Citrus Sinensis ID: 042750


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------
MDLVSKHMIHASQALPPIRSPSNSIFGSRSSHNSDTSFPVIAIAIVGILATGFLLVSYYIFVIKCCLNWHRIDILRRFSLSRNRRNLEHLIAHSPALETRGLDEAVIRAIPIFQFKKKASRDFGERSFCECAVCLNEFQENEKLRIIPNCGHVFHIDCIDVWLQSNANCPLCRTSISSTTTTPTTFLPFDRIIAPSSTPQDPSPYTENVINSDEDFVVIELGNHHSTDQTLLATQERLNSGELSGHSISPSPRKLDQRFVHKRARKLHKPIRRSFSMDSSADPKLYLAIQEAVQQKRQVTEASPIEGCSSRSKRFFFNFGHGSRGSRSAVLPVYSEP
cccccHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccccccccccccccccccccccccccccHHHHHHccEEEEcccccccccccccccccEEccccccccEEccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccc
ccHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHccEEEEEcccccccccccccEEEEEEccccccccEEEcccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccEEEEEEccccccccccccccccccccccccEEEEEcccccccccEEEEcccccc
MDLVSKHmihasqalppirspsnsifgsrsshnsdtsfpVIAIAIVGILATGFLLVSYYIFVIKCCLNWHRIDILRRFSLSRNRRNLEHLIahspaletrgldeAVIRAIpifqfkkkasrdfgersfCECAVCLNEfqeneklriipncghvfhIDCIDVWlqsnancplcrtsissttttpttflpfdriiapsstpqdpspytenvinsdeDFVVIELgnhhstdqtLLATQErlnsgelsghsispsprklDQRFVHKRARKLHkpirrsfsmdssadpKLYLAIQEAVQQKRqvteaspiegcssrskrfffnfghgsrgsrsavlpvysep
MDLVSKHMIhasqalppirspsNSIFGSRSSHNSDTSFPVIAIAIVGILATGFLLVSYYIFVIKCCLNWHRIDILRRFSLSRNRRNLEHLiahspaletrgldEAVIRAIPIFQFKKKASRDFGERSFCECAVCLNEFQENEKLRIIPNCGHVFHIDCIDVWLQSNANCPLCRTSISSTTTTPTTFLPFDRIIAPSSTPQDPSPYTENVINSDEDFVVIELGNHHSTDQTLLATQERLNSGElsghsispsprkldqrFVHKRarklhkpirrsfsmdssaDPKLYLAIQEAVQQKRQVteaspiegcssrSKRFFFnfghgsrgsrsavlpvysep
MDLVSKHMIHASQALPPIRSPSNSIFGSRSSHNSDTSFPVIAIAIVGILATGFLLVSYYIFVIKCCLNWHRIDIlrrfslsrnrrnlEHLIAHSPALETRGLDEAVIRAIPIFQFKKKASRDFGERSFCECAVCLNEFQENEKLRIIPNCGHVFHIDCIDVWLQSNANCPLCRtsissttttpttFLPFDRIIAPSSTPQDPSPYTENVINSDEDFVVIELGNHHSTDQTLLATQERLNSGELSGHSISPSPRKLDQRFVHKRARKLHKPIRRSFSMDSSADPKLYLAIQEAVQQKRQVTEASPIEGCSSRSKRFFFNFGHGSRGSRSAVLPVYSEP
*************************************FPVIAIAIVGILATGFLLVSYYIFVIKCCLNWHRIDILRRFSLSRNRRNLEHLIAHSPALETRGLDEAVIRAIPIFQFKKKASRDFGERSFCECAVCLNEFQENEKLRIIPNCGHVFHIDCIDVWLQSNANCPLCR****************************************EDFVVIELGN**************************************************************YLAI*************************FFFNFG*****************
***VSKHMI******************************VIAIAIVGILATGFLLVSYYIFVIKCCLNWHR******************************LDEAVIRAIPIFQFKKK*******RSFCECAVCLNEFQENEKLRIIPNCGHVFHIDCIDVWLQSNANCPLCRTSIS*********************************************************************************************************************************************************LPVYS**
MDLVSKHMIHASQALPPIRSPSN***********DTSFPVIAIAIVGILATGFLLVSYYIFVIKCCLNWHRIDILRRFSLSRNRRNLEHLIAHSPALETRGLDEAVIRAIPIFQFKKKASRDFGERSFCECAVCLNEFQENEKLRIIPNCGHVFHIDCIDVWLQSNANCPLCRTSISSTTTTPTTFLPFDRIIAPSSTPQDPSPYTENVINSDEDFVVIELGNHHSTDQTLLATQERLNSGELSGHSISPSPRKLDQRFVHKRARKLHKPIRRSFSMDSSADPKLYLAIQEAV*************GCSSRSKRFFFNFGHGSRGSRSAVLPVYSEP
***********************************TSFPVIAIAIVGILATGFLLVSYYIFVIKCCLNWHR****************************RGLDEAVIRAIPIFQFKKKASRDFGERSFCECAVCLNEFQENEKLRIIPNCGHVFHIDCIDVWLQSNANCPLCRTSI*********************************************************************************RFVHKRARKLHKPIRRSFSMDSSADPKLYLAIQEA*******************SKRFFFNFGHGSRGSRSAV*******
oooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLVSKHMIHASQALPPIRSPSNSIFGSRSSHNSDTSFPVIAIAIVGILATGFLLVSYYIFVIKCCLNWHRIDILRRFSLSRNRRNLEHLIAHSPALETRGLDEAVIRAIPIFQFKKKASRDFGERSFCECAVCLNEFQENEKLRIIPNCGHVFHIDCIDVWLQSNANCPLCRTSISSTTTTPTTFLPFDRIIAPSSTPQDPSPYTENVINSDEDFVVIELGNHHSTDQTLLATQERLNSGELSGHSISPSPRKLDQRFVHKRARKLHKPIRRSFSMDSSADPKLYLAIQEAVQQKRQVTEASPIEGCSSRSKRFFFNFGHGSRGSRSAVLPVYSEP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query337 2.2.26 [Sep-21-2011]
Q9LSW9375 RING-H2 finger protein AT yes no 0.768 0.690 0.517 3e-80
P93823381 RING-H2 finger protein AT no no 0.884 0.782 0.476 9e-76
Q9LF64362 RING-H2 finger protein AT no no 0.382 0.356 0.384 2e-23
Q9SRQ8356 RING-H2 finger protein AT no no 0.501 0.474 0.325 3e-23
P0C041310 Putative RING-H2 finger p no no 0.480 0.522 0.365 1e-22
Q7XLY8383 E3 ubiquitin-protein liga no no 0.845 0.744 0.264 1e-21
Q84W40404 RING-H2 finger protein AT no no 0.418 0.349 0.346 2e-20
Q8L9T5304 RING-H2 finger protein AT no no 0.305 0.338 0.418 5e-20
Q8LFY8413 RING-H2 finger protein AT no no 0.525 0.428 0.341 7e-20
Q8W571323 RING-H2 finger protein AT no no 0.379 0.396 0.345 1e-19
>sp|Q9LSW9|ATL16_ARATH RING-H2 finger protein ATL16 OS=Arabidopsis thaliana GN=ATL16 PE=2 SV=1 Back     alignment and function desciption
 Score =  298 bits (764), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 162/313 (51%), Positives = 214/313 (68%), Gaps = 54/313 (17%)

