNGQIVIPVFYQID************************************************************************DLDGFIGINSRIEEIKSLLCLESHDARIVGIWGMGGIGKTTIASVVFHQISRYFQGNCFMANVREESNKLGVIRVRDEVISQVLGENLKVGTLTIPQNIKKGLQRMKVLIVLDDVHDEFTQLESLAGVIDRFSPGSRIIITTRDKRVLDKCEVSNIFEVKGLEHNKAFELFCRKAFGQNNRSHDLYQLSQRVVCYADGNPLALEVLGSSLYQNSIQQWEDKLHNLNLISEPNIYKVLKISYDELNSEEKGIFLDIACFFKGEDVDLLTRIQDNPTSMCHRLKILVGKSLIAISDRKRLQMHDLL****************

***************YEVFLSFRGEDTRNGFTSHLAAALHRKQIQFFIDDEELKKGDEISPALSNAIETTDISIIIFSKGYASSKWCLNELVKTLDCKRTNGQIVIPVFYQIDPSDVRKQSESLEEAFLEHEKNFPDKVQKWRAALTEASNLSGYDPTESRNEAELVEEIVADISKKLEDMSDSTDLDGFIGINSRIEEIKSLLCLESHDARIVGIWGMGGIGKTTIASVVFHQISRYFQGNCFMANVREESNKLGVIRVRDEVISQVLGENLKVGTLTIPQNIKKGLQRMKVLIVLDDVHDEFTQLESLAGVIDRFSPGSRIIITTRDKRVLDKCEVSNIFEVKGLEHNKAFELFCRKAFGQNNRSHDLYQLSQRVVCYADGNPLALEVLGSSLYQNSIQQWEDKLHNLNLISEPNIYKVLKISYDELNSEEKGIFLDIACFFKGEDVDLLTRIQDNPTSMCHRLKILVGKSLIAISDRKRLQMHDLLQEMGQTIV*QE*****

***********AQNKYEVFLSFRGEDTRNGFTSHLAAALHRKQIQFFIDDEELKKGDEISPALSNAIETTDISIIIFSKGYASSKWCLNELVKTLDCKRTNGQIVIPVFYQIDPSDVRKQSESLEEAFLEHEKNFPDKVQKWRAALTEASNLSGYDPTESRNEAELVEEIVADISKKLEDMSDSTDLDGFIGINSRIEEIKSLLCLESHDARIVGIWGMGGIGKTTIASVVFHQISRYFQGNCFMANVREESNKLGVIRVRDEVISQVLGENLKVGTLTIPQNIKKGLQRMKVLIVLDDVHDEFTQLESLAGVIDRFSPGSRIIITTRDKRVLDKCEVSNIFEVKGLEHNKAFELFCRKAFGQNNRSHDLYQLSQRVVCYADGNPLALEVLGSSLYQNSIQQWEDKLHNLNLISEPNIYKVLKISYDELNSEEKGIFLDIACFFKGEDVDLLTRIQDNPTSMCHRLKILVGKSLIAISDRKRLQMHDLLQEMGQTIVRQESLKEP

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		505	2.2.26 [Sep-21-2011]
Q40392		1144	TMV resistance protein N	N/A	no	0.936	0.413	0.432	1e-103
O82500		1095	Putative disease resistan	no	no	0.978	0.451	0.394	6e-92
O23530		1301	Protein SUPPRESSOR OF npr	no	no	0.960	0.372	0.373	9e-85
Q9FL92		1372	Probable WRKY transcripti	no	no	0.859	0.316	0.345	3e-63
Q9SZ67		1895	Probable WRKY transcripti	no	no	0.902	0.240	0.335	7e-60
Q9FKN7		1613	Protein DA1-related 4 OS=	no	no	0.879	0.275	0.323	9e-54
Q9FH83		1288	Probable WRKY transcripti	no	no	0.865	0.339	0.327	2e-48
Q9FHE9		354	Protein PHLOEM PROTEIN 2-	no	no	0.344	0.491	0.377	4e-25
Q9C5Q9		411	Protein PHLOEM PROTEIN 2-	no	no	0.265	0.326	0.366	8e-18
Q9FHE8		392	Protein PHLOEM PROTEIN 2-	no	no	0.352	0.454	0.345	1e-16

>sp\|Q40392\|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1	Back alignment and function desciption

 Score =  376 bits (966), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 215/497 (43%), Positives = 315/497 (63%), Gaps = 24/497 (4%)

Query: 16  YEVFLSFRGEDTRNGFTSHLAAALHRKQIQFFIDDEELKKGDEISPALSNAIETTDISII 75
           Y+VFLSFRGEDTR  FTSHL   L+ K I+ F DD+ L+ G  I   L  AIE +  +I+
Sbjct: 12  YDVFLSFRGEDTRKTFTSHLYEVLNDKGIKTFQDDKRLEYGATIPGELCKAIEESQFAIV 71

Query: 76  IFSKGYASSKWCLNELVKTLDCKRTNGQIVIPVFYQIDPSDVRKQSESLEEAFLEHEKNF 135
           +FS+ YA+S+WCLNELVK ++CK    Q VIP+FY +DPS VR Q ES  +AF EHE  +
Sbjct: 72  VFSENYATSRWCLNELVKIMECKTRFKQTVIPIFYDVDPSHVRNQKESFAKAFEEHETKY 131

Query: 136 PDKV---QKWRAALTEASNLSGYDPTESRNEAELVEEIVADISKKLEDMSDSTDLDGFIG 192
            D V   Q+WR AL EA+NL G      + +A+ + +IV  IS KL  +S S  L   +G
Sbjct: 132 KDDVEGIQRWRIALNEAANLKGSCDNRDKTDADCIRQIVDQISSKLCKISLSY-LQNIVG 190

Query: 193 INSRIEEIKSLLCLESHDARIVGIWGMGGIGKTTIASVVFHQI------SRYFQGNCFMA 246
           I++ +E+I+SLL +  +  RI+GIWGMGG+GKTTIA  +F  +      S  F G CF+ 
Sbjct: 191 IDTHLEKIESLLEIGINGVRIMGIWGMGGVGKTTIARAIFDTLLGRMDSSYQFDGACFLK 250

Query: 247 NVREESNKLGVIRVRDEVISQVLGENLKVGTLTIPQN-IKKGLQRMKVLIVLDDVHDEFT 305
           +++E  NK G+  +++ ++S++L E          ++ +   L+  KVLIVLDD+ ++  
Sbjct: 251 DIKE--NKRGMHSLQNALLSELLREKANYNNEEDGKHQMASRLRSKKVLIVLDDIDNKDH 308

Query: 306 QLESLAGVIDRFSPGSRIIITTRDKRVLDKCEVSNIFEVKGLEHNKAFELFCRKAFGQNN 365
            LE LAG +D F  GSRIIITTRDK +++K ++  I+EV  L  +++ +LF + AFG+  
Sbjct: 309 YLEYLAGDLDWFGNGSRIIITTRDKHLIEKNDI--IYEVTALPDHESIQLFKQHAFGKEV 366

Query: 366 RSHDLYQLSQRVVCYADGNPLALEVLGSSLYQNSIQQWEDKLHNLNLISEPNIYKVLKIS 425
            + +  +LS  VV YA G PLAL+V GS L+   + +W+  + ++   S   I   LKIS
Sbjct: 367 PNENFEKLSLEVVNYAKGLPLALKVWGSLLHNLRLTEWKSAIEHMKNNSYSGIIDKLKIS 426

Query: 426 YDELNSEEKGIFLDIACFFKGEDVDLLTRIQDNPTSMCH-----RLKILVGKSLIAISDR 480
           YD L  +++ +FLDIACF +GE+ D + +I ++    CH      L+IL+ KSL+ IS+ 
Sbjct: 427 YDGLEPKQQEMFLDIACFLRGEEKDYILQILES----CHIGAEYGLRILIDKSLVFISEY 482

Query: 481 KRLQMHDLLQEMGQTIV 497
            ++QMHDL+Q+MG+ IV
Sbjct: 483 NQVQMHDLIQDMGKYIV 499

Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)

>sp\|O82500\|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1	Back alignment and function description

>sp\|O23530\|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3	Back alignment and function description

>sp\|Q9FL92\|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1	Back alignment and function description

>sp\|Q9SZ67\|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1	Back alignment and function description

>sp\|Q9FKN7\|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2	Back alignment and function description

>sp\|Q9FH83\|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3	Back alignment and function description

>sp\|Q9FHE9\|P2A08_ARATH Protein PHLOEM PROTEIN 2-LIKE A8 OS=Arabidopsis thaliana GN=PP2A8 PE=2 SV=1	Back alignment and function description

>sp\|Q9C5Q9\|P2A05_ARATH Protein PHLOEM PROTEIN 2-LIKE A5 OS=Arabidopsis thaliana GN=PP2A5 PE=2 SV=1	Back alignment and function description

>sp\|Q9FHE8\|P2A06_ARATH Protein PHLOEM PROTEIN 2-LIKE A6 OS=Arabidopsis thaliana GN=PP2A6 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		505
255564976		944	TMV resistance protein N, putative [Rici	0.984	0.526	0.536	1e-139
224127917		1470	tir-nbs-lrr resistance protein [Populus	0.974	0.334	0.502	1e-129
255573549		908	ATP binding protein, putative [Ricinus c	0.986	0.548	0.486	1e-127
255561496		876	TMV resistance protein N, putative [Rici	0.960	0.553	0.488	1e-126
255569048		1084	leucine-rich repeat-containing protein,	0.978	0.455	0.499	1e-126
147768286		1206	hypothetical protein VITISV_033530 [Viti	0.966	0.404	0.501	1e-123
225460354		1174	PREDICTED: TMV resistance protein N-like	0.966	0.415	0.501	1e-123
359493496		1180	PREDICTED: TMV resistance protein N-like	0.974	0.416	0.492	1e-123
255537139		1137	leucine-rich repeat-containing protein,	0.980	0.435	0.496	1e-122
359496034		1132	PREDICTED: TMV resistance protein N-like	0.966	0.431	0.486	1e-121

>gi\|255564976\|ref\|XP_002523481.1\| TMV resistance protein N, putative [Ricinus communis] gi\|223537309\|gb\|EEF38940.1\| TMV resistance protein N, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  501 bits (1289), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 274/511 (53%), Positives = 366/511 (71%), Gaps = 14/511 (2%)

Query: 1   MASSSSASSLDAQNKYEVFLSFRGEDTRNGFTSHLAAALHRKQIQFFIDDEELKKGDEIS 60
           MASSSS++S D Q KY+VF+SFRGEDTR+ FTSHL AALH+KQI+ F+DD+ L +G+EIS
Sbjct: 1   MASSSSSASFDPQLKYDVFVSFRGEDTRDNFTSHLYAALHQKQIKAFVDDK-LSRGEEIS 59

Query: 61  PALSNAIETTDISIIIFSKGYASSKWCLNELVKTLDCKRTNGQIVIPVFYQIDPSDVRKQ 120
            AL   IE + +S+IIFS+ YA S WCL+ELVK L+CK+T GQIV+PVFY +DPSDV +Q
Sbjct: 60  AALVKVIEESMVSVIIFSENYAFSPWCLDELVKILECKKTVGQIVLPVFYHVDPSDVAEQ 119

Query: 121 SESLEEAFLEHEKNFP---DKVQKWRAALTEASNLSGYDPTESRNEAELVEEIVADISKK 177
                 AF+EHEK F    DK+QKWRAALTEA+N+SG+  +  R+E++L++EI  DI KK
Sbjct: 120 KGGFGAAFIEHEKCFKERIDKLQKWRAALTEAANISGWSSSVIRSESKLIQEIAEDILKK 179

Query: 178 LEDMSDSTDLDGFIGINSRIEEIKSLLCLESHDARIVGIWGMGGIGKTTIASVVFHQISR 237
           L  MS STD  G +GINSRI++I+ LLC+E  D R +G+WGMGG GKTT A VVF++IS 
Sbjct: 180 LNHMSSSTDSKGLVGINSRIDKIELLLCVELADVRFLGLWGMGGAGKTTTAEVVFNRIST 239

Query: 238 YFQGNCFMANVREESNKLGVIRVRDEVISQVLGENLKVGTLTIPQNI--KKGLQRMKVLI 295
            F   CF+ANV EES + G+++++ ++ S++LG++     +   + I  K  L+  KVLI
Sbjct: 240 QFDSCCFLANVNEESERYGLLKLQRQLFSKLLGQD----NVNYAEGIFDKSRLKHRKVLI 295

Query: 296 VLDDVHDEFTQLESLAGVIDRFSPGSRIIITTRDKRVLDKCEVSNIFEVKGLEHNKAFEL 355
           VLDDV++   QLE+LAG  + F PGSRII+T+RDK VL K +   I++++ L+H++A +L
Sbjct: 296 VLDDVNN-LRQLENLAGEHNWFGPGSRIILTSRDKDVL-KNKTDAIYKIEDLDHHEALQL 353

Query: 356 FCRKAFGQNNRSHDLYQLSQRVVCYADGNPLALEVLGSSLYQNSIQQWEDKLHNLNLISE 415
           F   AF Q     D  +LS+RV+ YA GNPL L+VLGS LYQ +I++WE  LH L   + 
Sbjct: 354 FSLNAFRQECPKADYMKLSKRVINYAKGNPLGLKVLGSFLYQRNIKEWESALHKLERSTN 413

Query: 416 PNIYKVLKISYDELNSEEKGIFLDIACFFKGEDVDLLTRIQDNPT-SMCHRLKILVGKSL 474
             I  VLK+SYD L+ EEK IFLD+ACFF GED D +TRI +    S    + +LV KSL
Sbjct: 414 KEIQNVLKVSYDGLDDEEKDIFLDVACFFNGEDRDFVTRILNGCGFSADIAISVLVSKSL 473

Query: 475 IAISDRKRLQMHDLLQEMGQTIVRQESLKEP 505
           + IS+   L +H+LLQ+MG  IVRQES KEP
Sbjct: 474 LTISNNT-LAIHNLLQQMGWGIVRQESTKEP 503

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224127917\|ref\|XP_002329209.1\| tir-nbs-lrr resistance protein [Populus trichocarpa] gi\|222870990\|gb\|EEF08121.1\| tir-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|255573549\|ref\|XP_002527699.1\| ATP binding protein, putative [Ricinus communis] gi\|223532930\|gb\|EEF34698.1\| ATP binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|255561496\|ref\|XP_002521758.1\| TMV resistance protein N, putative [Ricinus communis] gi\|223538971\|gb\|EEF40568.1\| TMV resistance protein N, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|255569048\|ref\|XP_002525493.1\| leucine-rich repeat-containing protein, putative [Ricinus communis] gi\|223535172\|gb\|EEF36851.1\| leucine-rich repeat-containing protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|147768286\|emb\|CAN64759.1\| hypothetical protein VITISV_033530 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225460354\|ref\|XP_002263146.1\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359493496\|ref\|XP_003634615.1\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255537139\|ref\|XP_002509636.1\| leucine-rich repeat-containing protein, putative [Ricinus communis] gi\|223549535\|gb\|EEF51023.1\| leucine-rich repeat-containing protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|359496034\|ref\|XP_002277500.2\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		505
UNIPROTKB\|Q40392		1144	N "TMV resistance protein N" [	0.948	0.418	0.431	1.5e-97
TAIR\|locus:2118106		1219	AT4G12010 [Arabidopsis thalian	0.942	0.390	0.423	4.8e-94
TAIR\|locus:2175991		1294	AT5G17680 [Arabidopsis thalian	0.954	0.372	0.402	4.1e-90
TAIR\|locus:2175075		1068	AT5G41750 [Arabidopsis thalian	0.968	0.457	0.392	9.6e-89
TAIR\|locus:2167457		1191	AT5G36930 [Arabidopsis thalian	0.956	0.405	0.408	1.2e-88
TAIR\|locus:2032602		1163	AT1G72860 [Arabidopsis thalian	0.962	0.417	0.406	3.2e-88
TAIR\|locus:2115870		1234	AT4G08450 [Arabidopsis thalian	0.952	0.389	0.405	1.5e-87
TAIR\|locus:2136108		1095	AT4G11170 [Arabidopsis thalian	0.960	0.442	0.391	2e-86
TAIR\|locus:2153072		1229	AT5G51630 [Arabidopsis thalian	0.954	0.392	0.403	2.1e-86
TAIR\|locus:2160472		1038	AT5G41540 [Arabidopsis thalian	0.954	0.464	0.404	8.9e-86

UNIPROTKB\|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)]	Back alignment and assigned GO terms

 Score = 969 (346.2 bits), Expect = 1.5e-97, P = 1.5e-97
 Identities = 218/505 (43%), Positives = 320/505 (63%)

Query:    16 YEVFLSFRGEDTRNGFTSHLAAALHRKQIQFFIDDEELKKGDEISPALSNAIETTDISII 75
             Y+VFLSFRGEDTR  FTSHL   L+ K I+ F DD+ L+ G  I   L  AIE +  +I+
Sbjct:    12 YDVFLSFRGEDTRKTFTSHLYEVLNDKGIKTFQDDKRLEYGATIPGELCKAIEESQFAIV 71

Query:    76 IFSKGYASSKWCLNELVKTLDCKRTNGQIVIPVFYQIDPSDVRKQSESLEEAFLEHEKNF 135
             +FS+ YA+S+WCLNELVK ++CK    Q VIP+FY +DPS VR Q ES  +AF EHE  +
Sbjct:    72 VFSENYATSRWCLNELVKIMECKTRFKQTVIPIFYDVDPSHVRNQKESFAKAFEEHETKY 131

Query:   136 PDKV---QKWRAALTEASNLSGYDPTESRNEAELVEEIVADISKKLEDMSDSTDLDGFIG 192
              D V   Q+WR AL EA+NL G      + +A+ + +IV  IS KL  +S S  L   +G
Sbjct:   132 KDDVEGIQRWRIALNEAANLKGSCDNRDKTDADCIRQIVDQISSKLCKISLSY-LQNIVG 190

Query:   193 INSRIEEIKSLLCLESHDARIVGIWGMGGIGKTTIASVVFHQI-----SRY-FQGNCFMA 246
             I++ +E+I+SLL +  +  RI+GIWGMGG+GKTTIA  +F  +     S Y F G CF+ 
Sbjct:   191 IDTHLEKIESLLEIGINGVRIMGIWGMGGVGKTTIARAIFDTLLGRMDSSYQFDGACFLK 250

Query:   247 NVREESNKLGVIRVRDEVISQVLGENLKVGTLTIPQN-IKKGLQRMKVLIVLDDVHDEFT 305
             +++E  NK G+  +++ ++S++L E          ++ +   L+  KVLIVLDD+ ++  
Sbjct:   251 DIKE--NKRGMHSLQNALLSELLREKANYNNEEDGKHQMASRLRSKKVLIVLDDIDNKDH 308

Query:   306 QLESLAGVIDRFSPGSRIIITTRDKRVLDKCEVSNIFEVKGLEHNKAFELFCRKAFGQNN 365
              LE LAG +D F  GSRIIITTRDK +++K ++  I+EV  L  +++ +LF + AFG+  
Sbjct:   309 YLEYLAGDLDWFGNGSRIIITTRDKHLIEKNDI--IYEVTALPDHESIQLFKQHAFGKEV 366