Query: 31  SHNSDTSFPVIAIAIVGILATGFLLVSYYIFVIKCCLNWHRIDILRRFSLSRNRRNLEH- 89
           + ++ TSFP++A+A++GILAT FLLVSYY+FVIKCCLNWHRIDIL RFSLSR RRN +  
Sbjct: 27  ASSTGTSFPILAVAVIGILATAFLLVSYYVFVIKCCLNWHRIDILGRFSLSRRRRNDQDP 86

Query: 90  LIAHSPALETRGLDEAVIRAIPIFQFKKKASRDFG----------ERSFCECAVCLNEFQ 139
           L+ +SP L +RGLDE+VIRAIPIF+FKK+  ++ G          E+   EC+VCL+EFQ
Sbjct: 87  LMVYSPELRSRGLDESVIRAIPIFKFKKRYDQNDGVFTGEGEEEEEKRSQECSVCLSEFQ 146

Query: 140 ENEKLRIIPNCGHVFHIDCIDVWLQSNANCPLCRTSISSTTTTPTTFLPFDRIIAPSSTP 199
           + EKLRIIPNC H+FHIDCIDVWLQ+NANCPLCRT +S  T+ P      DR+ APS++P
Sbjct: 147 DEEKLRIIPNCSHLFHIDCIDVWLQNNANCPLCRTRVSCDTSFPP-----DRVSAPSTSP 201