Query:   366 RSHDLYQLSQRVVCYADGNPLALEVLGSSLYQNSIQQWEDKLHNLNLISEPNIYKVLKIS 425
              + +  +LS  VV YA G PLAL+V GS L+   + +W+  + ++   S   I   LKIS
Sbjct:   367 PNENFEKLSLEVVNYAKGLPLALKVWGSLLHNLRLTEWKSAIEHMKNNSYSGIIDKLKIS 426

Query:   426 YDELNSEEKGIFLDIACFFKGEDVDLLTRIQDNPTSMCH-----RLKILVGKSLIAISDR 480
             YD L  +++ +FLDIACF +GE+ D + +I ++    CH      L+IL+ KSL+ IS+ 
Sbjct:   427 YDGLEPKQQEMFLDIACFLRGEEKDYILQILES----CHIGAEYGLRILIDKSLVFISEY 482

Query:   481 KRLQMHDLLQEMGQTIVRQESLKEP 505
              ++QMHDL+Q+MG+ IV  +  K+P
Sbjct:   483 NQVQMHDLIQDMGKYIVNFQ--KDP 505

GO:0005515 "protein binding" evidence=IPI

TAIR\|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2175075 AT5G41750 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2167457 AT5G36930 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2032602 AT1G72860 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2115870 AT4G08450 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2136108 AT4G11170 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2153072 AT5G51630 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2160472 AT5G41540 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	eugene3.01250003	tir-nbs-lrr resistance protein (1470 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		505
PLN03210		1153	PLN03210, PLN03210, Resistant to P	1e-111
pfam01582		135	pfam01582, TIR, TIR domain	5e-38
pfam00931		285	pfam00931, NB-ARC, NB-ARC domain	3e-36
smart00255		140	smart00255, TIR, Toll - interleukin 1 - resistance	2e-35
PLN03194		187	PLN03194, PLN03194, putative disease resistance pr	1e-12
pfam13676		102	pfam13676, TIR_2, TIR domain	8e-09

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

 Score =  354 bits (911), Expect = e-111
 Identities = 210/523 (40%), Positives = 301/523 (57%), Gaps = 32/523 (6%)

Query: 1   MASSSSASSLDAQNKYEVFLSFRGEDTRNGFTSHLAAALHRKQIQFFIDDEELKKGDEIS 60
           MASSSS+S       Y+VF SF GED R  F SH    L RK I  F  D E+++   + 
Sbjct: 1   MASSSSSSR---NWVYDVFPSFSGEDVRITFLSHFLKELDRKLIIAF-KDNEIERSQSLD 56

Query: 61  PALSNAIETTDISIIIFSKGYASSKWCLNELVKTLDCKRTNGQIVIPVFYQIDPSDVRKQ 120
           P L  AI  + I++++FSK YASS WCLNEL++ + CK   GQ+VIPVFY +DPS VRKQ
Sbjct: 57  PELKQAIRDSRIAVVVFSKNYASSSWCLNELLEIVRCKEELGQLVIPVFYGLDPSHVRKQ 116

Query: 121 SESLEEAFLEHEKNFPDKVQK-WRAALTEASNLSGYDPTESRNEAELVEEIVADISKKLE 179
           +    EAF +  +N  +  +  W+ ALT+ +N+ GY      NEA+++EEI  D+  KL 
Sbjct: 117 TGDFGEAFEKTCQNKTEDEKIQWKQALTDVANILGYHSQNWPNEAKMIEEIANDVLGKL- 175

Query: 180 DMSDSTDLDGFIGINSRIEEIKSLLCLESHDARIVGIWGMGGIGKTTIASVVFHQISRYF 239
           +++ S D + F+GI   I ++ SLL LES + R+VGIWG  GIGKTTIA  +F ++SR F
Sbjct: 176 NLTPSNDFEDFVGIEDHIAKMSSLLHLESEEVRMVGIWGSSGIGKTTIARALFSRLSRQF 235

Query: 240 QGNCFM--------------ANVREESNKLGVIRVRDEVISQVLG-ENLKVGTLTIPQNI 284
           Q + F+              AN  + + KL    ++   +S++L  +++K+  L     +
Sbjct: 236 QSSVFIDRAFISKSMEIYSSANPDDYNMKL---HLQRAFLSEILDKKDIKIYHLGA---M 289

Query: 285 KKGLQRMKVLIVLDDVHDEFTQLESLAGVIDRFSPGSRIIITTRDKRVLDKCEVSNIFEV 344
           ++ L+  KVLI +DD+ D+   L++LAG    F  GSRII+ T+DK  L    + +I+EV
Sbjct: 290 EERLKHRKVLIFIDDLDDQDV-LDALAGQTQWFGSGSRIIVITKDKHFLRAHGIDHIYEV 348

Query: 345 KGLEHNKAFELFCRKAFGQNNRSHDLYQLSQRVVCYADGNPLALEVLGSSLYQNSIQQWE 404
               +  A E+FCR AF +N+      +L+  V   A   PL L VLGS L     + W 
Sbjct: 349 CLPSNELALEMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGLNVLGSYLRGRDKEDWM 408

Query: 405 DKLHNLNLISEPNIYKVLKISYDELNS-EEKGIFLDIACFFKGEDV-DLLTRIQDNPTSM 462
           D L  L    +  I K L++SYD LN+ ++K IF  IAC F GE V D+   + ++   +
Sbjct: 409 DMLPRLRNGLDGKIEKTLRVSYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDV 468

Query: 463 CHRLKILVGKSLIAISDRKRLQMHDLLQEMGQTIVRQESLKEP 505
              LK LV KSLI +     ++MH LLQEMG+ IVR +S  EP
Sbjct: 469 NIGLKNLVDKSLIHVR-EDIVEMHSLLQEMGKEIVRAQS-NEP 509

syringae 6; Provisional. Length = 1153

>gnl\|CDD\|216585 pfam01582, TIR, TIR domain	Back alignment and domain information

>gnl\|CDD\|216202 pfam00931, NB-ARC, NB-ARC domain	Back alignment and domain information

>gnl\|CDD\|214587 smart00255, TIR, Toll - interleukin 1 - resistance	Back alignment and domain information

>gnl\|CDD\|215626 PLN03194, PLN03194, putative disease resistance protein; Provisional	Back alignment and domain information

>gnl\|CDD\|222311 pfam13676, TIR_2, TIR domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		505
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	100.0
PLN03194		187	putative disease resistance protein; Provisional	100.0
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	100.0
smart00255		140	TIR Toll - interleukin 1 - resistance.	99.84
PRK04841		903	transcriptional regulator MalT; Provisional	99.81
PF01582		141	TIR: TIR domain; InterPro: IPR000157 In Drosophila	99.81
PF13676		102	TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_	99.71
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	99.7
COG3899		849	Predicted ATPase [General function prediction only	99.66
PRK00411		394	cdc6 cell division control protein 6; Reviewed	99.56
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	99.49
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	99.47
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	99.46
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	99.45
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	99.36
COG3903		414	Predicted ATPase [General function prediction only	99.32
PF05729		166	NACHT: NACHT domain	99.22
KOG3678		832	consensus SARM protein (with sterile alpha and arm	99.21
COG2256		436	MGS1 ATPase related to the helicase subunit of the	99.07
PRK06893		229	DNA replication initiation factor; Validated	99.05
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	99.02
PRK13342		413	recombination factor protein RarA; Reviewed	99.01
PF14516		331	AAA_35: AAA-like domain	98.95
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	98.95
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	98.94
PRK12402		337	replication factor C small subunit 2; Reviewed	98.93
PTZ00112		1164	origin recognition complex 1 protein; Provisional	98.93
PRK07471		365	DNA polymerase III subunit delta'; Validated	98.92
PLN03025		319	replication factor C subunit; Provisional	98.9
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	98.89
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	98.89
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	98.88
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	98.87
PRK00440		319	rfc replication factor C small subunit; Reviewed	98.87
PF13191		185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	98.87
PRK08903		227	DnaA regulatory inactivator Hda; Validated	98.87
PRK08727		233	hypothetical protein; Validated	98.87
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	98.86
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	98.86
PRK08084		235	DNA replication initiation factor; Provisional	98.85
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	98.84
PTZ00202		550	tuzin; Provisional	98.84
PRK05642		234	DNA replication initiation factor; Validated	98.84
PRK04195		482	replication factor C large subunit; Provisional	98.81
PRK05564		313	DNA polymerase III subunit delta'; Validated	98.8
PRK09112		351	DNA polymerase III subunit delta'; Validated	98.79
PRK07940		394	DNA polymerase III subunit delta'; Validated	98.79
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	98.78
PRK14087		450	dnaA chromosomal replication initiation protein; P	98.77
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	98.76
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	98.73
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	98.73
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	98.72
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	98.72
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	98.7
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	98.7
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	98.7
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	98.7
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	98.69
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	98.69
PRK09087		226	hypothetical protein; Validated	98.68
PF13173		128	AAA_14: AAA domain	98.67
PRK13341		725	recombination factor protein RarA/unknown domain f	98.67
PRK00149		450	dnaA chromosomal replication initiation protein; R	98.66
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	98.65
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	98.65
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	98.63
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	98.61
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	98.6
KOG2028		554	consensus ATPase related to the helicase subunit o	98.6
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	98.6
PRK14086		617	dnaA chromosomal replication initiation protein; P	98.58
PRK14088		440	dnaA chromosomal replication initiation protein; P	98.58
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	98.57
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	98.57
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	98.57
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	98.56
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	98.55
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	98.54
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	98.54
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	98.53
PRK06620		214	hypothetical protein; Validated	98.53
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	98.52
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	98.52
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	98.52
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	98.49
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	98.46
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	98.42
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	98.41
CHL00095		821	clpC Clp protease ATP binding subunit	98.41
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	98.4
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	98.4
PRK05707		328	DNA polymerase III subunit delta'; Validated	98.4
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	98.39
PF08937		130	DUF1863: MTH538 TIR-like domain (DUF1863); InterPr	98.39
PRK12422		445	chromosomal replication initiation protein; Provis	98.37
PRK03992		389	proteasome-activating nucleotidase; Provisional	98.37
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	98.33
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	98.33
PF10443		431	RNA12: RNA12 protein; InterPro: IPR018850 Mitochon	98.33
PHA02544		316	44 clamp loader, small subunit; Provisional	98.33
COG3267		269	ExeA Type II secretory pathway, component ExeA (pr	98.3
PRK07399		314	DNA polymerase III subunit delta'; Validated	98.3
COG0593		408	DnaA ATPase involved in DNA replication initiation	98.3
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	98.27
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	98.26
PRK10865		857	protein disaggregation chaperone; Provisional	98.25
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	98.25
PF08357		150	SEFIR: SEFIR domain; InterPro: IPR013568 This doma	98.23
PRK08769		319	DNA polymerase III subunit delta'; Validated	98.18
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	98.16
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	98.16
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	98.14
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	98.13
PRK06871		325	DNA polymerase III subunit delta'; Validated	98.12
CHL00195		489	ycf46 Ycf46; Provisional	98.11
PRK07993		334	DNA polymerase III subunit delta'; Validated	98.09
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	98.08
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	98.06
PF00004		132	AAA: ATPase family associated with various cellula	98.05
COG1373		398	Predicted ATPase (AAA+ superfamily) [General funct	98.03
CHL00176		638	ftsH cell division protein; Validated	98.01
PRK08058		329	DNA polymerase III subunit delta'; Validated	98.01
CHL00181		287	cbbX CbbX; Provisional	97.98
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	97.96
PRK08181		269	transposase; Validated	97.93
PRK06090		319	DNA polymerase III subunit delta'; Validated	97.92
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	97.92
PRK06964		342	DNA polymerase III subunit delta'; Validated	97.91
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	97.89
PRK08116		268	hypothetical protein; Validated	97.88
KOG2543		438	consensus Origin recognition complex, subunit 5 [R	97.88
PRK10536		262	hypothetical protein; Provisional	97.87
cd01128		249	rho_factor Transcription termination factor rho is	97.86
COG2812		515	DnaX DNA polymerase III, gamma/tau subunits [DNA r	97.85
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	97.83
TIGR00602		637	rad24 checkpoint protein rad24. This family is bas	97.83
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	97.82
smart00382		148	AAA ATPases associated with a variety of cellular	97.81
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	97.8
PRK09376		416	rho transcription termination factor Rho; Provisio	97.8
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	97.79
PRK12377		248	putative replication protein; Provisional	97.77
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	97.75
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	97.75
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	97.75
KOG2227		529	consensus Pre-initiation complex, subunit CDC6, AA	97.75
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	97.74
PRK09183		259	transposase/IS protein; Provisional	97.73
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	97.7
KOG2228		408	consensus Origin recognition complex, subunit 4 [R	97.69
PRK06526		254	transposase; Provisional	97.67
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	97.66
TIGR00767		415	rho transcription termination factor Rho. Members	97.65
PRK06921		266	hypothetical protein; Provisional	97.65
TIGR01817		534	nifA Nif-specific regulatory protein. This model r	97.65
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	97.64
PRK10865		857	protein disaggregation chaperone; Provisional	97.64
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	97.64
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	97.63
PRK11608		326	pspF phage shock protein operon transcriptional ac	97.63
PRK07952		244	DNA replication protein DnaC; Validated	97.61
PRK04132		846	replication factor C small subunit; Provisional	97.6
PRK13531		498	regulatory ATPase RavA; Provisional	97.6
PRK08699		325	DNA polymerase III subunit delta'; Validated	97.59
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	97.57
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	97.57
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	97.55
PRK08939		306	primosomal protein DnaI; Reviewed	97.54
TIGR02974		329	phageshock_pspF psp operon transcriptional activat	97.53
COG2607		287	Predicted ATPase (AAA+ superfamily) [General funct	97.53
KOG2004		906	consensus Mitochondrial ATP-dependent protease PIM	97.52
PRK06835		329	DNA replication protein DnaC; Validated	97.5
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	97.5
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	97.49
CHL00095		821	clpC Clp protease ATP binding subunit	97.49
PF00158		168	Sigma54_activat: Sigma-54 interaction domain; Inte	97.45
PRK05022		509	anaerobic nitric oxide reductase transcription reg	97.45
COG1484		254	DnaC DNA replication protein [DNA replication, rec	97.44
PF14532		138	Sigma54_activ_2: Sigma-54 interaction domain; PDB:	97.4
PRK15429		686	formate hydrogenlyase transcriptional activator Fh	97.39
TIGR02902		531	spore_lonB ATP-dependent protease LonB. Members of	97.37
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	97.36
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	97.36
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	97.34
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	97.34
PF10236		309	DAP3: Mitochondrial ribosomal death-associated pro	97.33
KOG1514		767	consensus Origin recognition complex, subunit 1, a	97.29
PRK04296		190	thymidine kinase; Provisional	97.26
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	97.26
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	97.26
cd01394		218	radB RadB. The archaeal protein radB shares simila	97.25
PRK12608		380	transcription termination factor Rho; Provisional	97.24
PRK08118		167	topology modulation protein; Reviewed	97.23
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	97.23
PF04665		241	Pox_A32: Poxvirus A32 protein; InterPro: IPR006758	97.23
PRK09361		225	radB DNA repair and recombination protein RadB; Pr	97.22
COG1223		368	Predicted ATPase (AAA+ superfamily) [General funct	97.21
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	97.2
TIGR02237		209	recomb_radB DNA repair and recombination protein R	97.2
PF03215		519	Rad17: Rad17 cell cycle checkpoint protein	97.19
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	97.19
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	97.18
PRK00771		437	signal recognition particle protein Srp54; Provisi	97.18
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	97.16
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	97.14
COG1066		456	Sms Predicted ATP-dependent serine protease [Postt	97.13
COG1618		179	Predicted nucleotide kinase [Nucleotide transport	97.12
PRK10820		520	DNA-binding transcriptional regulator TyrR; Provis	97.11
PRK06696		223	uridine kinase; Validated	97.1
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	97.06
KOG1970		634	consensus Checkpoint RAD17-RFC complex, RAD17/RAD2	97.05
PHA00729		226	NTP-binding motif containing protein	97.04
PRK07667		193	uridine kinase; Provisional	97.03
KOG0731		774	consensus AAA+-type ATPase containing the peptidas	97.01
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	97.0
PRK14974		336	cell division protein FtsY; Provisional	96.97
cd01393		226	recA_like RecA is a bacterial enzyme which has rol	96.95
cd01133		274	F1-ATPase_beta F1 ATP synthase beta subunit, nucle	96.94
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	96.93
PRK06067		234	flagellar accessory protein FlaH; Validated	96.92
PTZ00494		664	tuzin-like protein; Provisional	96.92
TIGR01420		343	pilT_fam pilus retraction protein PilT. This model	96.91
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	96.91
PRK10733		644	hflB ATP-dependent metalloprotease; Reviewed	96.91
PRK07261		171	topology modulation protein; Provisional	96.91
TIGR01359		183	UMP_CMP_kin_fam UMP-CMP kinase family. This subfam	96.88
KOG2035		351	consensus Replication factor C, subunit RFC3 [Cell	96.88
PRK10923		469	glnG nitrogen regulation protein NR(I); Provisiona	96.87
PRK11388		638	DNA-binding transcriptional regulator DhaR; Provis	96.86
cd00561		159	CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B	96.86
cd00544		169	CobU Adenosylcobinamide kinase / adenosylcobinamid	96.86
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	96.83
cd01123		235	Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r	96.81
KOG1969		877	consensus DNA replication checkpoint protein CHL12	96.8
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	96.78
PF01583		156	APS_kinase: Adenylylsulphate kinase; InterPro: IPR	96.77
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	96.73
PF03969		362	AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654	96.71
PRK11823		446	DNA repair protein RadA; Provisional	96.69
KOG0743		457	consensus AAA+-type ATPase [Posttranslational modi	96.69
COG4088		261	Predicted nucleotide kinase [Nucleotide transport	96.68
KOG3928		461	consensus Mitochondrial ribosome small subunit com	96.68
TIGR00416		454	sms DNA repair protein RadA. The gene protuct code	96.68
PRK15455		644	PrkA family serine protein kinase; Provisional	96.66
PRK07132		299	DNA polymerase III subunit delta'; Validated	96.66
PRK00279		215	adk adenylate kinase; Reviewed	96.66
PF10137		125	TIR-like: Predicted nucleotide-binding protein con	96.6
PRK05800		170	cobU adenosylcobinamide kinase/adenosylcobinamide-	96.6
TIGR02329		526	propionate_PrpR propionate catabolism operon regul	96.59
KOG0734		752	consensus AAA+-type ATPase containing the peptidas	96.59
TIGR00150		133	HI0065_YjeE ATPase, YjeE family. Members of this f	96.59
PF00406		151	ADK: Adenylate kinase; InterPro: IPR000850 Adenyla	96.58
PRK10867		433	signal recognition particle protein; Provisional	96.57