Query: 200 QDPSPYTENVINSDEDFVVIELGNHHSTDQT------LLATQERLNSGEL----SGHSIS 249
           ++       ++  + ++VVIELG+   +D+       LL  QER NSG L    + +SIS
Sbjct: 202 ENLV-----MLRGENEYVVIELGSSIGSDRDSPRHGRLLTGQERSNSGYLLNENTQNSIS 256

Query: 250 PSPRKLDQRFVHKRARKLHK-----------------------PIRRSFSMDSSADPKLY 286
           PSP+KLD+  + ++ RKLHK                       PIRRS SMDSSAD +LY
Sbjct: 257 PSPKKLDRGGLPRKFRKLHKMTSMGDECIDIRRGKDEQFGSIQPIRRSISMDSSADRQLY 316

Query: 287 LAIQEAVQQKRQV 299
           LA+QEA+++ R+V
Sbjct: 317 LAVQEAIRKNREV 329





Arabidopsis thaliana (taxid: 3702)
>sp|P93823|ATL1_ARATH RING-H2 finger protein ATL1 OS=Arabidopsis thaliana GN=ATL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LF64|ATL52_ARATH RING-H2 finger protein ATL52 OS=Arabidopsis thaliana GN=ATL52 PE=2 SV=1 Back     alignment and function description
>sp|Q9SRQ8|ATL51_ARATH RING-H2 finger protein ATL51 OS=Arabidopsis thaliana GN=ATL51 PE=2 SV=2 Back     alignment and function description
>sp|P0C041|ATL53_ARATH Putative RING-H2 finger protein ATL53 OS=Arabidopsis thaliana GN=ATL53 PE=3 SV=2 Back     alignment and function description
>sp|Q7XLY8|ATL41_ORYSJ E3 ubiquitin-protein ligase Os04g0590900 OS=Oryza sativa subsp. japonica GN=Os04g0590900 PE=2 SV=2 Back     alignment and function description
>sp|Q84W40|ATL11_ARATH RING-H2 finger protein ATL11 OS=Arabidopsis thaliana GN=ATL11 PE=2 SV=2 Back     alignment and function description
>sp|Q8L9T5|ATL2_ARATH RING-H2 finger protein ATL2 OS=Arabidopsis thaliana GN=ATL2 PE=2 SV=2 Back     alignment and function description
>sp|Q8LFY8|ATL54_ARATH RING-H2 finger protein ATL54 OS=Arabidopsis thaliana GN=ATL54 PE=2 SV=2 Back     alignment and function description
>sp|Q8W571|ATL32_ARATH RING-H2 finger protein ATL32 OS=Arabidopsis thaliana GN=ATL32 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query337
224107873340 predicted protein [Populus trichocarpa] 0.910 0.902 0.693 1e-119
147775862419 hypothetical protein VITISV_043412 [Viti 0.979 0.787 0.668 1e-115
359477789359 PREDICTED: RING-H2 finger protein ATL16- 0.979 0.919 0.668 1e-114
255576814376 ring finger protein, putative [Ricinus c 0.979 0.877 0.637 1e-113
356533787367 PREDICTED: RING-H2 finger protein ATL16- 0.964 0.885 0.580 4e-92
356574754364 PREDICTED: RING-H2 finger protein ATL16- 0.964 0.892 0.579 4e-91
225437852351 PREDICTED: RING-H2 finger protein ATL1-l 0.925 0.888 0.510 1e-89
297795079379 hypothetical protein ARALYDRAFT_494656 [ 0.860 0.765 0.502 4e-80
297848660382 hypothetical protein ARALYDRAFT_887598 [ 0.875 0.772 0.484 1e-78
15239865375 RING-H2 finger protein ATL16 [Arabidopsi 0.768 0.690 0.517 2e-78
>gi|224107873|ref|XP_002314635.1| predicted protein [Populus trichocarpa] gi|222863675|gb|EEF00806.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  436 bits (1120), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 235/339 (69%), Positives = 271/339 (79%), Gaps = 32/339 (9%)

Query: 23  NSIFGSRSSHNSDTSFPVIAIAIVGILATGFLLVSYYIFVIKCCLNWHRIDILRRFSLSR 82
           +SIFG R+  +SDTSFP+IAIAI+GILAT  LLVSYYIFVIKCCLNWHRID+LRRFSLSR
Sbjct: 8   SSIFGPRT-QSSDTSFPIIAIAIIGILATALLLVSYYIFVIKCCLNWHRIDLLRRFSLSR 66

Query: 83  NRRNLEHLIAHSP-ALETRGLDEAVIRAIPIFQFKKKAS--RDFGERSFCECAVCLNEFQ 139
           NR + + L+A+SP A+E+RGLDE+VIR+IP+F+FKK+ +  R+ GERSFCECAVCLNEFQ
Sbjct: 67  NRNHEDPLMAYSPSAIESRGLDESVIRSIPVFKFKKEGNNVRNVGERSFCECAVCLNEFQ 126

Query: 140 ENEKLRIIPNCGHVFHIDCIDVWLQSNANCPLCRTSISSTTTTPTTFLPFDRIIAPSSTP 199
           E EKLR IPNC HVFHIDCIDVWLQSNANCPLCRTSISSTT       P D IIAPSSTP
Sbjct: 127 EAEKLRRIPNCSHVFHIDCIDVWLQSNANCPLCRTSISSTTR-----FPIDHIIAPSSTP 181

Query: 200 QDPSPYTENVINSDEDFVVIELGNHHSTDQTLLATQERLNSGELSGHSISPSPRKLDQRF 259
            D +PY+E+V+  DED+VVIEL NH+STDQTLLA QERLNSGELS  SISPSPRK++Q  
Sbjct: 182 HDANPYSESVMGGDEDYVVIELSNHNSTDQTLLAAQERLNSGELSARSISPSPRKIEQGV 241

Query: 260 VHKRARKLHK----------------------PIRRSFSMDSSADPKLYLAIQEAVQQKR 297
            HK+AR L+K                      PIRRSFSMDSSAD +LYL+IQE VQQ R
Sbjct: 242 GHKKARNLNKVTSMGDECIDTRGKDDQFGLIQPIRRSFSMDSSADRQLYLSIQEIVQQSR 301

Query: 298 QVTEASPIEGCSSRSKRFFFNFGHGSRGSRSAVLPVYSE 336
           QVTE S +EGCS R++R FF+FGHG RGSRS+VLPVY E
Sbjct: 302 QVTEVSSVEGCSGRARRAFFSFGHG-RGSRSSVLPVYLE 339




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147775862|emb|CAN69298.1| hypothetical protein VITISV_043412 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359477789|ref|XP_002281024.2| PREDICTED: RING-H2 finger protein ATL16-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255576814|ref|XP_002529293.1| ring finger protein, putative [Ricinus communis] gi|223531217|gb|EEF33062.1| ring finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356533787|ref|XP_003535440.1| PREDICTED: RING-H2 finger protein ATL16-like [Glycine max] Back     alignment and taxonomy information
>gi|356574754|ref|XP_003555510.1| PREDICTED: RING-H2 finger protein ATL16-like [Glycine max] Back     alignment and taxonomy information
>gi|225437852|ref|XP_002263905.1| PREDICTED: RING-H2 finger protein ATL1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297795079|ref|XP_002865424.1| hypothetical protein ARALYDRAFT_494656 [Arabidopsis lyrata subsp. lyrata] gi|297311259|gb|EFH41683.1| hypothetical protein ARALYDRAFT_494656 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|297848660|ref|XP_002892211.1| hypothetical protein ARALYDRAFT_887598 [Arabidopsis lyrata subsp. lyrata] gi|297338053|gb|EFH68470.1| hypothetical protein ARALYDRAFT_887598 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15239865|ref|NP_199155.1| RING-H2 finger protein ATL16 [Arabidopsis thaliana] gi|68565310|sp|Q9LSW9.1|ATL16_ARATH RecName: Full=RING-H2 finger protein ATL16 gi|8843895|dbj|BAA97421.1| unnamed protein product [Arabidopsis thaliana] gi|30725342|gb|AAP37693.1| At5g43420 [Arabidopsis thaliana] gi|110736470|dbj|BAF00203.1| hypothetical protein [Arabidopsis thaliana] gi|332007576|gb|AED94959.1| RING-H2 finger protein ATL16 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query337
TAIR|locus:2176436375 AT5G43420 [Arabidopsis thalian 0.756 0.68 0.475 2.5e-75
TAIR|locus:2018334381 AT1G04360 [Arabidopsis thalian 0.768 0.679 0.477 8.6e-73
TAIR|locus:2151421362 AT5G17600 [Arabidopsis thalian 0.439 0.408 0.381 4e-26
TAIR|locus:2096444356 AT3G03550 [Arabidopsis thalian 0.578 0.547 0.310 1.4e-23
UNIPROTKB|Q7XLY8383 LOC_Os04g50100 "E3 ubiquitin-p 0.866 0.762 0.272 3.4e-22
TAIR|locus:4515103413310 ATL4H [Arabidopsis thaliana (t 0.409 0.445 0.397 1.1e-21
TAIR|locus:2199902369 AT1G23980 [Arabidopsis thalian 0.477 0.436 0.346 6.1e-20
TAIR|locus:2207066413 AT1G72220 [Arabidopsis thalian 0.454 0.370 0.359 9.3e-20
TAIR|locus:2081907334 ATL4 "TOXICOS EN LEVADURA 4" [ 0.439 0.443 0.35 1.9e-19
TAIR|locus:2097890349 AT3G48030 "AT3G48030" [Arabido 0.477 0.461 0.341 2.2e-19
TAIR|locus:2176436 AT5G43420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 609 (219.4 bits), Expect = 2.5e-75, Sum P(2) = 2.5e-75
 Identities = 138/290 (47%), Positives = 183/290 (63%)