PF03308		266	ArgK: ArgK protein; InterPro: IPR005129 Bacterial	96.57
TIGR00064		272	ftsY signal recognition particle-docking protein F	96.57
PRK05541		176	adenylylsulfate kinase; Provisional	96.57
PF00910		107	RNA_helicase: RNA helicase; InterPro: IPR000605 He	96.56
PRK14527		191	adenylate kinase; Provisional	96.56
PF13238		129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	96.54
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	96.53
cd01858		157	NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei	96.49
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	96.47
PF07726		131	AAA_3: ATPase family associated with various cellu	96.47
PF00485		194	PRK: Phosphoribulokinase / Uridine kinase family;	96.47
COG0563		178	Adk Adenylate kinase and related kinases [Nucleoti	96.46
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	96.45
PRK05917		290	DNA polymerase III subunit delta'; Validated	96.45
cd01122		271	GP4d_helicase GP4d_helicase is a homohexameric 5'-	96.44
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	96.44
PF13671		143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	96.43
PRK14528		186	adenylate kinase; Provisional	96.43
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	96.41
PRK10463		290	hydrogenase nickel incorporation protein HypB; Pro	96.41
TIGR02915		445	PEP_resp_reg putative PEP-CTERM system response re	96.39
PRK08233		182	hypothetical protein; Provisional	96.39
cd02019		69	NK Nucleoside/nucleotide kinase (NK) is a protein	96.38
PRK06762		166	hypothetical protein; Provisional	96.38
TIGR03574		249	selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem	96.37
COG0468		279	RecA RecA/RadA recombinase [DNA replication, recom	96.37
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	96.37
PF08433		270	KTI12: Chromatin associated protein KTI12 ; InterP	96.36
cd03247		178	ABCC_cytochrome_bd The CYD subfamily implicated in	96.36
PRK15115		444	response regulator GlrR; Provisional	96.33
cd03214		180	ABC_Iron-Siderophores_B12_Hemin ABC transporters,	96.3
KOG0736		953	consensus Peroxisome assembly factor 2 containing	96.3
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	96.27
TIGR03877		237	thermo_KaiC_1 KaiC domain protein, Ph0284 family.	96.25
PRK05480		209	uridine/cytidine kinase; Provisional	96.24
PRK07276		290	DNA polymerase III subunit delta'; Validated	96.24
COG1703		323	ArgK Putative periplasmic protein kinase ArgK and	96.22
TIGR01351		210	adk adenylate kinases. Adenylate kinase (EC 2.7.4.	96.22
COG1875		436	NYN ribonuclease and ATPase of PhoH family domains	96.22
COG4608		268	AppF ABC-type oligopeptide transport system, ATPas	96.22
PTZ00088		229	adenylate kinase 1; Provisional	96.22
PRK09270		229	nucleoside triphosphate hydrolase domain-containin	96.21
TIGR01818		463	ntrC nitrogen regulation protein NR(I). This model	96.21
COG0529		197	CysC Adenylylsulfate kinase and related kinases [I	96.19
PTZ00301		210	uridine kinase; Provisional	96.19
PRK14532		188	adenylate kinase; Provisional	96.19
TIGR02524		358	dot_icm_DotB Dot/Icm secretion system ATPase DotB.	96.19
PRK14531		183	adenylate kinase; Provisional	96.18
COG0467		260	RAD55 RecA-superfamily ATPases implicated in signa	96.17
PRK11361		457	acetoacetate metabolism regulatory protein AtoC; P	96.16
CHL00206		2281	ycf2 Ycf2; Provisional	96.15
cd02027		149	APSK Adenosine 5'-phosphosulfate kinase (APSK) cat	96.14
PLN02674		244	adenylate kinase	96.14
cd03222		177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	96.13
cd03228		171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	96.12
PRK03839		180	putative kinase; Provisional	96.12
PRK00131		175	aroK shikimate kinase; Reviewed	96.11
KOG0728		404	consensus 26S proteasome regulatory complex, ATPas	96.1
TIGR00235		207	udk uridine kinase. Model contains a number of lon	96.1
PF03266		168	NTPase_1: NTPase; InterPro: IPR004948 This entry r	96.09
PRK04040		188	adenylate kinase; Provisional	96.07
cd03115		173	SRP The signal recognition particle (SRP) mediates	96.06
KOG0739		439	consensus AAA+-type ATPase [Posttranslational modi	96.06
PRK00889		175	adenylylsulfate kinase; Provisional	96.02
PF13245		76	AAA_19: Part of AAA domain	96.02
TIGR01360		188	aden_kin_iso1 adenylate kinase, isozyme 1 subfamil	96.02
cd00227		175	CPT Chloramphenicol (Cm) phosphotransferase (CPT).	96.02
PRK06217		183	hypothetical protein; Validated	96.01
KOG0729		435	consensus 26S proteasome regulatory complex, ATPas	96.01
cd03223		166	ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass	96.01
PRK06547		172	hypothetical protein; Provisional	96.0
KOG1051		898	consensus Chaperone HSP104 and related ATP-depende	95.98
PRK15424		538	propionate catabolism operon regulatory protein Pr	95.98
cd01428		194	ADK Adenylate kinase (ADK) catalyzes the reversibl	95.97
COG0465		596	HflB ATP-dependent Zn proteases [Posttranslational	95.97
TIGR02858		270	spore_III_AA stage III sporulation protein AA. Mem	95.96
COG1102		179	Cmk Cytidylate kinase [Nucleotide transport and me	95.95
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	95.95
PRK00625		173	shikimate kinase; Provisional	95.95
TIGR02525		372	plasmid_TraJ plasmid transfer ATPase TraJ. Members	95.94
PF00625		183	Guanylate_kin: Guanylate kinase; InterPro: IPR0081	95.94
PHA02244		383	ATPase-like protein	95.93
PRK02496		184	adk adenylate kinase; Provisional	95.93
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	95.9
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	95.89
TIGR00959		428	ffh signal recognition particle protein. This mode	95.89
COG2204		464	AtoC Response regulator containing CheY-like recei	95.89
cd01125		239	repA Hexameric Replicative Helicase RepA. RepA is	95.89
cd02028		179	UMPK_like Uridine monophosphate kinase_like (UMPK_	95.89
COG4133		209	CcmA ABC-type transport system involved in cytochr	95.89
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	95.88
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	95.88
PRK05973		237	replicative DNA helicase; Provisional	95.88
PRK04328		249	hypothetical protein; Provisional	95.87
PRK14529		223	adenylate kinase; Provisional	95.86
cd03216		163	ABC_Carb_Monos_I This family represents the domain	95.86
PF12775		272	AAA_7: P-loop containing dynein motor region D3; P	95.84
PF06068		398	TIP49: TIP49 C-terminus; InterPro: IPR010339 This	95.83
cd00983		325	recA RecA is a bacterial enzyme which has roles in	95.82
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	95.81
KOG0652		424	consensus 26S proteasome regulatory complex, ATPas	95.8
PRK03846		198	adenylylsulfate kinase; Provisional	95.79
COG3910		233	Predicted ATPase [General function prediction only	95.79
cd03230		173	ABC_DR_subfamily_A This family of ATP-binding prot	95.79
TIGR02238		313	recomb_DMC1 meiotic recombinase Dmc1. This model d	95.78
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	95.78
COG0572		218	Udk Uridine kinase [Nucleotide transport and metab	95.77
PRK09435		332	membrane ATPase/protein kinase; Provisional	95.76
PRK14738		206	gmk guanylate kinase; Provisional	95.75
COG1224		450	TIP49 DNA helicase TIP49, TBP-interacting protein	95.75
cd01857		141	HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t	95.73
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	95.7
COG0714		329	MoxR-like ATPases [General function prediction onl	95.69
PRK05439		311	pantothenate kinase; Provisional	95.68
PF08298		358	AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi	95.67
PF09848		352	DUF2075: Uncharacterized conserved protein (DUF207	95.67
TIGR00390		441	hslU ATP-dependent protease HslVU, ATPase subunit.	95.66
PRK09354		349	recA recombinase A; Provisional	95.66
cd02021		150	GntK Gluconate kinase (GntK) catalyzes the phospho	95.66
PF03193		161	DUF258: Protein of unknown function, DUF258; Inter	95.66
PRK13947		171	shikimate kinase; Provisional	95.66
PRK14526		211	adenylate kinase; Provisional	95.65
cd03246		173	ABCC_Protease_Secretion This family represents the	95.65
TIGR02322		179	phosphon_PhnN phosphonate metabolism protein/1,5-b	95.64
COG1936		180	Predicted nucleotide kinase (related to CMP and AM	95.64
TIGR02533		486	type_II_gspE general secretory pathway protein E.	95.63
cd00071		137	GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.	95.63
TIGR00708		173	cobA cob(I)alamin adenosyltransferase. Alternate n	95.62
COG0378		202	HypB Ni2+-binding GTPase involved in regulation of	95.61
PF02374		305	ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_	95.61
PF03205		140	MobB: Molybdopterin guanine dinucleotide synthesis	95.6
KOG0651		388	consensus 26S proteasome regulatory complex, ATPas	95.6
PRK08533		230	flagellar accessory protein FlaH; Reviewed	95.59
COG2884		223	FtsE Predicted ATPase involved in cell division [C	95.59
PRK05537		568	bifunctional sulfate adenylyltransferase subunit 1	95.58
cd02024		187	NRK1 Nicotinamide riboside kinase (NRK) is an enzy	95.57
cd02020		147	CMPK Cytidine monophosphate kinase (CMPK) catalyze	95.54
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	95.53
COG0003		322	ArsA Predicted ATPase involved in chromosome parti	95.53
COG1428		216	Deoxynucleoside kinases [Nucleotide transport and	95.52
PRK04301		317	radA DNA repair and recombination protein RadA; Va	95.51
PRK10751		173	molybdopterin-guanine dinucleotide biosynthesis pr	95.49
PRK14737		186	gmk guanylate kinase; Provisional	95.49
cd02023		198	UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.	95.48
cd02025		220	PanK Pantothenate kinase (PanK) catalyzes the phos	95.47
TIGR03880		224	KaiC_arch_3 KaiC domain protein, AF_0351 family. T	95.47
COG1643		845	HrpA HrpA-like helicases [DNA replication, recombi	95.46
PF02367		123	UPF0079: Uncharacterised P-loop hydrolase UPF0079;	95.45
COG3854		308	SpoIIIAA ncharacterized protein conserved in bacte	95.45
COG0703		172	AroK Shikimate kinase [Amino acid transport and me	95.44
PRK12339		197	2-phosphoglycerate kinase; Provisional	95.44
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	95.43
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	95.43
COG3640		255	CooC CO dehydrogenase maturation factor [Cell divi	95.43
PF07693		325	KAP_NTPase: KAP family P-loop domain; InterPro: IP	95.42
COG0194		191	Gmk Guanylate kinase [Nucleotide transport and met	95.41
KOG3347		176	consensus Predicted nucleotide kinase/nuclear prot	95.4
PRK13808		333	adenylate kinase; Provisional	95.39
cd03232		192	ABC_PDR_domain2 The pleiotropic drug resistance-li	95.39
PRK05818		261	DNA polymerase III subunit delta'; Validated	95.38
PRK15453		290	phosphoribulokinase; Provisional	95.38
TIGR02788		308	VirB11 P-type DNA transfer ATPase VirB11. The VirB	95.36
cd00464		154	SK Shikimate kinase (SK) is the fifth enzyme in th	95.36
PRK13949		169	shikimate kinase; Provisional	95.35
TIGR00750		300	lao LAO/AO transport system ATPase. Mutations have	95.35
PRK10416		318	signal recognition particle-docking protein FtsY;	95.34
KOG0742		630	consensus AAA+-type ATPase [Posttranslational modi	95.34
cd03281		213	ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS	95.33
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	95.32
PRK05201		443	hslU ATP-dependent protease ATP-binding subunit Hs	95.32
TIGR00764		608	lon_rel lon-related putative ATP-dependent proteas	95.32
PRK13948		182	shikimate kinase; Provisional	95.32
TIGR01313		163	therm_gnt_kin carbohydrate kinase, thermoresistant	95.32
TIGR03263		180	guanyl_kin guanylate kinase. Members of this famil	95.31
KOG1532		366	consensus GTPase XAB1, interacts with DNA repair p	95.31
PF05970		364	PIF1: PIF1-like helicase; InterPro: IPR010285 This	95.3
TIGR02236		310	recomb_radA DNA repair and recombination protein R	95.3
PLN02459		261	probable adenylate kinase	95.28
PRK14530		215	adenylate kinase; Provisional	95.28
COG2401		593	ABC-type ATPase fused to a predicted acetyltransfe	95.27
PRK00300		205	gmk guanylate kinase; Provisional	95.25
PF08477		119	Miro: Miro-like protein; InterPro: IPR013684 Mitoc	95.21
PRK13765		637	ATP-dependent protease Lon; Provisional	95.21
PF06414		199	Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e	95.21
PRK10646		153	ADP-binding protein; Provisional	95.19
PLN02200		234	adenylate kinase family protein	95.18
cd03233		202	ABC_PDR_domain1 The pleiotropic drug resistance (P	95.18
PF13521		163	AAA_28: AAA domain; PDB: 1LW7_A.	95.17
cd00984		242	DnaB_C DnaB helicase C terminal domain. The hexame	95.17
PF00006		215	ATP-synt_ab: ATP synthase alpha/beta family, nucle	95.16
COG2804		500	PulE Type II secretory pathway, ATPase PulE/Tfp pi	95.15
PRK09519		790	recA DNA recombination protein RecA; Reviewed	95.13
PRK09280		463	F0F1 ATP synthase subunit beta; Validated	95.13
TIGR00073		207	hypB hydrogenase accessory protein HypB. HypB is i	95.13
COG1221		403	PspF Transcriptional regulators containing an AAA-	95.13
PRK13946		184	shikimate kinase; Provisional	95.12
TIGR00041		195	DTMP_kinase thymidylate kinase. Function: phosphor	95.11
smart00072		184	GuKc Guanylate kinase homologues. Active enzymes c	95.11
COG2805		353	PilT Tfp pilus assembly protein, pilus retraction	95.11
cd00820		107	PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC	95.11
PF03029		238	ATP_bind_1: Conserved hypothetical ATP binding pro	95.1
PRK13768		253	GTPase; Provisional	95.1
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	95.09
PRK12597		461	F0F1 ATP synthase subunit beta; Provisional	95.08
COG2019		189	AdkA Archaeal adenylate kinase [Nucleotide transpo	95.04
TIGR03600		421	phage_DnaB phage replicative helicase, DnaB family	95.03
TIGR00176		155	mobB molybdopterin-guanine dinucleotide biosynthes	95.03
cd00267		157	ABC_ATPase ABC (ATP-binding cassette) transporter	95.02
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	95.02
PRK14493		274	putative bifunctional molybdopterin-guanine dinucl	95.01
PRK13975		196	thymidylate kinase; Provisional	94.99
PRK10078		186	ribose 1,5-bisphosphokinase; Provisional	94.99
PRK10436		462	hypothetical protein; Provisional	94.99
PRK06761		282	hypothetical protein; Provisional	94.98
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309		127	Torsin: Torsin; InterPro: IPR010448 This family co	94.97
cd01672		200	TMPK Thymidine monophosphate kinase (TMPK), also k	94.96
TIGR01039		461	atpD ATP synthase, F1 beta subunit. The sequences	94.95
cd03213		194	ABCG_EPDR ABCG transporters are involved in eye pi	94.95
KOG0727		408	consensus 26S proteasome regulatory complex, ATPas	94.91
TIGR01287		275	nifH nitrogenase iron protein. This model describe	94.91
PRK05057		172	aroK shikimate kinase I; Reviewed	94.91
TIGR01069		771	mutS2 MutS2 family protein. Function of MutS2 is u	94.9
PRK10875		615	recD exonuclease V subunit alpha; Provisional	94.89
PRK10365		441	transcriptional regulatory protein ZraR; Provision	94.89
COG0802		149	Predicted ATPase or kinase [General function predi	94.89
cd03287		222	ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS	94.88
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	94.86
PRK05986		191	cob(I)alamin adenolsyltransferase/cobinamide ATP-d	94.82
cd01855		190	YqeH YqeH. YqeH is an essential GTP-binding protei	94.82
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	94.81
smart00487		201	DEXDc DEAD-like helicases superfamily.	94.81
TIGR02782		299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	94.81
smart00534		185	MUTSac ATPase domain of DNA mismatch repair MUTS f	94.79
TIGR02768		744	TraA_Ti Ti-type conjugative transfer relaxase TraA	94.79
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	94.78
COG4240		300	Predicted kinase [General function prediction only	94.77
PLN02318		656	phosphoribulokinase/uridine kinase	94.77
TIGR00554		290	panK_bact pantothenate kinase, bacterial type. Sho	94.76
cd03114		148	ArgK-like The function of this protein family is u	94.73
COG1124		252	DppF ABC-type dipeptide/oligopeptide/nickel transp	94.73
PRK04182		180	cytidylate kinase; Provisional	94.73
cd02117		212	NifH_like This family contains the NifH (iron prot	94.72
PHA02530		300	pseT polynucleotide kinase; Provisional	94.72
TIGR02173		171	cyt_kin_arch cytidylate kinase, putative. Proteins	94.71
cd01130		186	VirB11-like_ATPase Type IV secretory pathway compo	94.71