Query:     1 MDLVSKHMIHASQALPPIRSPSNSIFGSRSSHNSDTSFPVIAIAIVGILATGFLLVSYYI 60
             MDL ++       + PP   P   IF   SS  + TSFP++A+A++GILAT FLLVSYY+
Sbjct:     1 MDLSNRRNPLRDLSFPP--PPPPPIFHRASS--TGTSFPILAVAVIGILATAFLLVSYYV 56

Query:    61 FVIKCCLNWHRIDIXXXXXXXXXXXXXEH-LIAHSPALETRGLDEAVIRAIPIFQFKKKA 119
             FVIKCCLNWHRIDI             +  L+ +SP L +RGLDE+VIRAIPIF+FKK+ 
Sbjct:    57 FVIKCCLNWHRIDILGRFSLSRRRRNDQDPLMVYSPELRSRGLDESVIRAIPIFKFKKRY 116

Query:   120 SRDFG----------ERSFCECAVCLNEFQENEKLRIIPNCGHVFHIDCIDVWLQSNANC 169
              ++ G          E+   EC+VCL+EFQ+ EKLRIIPNC H+FHIDCIDVWLQ+NANC
Sbjct:   117 DQNDGVFTGEGEEEEEKRSQECSVCLSEFQDEEKLRIIPNCSHLFHIDCIDVWLQNNANC 176

Query:   170 PLCRXXXXXXXXXXXXFLPFDRIIAPSSTPQDPSPYTENVINSDEDFVVIELGNHHSTDQ 229
             PLCR              P DR+ APS++P++       ++  + ++VVIELG+   +D+
Sbjct:   177 PLCRTRVSCDTS-----FPPDRVSAPSTSPENLV-----MLRGENEYVVIELGSSIGSDR 226

Query:   230 T------LLATQERLNSGEL----SGHSISPSPRKLDQRFVHKRARKLHK 269
                    LL  QER NSG L    + +SISPSP+KLD+  + ++ RKLHK
Sbjct:   227 DSPRHGRLLTGQERSNSGYLLNENTQNSISPSPKKLDRGGLPRKFRKLHK 276


GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
TAIR|locus:2018334 AT1G04360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151421 AT5G17600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096444 AT3G03550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q7XLY8 LOC_Os04g50100 "E3 ubiquitin-protein ligase Os04g0590900" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:4515103413 ATL4H [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199902 AT1G23980 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2207066 AT1G72220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081907 ATL4 "TOXICOS EN LEVADURA 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097890 AT3G48030 "AT3G48030" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LSW9ATL16_ARATHNo assigned EC number0.51750.76850.6906yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_X000673
hypothetical protein (340 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query337
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 5e-16
cd0016245 cd00162, RING, RING-finger (Really Interesting New 1e-12
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 1e-10
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 3e-10
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 7e-10
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 1e-08
smart0018440 smart00184, RING, Ring finger 3e-08
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 8e-07
COG5243491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 2e-05
pfam1179370 pfam11793, FANCL_C, FANCL C-terminal domain 1e-04
COG52191525 COG5219, COG5219, Uncharacterized conserved protei 1e-04
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 1e-04
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 2e-04
PHA02926242 PHA02926, PHA02926, zinc finger-like protein; Prov 4e-04
pfam05883135 pfam05883, Baculo_RING, Baculovirus U-box/Ring-lik 4e-04
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 7e-04
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
 Score = 70.5 bits (173), Expect = 5e-16
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 1/46 (2%)

Query: 130 ECAVCLNEFQENEKLRIIPNCGHVFHIDCIDVWLQSNANCPLCRTS 175
           EC +CL+EF+  E++ ++P CGHVFH +C+D WL+S+  CPLCR  
Sbjct: 2   ECPICLDEFEPGEEVVVLP-CGHVFHKECLDKWLRSSNTCPLCRAP 46


Length = 46

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|204746 pfam11793, FANCL_C, FANCL C-terminal domain Back     alignment and domain information
>gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|165237 PHA02926, PHA02926, zinc finger-like protein; Provisional Back     alignment and domain information
>gnl|CDD|218794 pfam05883, Baculo_RING, Baculovirus U-box/Ring-like domain Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 337
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.77
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.46
PHA02929238 N1R/p28-like protein; Provisional 99.31
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.26
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.22
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.17
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.97
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.87
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.84
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.84
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.8
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.78
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.76
PHA02926242 zinc finger-like protein; Provisional 98.73
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.64
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 98.63
PF1463444 zf-RING_5: zinc-RING finger domain 98.58
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.54
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.54
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.48
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.46
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.42
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.35
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.31
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.23
COG52191525 Uncharacterized conserved protein, contains RING Z 98.18
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.14
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 98.12
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.11
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.11
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.09
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.97
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.93
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.89
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.88
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.84
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.83
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.8
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.8
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.79
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.72
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.63
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.57
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.49
KOG4445368 consensus Uncharacterized conserved protein, conta 97.47
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.44
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.3
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 97.22
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.11
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.11
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 96.81
KOG1941518 consensus Acetylcholine receptor-associated protei 96.58
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 96.57
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 96.56
KOG3970299 consensus Predicted E3 ubiquitin ligase [Posttrans 96.49
KOG0297 391 consensus TNF receptor-associated factor [Signal t 96.37
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 96.32
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 96.23
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.16
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 96.12
KOG1002791 consensus Nucleotide excision repair protein RAD16 96.0
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 95.89
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 95.74
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 95.64
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 95.54
KOG2660 331 consensus Locus-specific chromosome binding protei 95.54
PHA03096284 p28-like protein; Provisional 95.48
PHA02862156 5L protein; Provisional 95.33
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 95.22
COG5152259 Uncharacterized conserved protein, contains RING a 95.22
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 95.06
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 94.97
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 94.86
KOG4739233 consensus Uncharacterized protein involved in syna 94.68
KOG3039303 consensus Uncharacterized conserved protein [Funct 94.56
PHA02825162 LAP/PHD finger-like protein; Provisional 94.54
COG5222427 Uncharacterized conserved protein, contains RING Z 94.01
PF04641260 Rtf2: Rtf2 RING-finger 93.93
COG5236 493 Uncharacterized conserved protein, contains RING Z 93.72
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 93.68
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 93.64
KOG1940276 consensus Zn-finger protein [General function pred 93.04
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 92.92
KOG0827465 consensus Predicted E3 ubiquitin ligase [Posttrans 92.9
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 92.53
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 92.52
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 92.46
KOG2932389 consensus E3 ubiquitin ligase involved in ubiquiti 92.1
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 91.61
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 91.4
KOG03091081 consensus Conserved WD40 repeat-containing protein 91.3
COG5175 480 MOT2 Transcriptional repressor [Transcription] 89.94
KOG1001674 consensus Helicase-like transcription factor HLTF/ 89.76
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 88.54
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 88.35
KOG02981394 consensus DEAD box-containing helicase-like transc 87.96
PF0170891 Gemini_mov: Geminivirus putative movement protein 86.52
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 86.51
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 86.2
PF10272358 Tmpp129: Putative transmembrane protein precursor; 84.33
KOG1609323 consensus Protein involved in mRNA turnover and st 82.23
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 81.79
KOG3800300 consensus Predicted E3 ubiquitin ligase containing 81.59
COG5220314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 81.11
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.77  E-value=1.9e-18  Score=167.17  Aligned_cols=78  Identities=35%  Similarity=0.905  Sum_probs=66.1