>PLN03210 Resistant to P	Back alignment and domain information

Probab=100.00  E-value=5.4e-79  Score=682.19  Aligned_cols=492  Identities=41%  Similarity=0.664  Sum_probs=434.4

Q ss_pred             CCCCCCCCCCCCCCcccEEEcccccccccchHHHHHHHHHhcCcceeeccccccCCCchhHHHHHHHhhcceEEEEecCC
Q 042739            1 MASSSSASSLDAQNKYEVFLSFRGEDTRNGFTSHLAAALHRKQIQFFIDDEELKKGDEISPALSNAIETTDISIIIFSKG   80 (505)
Q Consensus         1 ~~~~~~~~~~~~~~~~dvFisy~~~D~~~~~~~~l~~~L~~~g~~~~~d~~~~~~g~~~~~~i~~~i~~s~~~i~v~s~~   80 (505)
                      |++|+|++   ..++|||||||+|+|++++|+.||+++|.++||.+|.|. ++..|+.+..++.+||++|+++|||+|++
T Consensus         1 ~~~~~~~~---~~~~~~vf~sfrg~d~r~~f~~hl~~~l~~~~i~~f~d~-~~~~g~~~~~~l~~~i~~s~~~ivv~s~~   76 (1153)
T PLN03210          1 MASSSSSS---RNWVYDVFPSFSGEDVRITFLSHFLKELDRKLIIAFKDN-EIERSQSLDPELKQAIRDSRIAVVVFSKN   76 (1153)
T ss_pred             CCCCCCCC---CCCCCcEEeeCCCcccccCHHHHHHHHHHHCCCeEEccC-CccCCCcccHHHHHHHHhCeEEEEEecCC
Confidence            55555433   468999999999999999999999999999999999998 79999999999999999999999999999


Q ss_pred             cccchhhHHHHHHHHHhhhhCCCeEEEEEeecCCccccccccchHHHHHHHHhhCh-hhHHHHHHHHHhhccCCCCCCCC
Q 042739           81 YASSKWCLNELVKTLDCKRTNGQIVIPVFYQIDPSDVRKQSESLEEAFLEHEKNFP-DKVQKWRAALTEASNLSGYDPTE  159 (505)
Q Consensus        81 ~~~s~~~~~El~~~~~~~~~~~~~v~pv~~~~~p~~vr~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~~  159 (505)
                      |++|.||++||++|++|.+..+++|+||||+|+|++||+|+|+|+++|.+++.+.. +++++|++||.+++++.|+++..
T Consensus        77 ya~s~wcl~el~~i~~~~~~~~~~v~pvfy~v~p~~v~~~~g~f~~~f~~~~~~~~~~~~~~w~~al~~~~~~~g~~~~~  156 (1153)
T PLN03210         77 YASSSWCLNELLEIVRCKEELGQLVIPVFYGLDPSHVRKQTGDFGEAFEKTCQNKTEDEKIQWKQALTDVANILGYHSQN  156 (1153)
T ss_pred             cccchHHHHHHHHHHHhhhhcCceEEEEEecccHHHHhhccchHHHHHHHHhcccchhHHHHHHHHHHHHhCcCceecCC
Confidence            99999999999999999999999999999999999999999999999999887754 45999999999999999999998