Q ss_pred             cCCCCHHHHHhCCceeeccccccccCCCCCCcccccccccccCceeEecCCCCccccHHhHHHHHhcCCC-CCcccccCC
Q 042750           99 TRGLDEAVIRAIPIFQFKKKASRDFGERSFCECAVCLNEFQENEKLRIIPNCGHVFHIDCIDVWLQSNAN-CPLCRTSIS  177 (337)
Q Consensus        99 ~~gl~~~~i~~lP~~~~~~~~~~~~~~~~~~~C~ICl~~~~~~~~~~~lp~C~H~FH~~Ci~~Wl~~~~~-CPlCR~~l~  177 (337)
                      ...+.+..++++|..+|......+   . ...|+||||+|..|+++++|| |+|.||..||+.||..+.+ ||+||+++.
T Consensus       204 ~~r~~k~~l~~~p~~~f~~~~~~~---~-~~~CaIClEdY~~GdklRiLP-C~H~FH~~CIDpWL~~~r~~CPvCK~di~  278 (348)
T KOG4628|consen  204 RNRLIKRLLKKLPVRTFTKGDDED---A-TDTCAICLEDYEKGDKLRILP-CSHKFHVNCIDPWLTQTRTFCPVCKRDIR  278 (348)
T ss_pred             hhhhHHHHHhhCCcEEeccccccC---C-CceEEEeecccccCCeeeEec-CCCchhhccchhhHhhcCccCCCCCCcCC
Confidence            345778899999999999986222   1 168999999999999999999 9999999999999988755 999999886


Q ss_pred             CCCC
Q 042750          178 STTT  181 (337)
Q Consensus       178 ~~~~  181 (337)
                      ....
T Consensus       279 ~~~~  282 (348)
T KOG4628|consen  279 TDSG  282 (348)
T ss_pred             CCCC
Confidence            6543



>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PF01708 Gemini_mov: Geminivirus putative movement protein ; InterPro: IPR002621 This family consists of putative movement proteins from Maize streak virus and Wheat dwarf virus [] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query337
1iym_A55 Ring-H2 Finger Domain Of El5 Length = 55 1e-12
1x4j_A75 Solution Structure Of Ring Finger In Ring Finger Pr 1e-07
2kiz_A69 Solution Structure Of Arkadia Ring-H2 Finger Domain 4e-06
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 8e-06
2ep4_A74 Solution Structure Of Ring Finger From Human Ring F 9e-05
2l0b_A91 Solution Nmr Structure Of Zinc Finger Domain Of E3 1e-04
>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 Back     alignment and structure

Iteration: 1

Score = 70.9 bits (172), Expect = 1e-12, Method: Composition-based stats. Identities = 25/44 (56%), Positives = 34/44 (77%) Query: 130 ECAVCLNEFQENEKLRIIPNCGHVFHIDCIDVWLQSNANCPLCR 173 ECAVCL E ++ E+ R +P CGH FH +C+D+WL S++ CPLCR Sbjct: 7 ECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCR 50
>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 Back     alignment and structure
>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 Back     alignment and structure
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure
>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 Back     alignment and structure
>pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query337
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 1e-29
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 1e-27
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 7e-24
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 7e-24
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 4e-21
2ect_A78 Ring finger protein 126; metal binding protein, st 9e-20
2ecm_A55 Ring finger and CHY zinc finger domain- containing 2e-19
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 8e-18
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 7e-17
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 9e-16
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 7e-14
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 5e-13
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 7e-13
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 2e-12
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 4e-12
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 2e-11
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 3e-10
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 8e-10
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 2e-09
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 3e-09
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 4e-09
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 7e-09
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 2e-08
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 2e-08
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 2e-07
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 3e-08
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 3e-08
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 1e-07
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 2e-07
3nw0_A238 Non-structural maintenance of chromosomes element 1e-06
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 6e-06
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 6e-06
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 7e-06
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 9e-06
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 9e-06
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 1e-05
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 2e-05
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 3e-05
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 6e-05
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 2e-04
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 2e-04
1z6u_A150 NP95-like ring finger protein isoform B; structura 2e-04
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 3e-04
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 7e-04
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 8e-04
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 9e-04
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
 Score =  107 bits (269), Expect = 1e-29
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 105 AVIRAIPIFQFKKKASRDFGERSFCECAVCLNEFQENEKLRIIPNCGHVFHIDCIDVWLQ 164
                +P ++F         +     C VC+ +F+  + LR++P C H FH  C+D WL+
Sbjct: 4   GSSGQLPSYRFNPNN----HQSEQTLCVVCMCDFESRQLLRVLP-CNHEFHAKCVDKWLK 58