Q ss_pred             CChhHHHHHHHHHhhccccccCCCCCCCCCceechhhHHHHHHhhhccCCCceEEEEeccCcchHHHHHHHHHhhhcccc
Q 042739          160 SRNEAELVEEIVADISKKLEDMSDSTDLDGFIGINSRIEEIKSLLCLESHDARIVGIWGMGGIGKTTIASVVFHQISRYF  239 (505)
Q Consensus       160 ~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~fvGR~~el~~l~~~L~~~~~~~~~v~I~G~~GiGKTtLa~~~~~~~~~~f  239 (505)
                      +.+|++++++|+++|..++...++ .+.+.+|||+..+++|..+|..+.+++++|+|+||||+||||||+.+++++..+|
T Consensus       157 ~~~E~~~i~~Iv~~v~~~l~~~~~-~~~~~~vG~~~~l~~l~~lL~l~~~~~~vvgI~G~gGiGKTTLA~~l~~~l~~~F  235 (1153)
T PLN03210        157 WPNEAKMIEEIANDVLGKLNLTPS-NDFEDFVGIEDHIAKMSSLLHLESEEVRMVGIWGSSGIGKTTIARALFSRLSRQF  235 (1153)
T ss_pred             CCCHHHHHHHHHHHHHHhhccccC-cccccccchHHHHHHHHHHHccccCceEEEEEEcCCCCchHHHHHHHHHHHhhcC
Confidence            899999999999999999987776 7888999999999999999987677799999999999999999999999999999


Q ss_pred             cceEEEeec--cccc---c------cccHHHHHHHHHHHHhCCCCccCCCCchHHHHhccCCCeEEEEEeCCCCCHHHHH
Q 042739          240 QGNCFMANV--REES---N------KLGVIRVRDEVISQVLGENLKVGTLTIPQNIKKGLQRMKVLIVLDDVHDEFTQLE  308 (505)
Q Consensus       240 ~~~~~~~~~--~~~~---~------~~~~~~~~~~ll~~~~~~~~~~~~~~~~~~l~~~l~~~~~LlVlDdv~~~~~~~~  308 (505)
                      +..+|+...  ....   .      ......+..+++..+......  .......+++.+.++|+||||||+ ++..+++
T Consensus       236 ~g~vfv~~~~v~~~~~~~~~~~~~~~~~~~~l~~~~l~~il~~~~~--~~~~~~~~~~~L~~krvLLVLDdv-~~~~~l~  312 (1153)
T PLN03210        236 QSSVFIDRAFISKSMEIYSSANPDDYNMKLHLQRAFLSEILDKKDI--KIYHLGAMEERLKHRKVLIFIDDL-DDQDVLD  312 (1153)
T ss_pred             CeEEEeeccccccchhhcccccccccchhHHHHHHHHHHHhCCCCc--ccCCHHHHHHHHhCCeEEEEEeCC-CCHHHHH
Confidence            988887531  1000   0      011233445556555443221  111246678889999999999999 7788899


Q ss_pred             HHhcCcCCCCCCCEEEEEeCcchhhcccCCCcEEEcCCCCHhHHHHHHHHhhcCCCCCChhHHHHHHHHHHHhcCChHHH
Q 042739          309 SLAGVIDRFSPGSRIIITTRDKRVLDKCEVSNIFEVKGLEHNKAFELFCRKAFGQNNRSHDLYQLSQRVVCYADGNPLAL  388 (505)
Q Consensus       309 ~l~~~l~~~~~~~~iliTsR~~~~~~~~~~~~~~~l~~L~~~ea~~L~~~~~~~~~~~~~~~~~~~~~i~~~~~G~PLal  388 (505)
                      .+.....+.++|++||||||+..++...+..+.++++.|+.++|++||++++|+...++....+++.+|+++|+|+||||
T Consensus       313 ~L~~~~~~~~~GsrIIiTTrd~~vl~~~~~~~~~~v~~l~~~ea~~LF~~~Af~~~~~~~~~~~l~~~iv~~c~GLPLAl  392 (1153)
T PLN03210        313 ALAGQTQWFGSGSRIIVITKDKHFLRAHGIDHIYEVCLPSNELALEMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGL  392 (1153)
T ss_pred             HHHhhCccCCCCcEEEEEeCcHHHHHhcCCCeEEEecCCCHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHhCCCcHHH
Confidence            88877777789999999999998887766678999999999999999999999877777778899999999999999999


Q ss_pred             HHHHHhhcCCCHHHHHHHHHhhccCCCccHHHHHHHhHhcCCh-hHHHHHhhhhccCCCCCHHHHHHHHhC-CCchhhHH
Q 042739          389 EVLGSSLYQNSIQQWEDKLHNLNLISEPNIYKVLKISYDELNS-EEKGIFLDIACFFKGEDVDLLTRIQDN-PTSMCHRL  466 (505)
Q Consensus       389 ~~~~~~l~~~~~~~~~~~l~~l~~~~~~~l~~~l~~s~~~L~~-~~~~~l~~la~f~~~~~~~~l~~l~~~-~~~~~~~l  466 (505)
                      +.+|++|++++..+|...+.++....+..+..+|+.||+.|++ .+|.+|+++|+|+.+.+.+.+..++.. +..+..++
T Consensus       393 ~vlgs~L~~k~~~~W~~~l~~L~~~~~~~I~~~L~~SYd~L~~~~~k~~Fl~ia~ff~~~~~~~v~~~l~~~~~~~~~~l  472 (1153)
T PLN03210        393 NVLGSYLRGRDKEDWMDMLPRLRNGLDGKIEKTLRVSYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGL  472 (1153)
T ss_pred             HHHHHHHcCCCHHHHHHHHHHHHhCccHHHHHHHHHhhhccCccchhhhhheehhhcCCCCHHHHHHHHHhcCCCchhCh
Confidence            9999999999999999999999888888899999999999986 589999999999999999988888877 77778889


Q ss_pred             HHHhhccceEEcCCCcEEecHHHHHHHHHHHhhcC
Q 042739          467 KILVGKSLIAISDRKRLQMHDLLQEMGQTIVRQES  501 (505)
Q Consensus       467 ~~L~~~sLl~~~~~~~~~~H~lvr~~a~~~~~~e~  501 (505)
                      +.|++++||+.. .+++.||+++|++|++++++++
T Consensus       473 ~~L~~ksLi~~~-~~~~~MHdLl~~~~r~i~~~~~  506 (1153)
T PLN03210        473 KNLVDKSLIHVR-EDIVEMHSLLQEMGKEIVRAQS  506 (1153)
T ss_pred             HHHHhcCCEEEc-CCeEEhhhHHHHHHHHHHHhhc
Confidence            999999999987 6789999999999999999876

syringae 6; Provisional

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PLN03194 putative disease resistance protein; Provisional	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>smart00255 TIR Toll - interleukin 1 - resistance	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>PF01582 TIR: TIR domain; InterPro: IPR000157 In Drosophila melanogaster the Toll protein is involved in establishment of dorso-ventral polarity in the embryo	Back alignment and domain information

>PF13676 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_A 3UB2_A	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>COG3899 Predicted ATPase [General function prediction only]	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>COG3903 Predicted ATPase [General function prediction only]	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures]	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PF14516 AAA_35: AAA-like domain	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PTZ00202 tuzin; Provisional	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF08937 DUF1863: MTH538 TIR-like domain (DUF1863); InterPro: IPR015032 This protein adopts the flavodoxin fold, that is, five parallel beta-strands and four helical segments	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ]	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>PF08357 SEFIR: SEFIR domain; InterPro: IPR013568 This domain is found in IL17 receptors (IL17Rs, e	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair]	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase	Back alignment and domain information

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>TIGR00602 rad24 checkpoint protein rad24	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK09376 rho transcription termination factor Rho; Provisional	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair]	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00767 rho transcription termination factor Rho	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01817 nifA Nif-specific regulatory protein	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>PRK13531 regulatory ATPase RavA; Provisional	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF	Back alignment and domain information

>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor	Back alignment and domain information

>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H	Back alignment and domain information

>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional	Back alignment and domain information

>TIGR02902 spore_lonB ATP-dependent protease LonB	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms	Back alignment and domain information

>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair]	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>cd01394 radB RadB	Back alignment and domain information

>PRK12608 transcription termination factor Rho; Provisional	Back alignment and domain information

>PRK08118 topology modulation protein; Reviewed	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein	Back alignment and domain information

>PRK09361 radB DNA repair and recombination protein RadB; Provisional	Back alignment and domain information

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>PF03215 Rad17: Rad17 cell cycle checkpoint protein	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional	Back alignment and domain information

>PRK06696 uridine kinase; Validated	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>PRK07667 uridine kinase; Provisional	Back alignment and domain information

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>PTZ00494 tuzin-like protein; Provisional	Back alignment and domain information

>TIGR01420 pilT_fam pilus retraction protein PilT	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK10733 hflB ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>PRK07261 topology modulation protein; Provisional	Back alignment and domain information

>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family	Back alignment and domain information

>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PRK10923 glnG nitrogen regulation protein NR(I); Provisional	Back alignment and domain information

>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional	Back alignment and domain information

>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP	Back alignment and domain information

>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU)	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B	Back alignment and domain information

>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG3928 consensus Mitochondrial ribosome small subunit component, mediator of apoptosis DAP3 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00416 sms DNA repair protein RadA	Back alignment and domain information

>PRK15455 PrkA family serine protein kinase; Provisional	Back alignment and domain information

>PRK07132 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK00279 adk adenylate kinase; Reviewed	Back alignment and domain information

>PF10137 TIR-like: Predicted nucleotide-binding protein containing TIR-like domain; InterPro: IPR019302 This entry represents a TIR-like domain found in a family of prokaryotic predicted nucleotide-binding proteins	Back alignment and domain information

>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated	Back alignment and domain information

>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR	Back alignment and domain information

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00150 HI0065_YjeE ATPase, YjeE family	Back alignment and domain information

>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>PRK05541 adenylylsulfate kinase; Provisional	Back alignment and domain information

>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5)	Back alignment and domain information

>PRK14527 adenylate kinase; Provisional	Back alignment and domain information

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>cd01858 NGP_1 NGP-1	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model	Back alignment and domain information

>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2	Back alignment and domain information

>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>PRK05917 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B	Back alignment and domain information

>PRK14528 adenylate kinase; Provisional	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional	Back alignment and domain information

>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator	Back alignment and domain information

>PRK08233 hypothetical protein; Provisional	Back alignment and domain information

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars	Back alignment and domain information

>PRK06762 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal	Back alignment and domain information

>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II []	Back alignment and domain information

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis	Back alignment and domain information

>PRK15115 response regulator GlrR; Provisional	Back alignment and domain information

>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family	Back alignment and domain information

>PRK05480 uridine/cytidine kinase; Provisional	Back alignment and domain information

>PRK07276 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01351 adk adenylate kinases	Back alignment and domain information

>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only]	Back alignment and domain information

>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PTZ00088 adenylate kinase 1; Provisional	Back alignment and domain information

>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed	Back alignment and domain information

>TIGR01818 ntrC nitrogen regulation protein NR(I)	Back alignment and domain information

>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]	Back alignment and domain information

>PTZ00301 uridine kinase; Provisional	Back alignment and domain information

>PRK14532 adenylate kinase; Provisional	Back alignment and domain information

>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB	Back alignment and domain information

>PRK14531 adenylate kinase; Provisional	Back alignment and domain information

>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]	Back alignment and domain information

>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional	Back alignment and domain information

>CHL00206 ycf2 Ycf2; Provisional	Back alignment and domain information

>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS)	Back alignment and domain information

>PLN02674 adenylate kinase	Back alignment and domain information

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids	Back alignment and domain information

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export	Back alignment and domain information

>PRK03839 putative kinase; Provisional	Back alignment and domain information

>PRK00131 aroK shikimate kinase; Reviewed	Back alignment and domain information

>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00235 udk uridine kinase	Back alignment and domain information

>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency []	Back alignment and domain information

>PRK04040 adenylate kinase; Provisional	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK00889 adenylylsulfate kinase; Provisional	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily	Back alignment and domain information

>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT)	Back alignment and domain information

>PRK06217 hypothetical protein; Validated	Back alignment and domain information

>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome	Back alignment and domain information

>PRK06547 hypothetical protein; Provisional	Back alignment and domain information

>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional	Back alignment and domain information

>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP)	Back alignment and domain information

>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02858 spore_III_AA stage III sporulation protein AA	Back alignment and domain information

>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>PRK00625 shikimate kinase; Provisional	Back alignment and domain information

>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ	Back alignment and domain information

>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>PRK02496 adk adenylate kinase; Provisional	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]	Back alignment and domain information

>cd01125 repA Hexameric Replicative Helicase RepA	Back alignment and domain information

>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>PRK05973 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK04328 hypothetical protein; Provisional	Back alignment and domain information

>PRK14529 adenylate kinase; Provisional	Back alignment and domain information

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A	Back alignment and domain information

>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins	Back alignment and domain information

>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK03846 adenylylsulfate kinase; Provisional	Back alignment and domain information

>COG3910 Predicted ATPase [General function prediction only]	Back alignment and domain information

>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity	Back alignment and domain information

>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK09435 membrane ATPase/protein kinase; Provisional	Back alignment and domain information

>PRK14738 gmk guanylate kinase; Provisional	Back alignment and domain information

>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>cd01857 HSR1_MMR1 HSR1/MMR1	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>COG0714 MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>PRK05439 pantothenate kinase; Provisional	Back alignment and domain information

>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length	Back alignment and domain information

>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function	Back alignment and domain information

>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>PRK09354 recA recombinase A; Provisional	Back alignment and domain information

>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate	Back alignment and domain information

>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis	Back alignment and domain information

>PRK13947 shikimate kinase; Provisional	Back alignment and domain information

>PRK14526 adenylate kinase; Provisional	Back alignment and domain information

>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain	Back alignment and domain information

>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN	Back alignment and domain information

>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR02533 type_II_gspE general secretory pathway protein E	Back alignment and domain information

>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2	Back alignment and domain information

>TIGR00708 cobA cob(I)alamin adenosyltransferase	Back alignment and domain information

>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription]	Back alignment and domain information

>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B	Back alignment and domain information

>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A	Back alignment and domain information

>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated	Back alignment and domain information

>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+)	Back alignment and domain information

>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK04301 radA DNA repair and recombination protein RadA; Validated	Back alignment and domain information

>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional	Back alignment and domain information

>PRK14737 gmk guanylate kinase; Provisional	Back alignment and domain information

>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway	Back alignment and domain information

>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family	Back alignment and domain information

>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop	Back alignment and domain information

>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK12339 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning]	Back alignment and domain information

>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals	Back alignment and domain information

>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK13808 adenylate kinase; Provisional	Back alignment and domain information

>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>PRK05818 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK15453 phosphoribulokinase; Provisional	Back alignment and domain information

>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11	Back alignment and domain information

>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants	Back alignment and domain information

>PRK13949 shikimate kinase; Provisional	Back alignment and domain information

>TIGR00750 lao LAO/AO transport system ATPase	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional	Back alignment and domain information

>TIGR00764 lon_rel lon-related putative ATP-dependent protease	Back alignment and domain information

>PRK13948 shikimate kinase; Provisional	Back alignment and domain information

>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family	Back alignment and domain information

>TIGR03263 guanyl_kin guanylate kinase	Back alignment and domain information

>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair]	Back alignment and domain information

>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins	Back alignment and domain information

>TIGR02236 recomb_radA DNA repair and recombination protein RadA	Back alignment and domain information

>PLN02459 probable adenylate kinase	Back alignment and domain information

>PRK14530 adenylate kinase; Provisional	Back alignment and domain information

>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only]	Back alignment and domain information

>PRK00300 gmk guanylate kinase; Provisional	Back alignment and domain information

>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases	Back alignment and domain information

>PRK13765 ATP-dependent protease Lon; Provisional	Back alignment and domain information

>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein []	Back alignment and domain information

>PRK10646 ADP-binding protein; Provisional	Back alignment and domain information

>PLN02200 adenylate kinase family protein	Back alignment and domain information

>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>PF13521 AAA_28: AAA domain; PDB: 1LW7_A	Back alignment and domain information

>cd00984 DnaB_C DnaB helicase C terminal domain	Back alignment and domain information

>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane	Back alignment and domain information

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK09519 recA DNA recombination protein RecA; Reviewed	Back alignment and domain information

>PRK09280 F0F1 ATP synthase subunit beta; Validated	Back alignment and domain information

>TIGR00073 hypB hydrogenase accessory protein HypB	Back alignment and domain information

>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PRK13946 shikimate kinase; Provisional	Back alignment and domain information

>TIGR00041 DTMP_kinase thymidylate kinase	Back alignment and domain information

>smart00072 GuKc Guanylate kinase homologues	Back alignment and domain information

>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis	Back alignment and domain information

>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity	Back alignment and domain information

>PRK13768 GTPase; Provisional	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK12597 F0F1 ATP synthase subunit beta; Provisional	Back alignment and domain information

>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily	Back alignment and domain information

>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB	Back alignment and domain information

>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional	Back alignment and domain information

>PRK13975 thymidylate kinase; Provisional	Back alignment and domain information

>PRK10078 ribose 1,5-bisphosphokinase; Provisional	Back alignment and domain information

>PRK10436 hypothetical protein; Provisional	Back alignment and domain information

>PRK06761 hypothetical protein; Provisional	Back alignment and domain information

>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins	Back alignment and domain information

>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor	Back alignment and domain information

>TIGR01039 atpD ATP synthase, F1 beta subunit	Back alignment and domain information

>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR)	Back alignment and domain information

>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01287 nifH nitrogenase iron protein	Back alignment and domain information

>PRK05057 aroK shikimate kinase I; Reviewed	Back alignment and domain information

>TIGR01069 mutS2 MutS2 family protein	Back alignment and domain information

>PRK10875 recD exonuclease V subunit alpha; Provisional	Back alignment and domain information

>PRK10365 transcriptional regulatory protein ZraR; Provisional	Back alignment and domain information

>COG0802 Predicted ATPase or kinase [General function prediction only]	Back alignment and domain information

>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated	Back alignment and domain information

>cd01855 YqeH YqeH	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>smart00487 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB	Back alignment and domain information

>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family	Back alignment and domain information

>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4240 Predicted kinase [General function prediction only]	Back alignment and domain information

>PLN02318 phosphoribulokinase/uridine kinase	Back alignment and domain information

>TIGR00554 panK_bact pantothenate kinase, bacterial type	Back alignment and domain information

>cd03114 ArgK-like The function of this protein family is unkown	Back alignment and domain information

>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK04182 cytidylate kinase; Provisional	Back alignment and domain information

>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase	Back alignment and domain information

>PHA02530 pseT polynucleotide kinase; Provisional	Back alignment and domain information

>TIGR02173 cyt_kin_arch cytidylate kinase, putative	Back alignment and domain information

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases	Back alignment and domain information

Homologous Structure Templates