Query: 165 SNANCPLCRTSISSTT 180
           +N  CP+CR     ++
Sbjct: 59  ANRTCPICRADSGPSS 74


>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query337
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.66
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.59
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.49
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.47
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.46
2ect_A78 Ring finger protein 126; metal binding protein, st 99.45
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.42
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.37
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.34
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.33
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.31
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.3
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.29
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.26
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.25
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.24
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.21
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.2
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.2
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.18
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.14
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.13
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.12
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.11
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.1
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.08
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.05
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.05
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.03
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.02
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.02
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.02
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.99
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.98
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.97
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.96
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.96
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.94
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.94
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.93
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.93
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.88
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.84
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.81
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.8
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.78
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.78
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.76
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.75
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.73
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.73
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.72
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.7
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.68
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.67
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.65
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.62
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.61
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.51
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.51
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.46
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.46
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.45
2ea5_A68 Cell growth regulator with ring finger domain prot 98.43
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.39
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.32
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.27
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.11
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.1
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.06
3nw0_A238 Non-structural maintenance of chromosomes element 97.91
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.79
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 95.34
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 93.32
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 90.94
1wil_A89 KIAA1045 protein; ring finger domain, structural g 85.77
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 85.05
1we9_A64 PHD finger family protein; structural genomics, PH 83.94
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 83.84
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 81.47
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 80.34
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.66  E-value=1.1e-16  Score=126.43  Aligned_cols=79  Identities=24%  Similarity=0.603  Sum_probs=68.7

Q ss_pred             chhcCCCCHHHHHhCCceeeccccccccCCCCCCcccccccccccCceeEecCCCCccccHHhHHHHHhcCCCCCccccc
Q 042750           96 ALETRGLDEAVIRAIPIFQFKKKASRDFGERSFCECAVCLNEFQENEKLRIIPNCGHVFHIDCIDVWLQSNANCPLCRTS  175 (337)
Q Consensus        96 ~~~~~gl~~~~i~~lP~~~~~~~~~~~~~~~~~~~C~ICl~~~~~~~~~~~lp~C~H~FH~~Ci~~Wl~~~~~CPlCR~~  175 (337)
                      .....|++++.|+.||.+++....   .....+..|+||++.|..++.++.+| |+|.||..||..|+..+.+||+||..
T Consensus        11 ~~~~~~~s~~~i~~lp~~~~~~~~---~~~~~~~~C~IC~~~~~~~~~~~~l~-C~H~Fh~~Ci~~wl~~~~~CP~Cr~~   86 (91)
T 2l0b_A           11 MVANPPASKESIDALPEILVTEDH---GAVGQEMCCPICCSEYVKGDVATELP-CHHYFHKPCVSIWLQKSGTCPVCRCM   86 (91)
T ss_dssp             SSCCCCCCHHHHHTSCEEECCTTC---SSSSSCSEETTTTEECCTTCEEEEET-TTEEEEHHHHHHHHTTTCBCTTTCCB
T ss_pred             CcCCCCCCHHHHHhCCCeeecccc---cccCCCCCCcccChhhcCCCcEEecC-CCChHHHHHHHHHHHcCCcCcCcCcc
Confidence            446789999999999999987764   22345678999999999999999998 99999999999999999999999998


Q ss_pred             CCC
Q 042750          176 ISS  178 (337)
Q Consensus       176 l~~  178 (337)
                      +..
T Consensus        87 ~~~   89 (91)
T 2l0b_A           87 FPP   89 (91)
T ss_dssp             SSC
T ss_pred             CCC
Confidence            853



>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 337
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 3e-20
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 1e-14
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 7e-12
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 1e-11
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 5e-11
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 6e-11
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 1e-10
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 3e-08
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 3e-08
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 4e-08
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 7e-07
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 3e-06
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 2e-05
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 3e-05
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 0.002
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 0.003
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
 Score = 80.7 bits (199), Expect = 3e-20
 Identities = 25/47 (53%), Positives = 36/47 (76%)

Query: 130 ECAVCLNEFQENEKLRIIPNCGHVFHIDCIDVWLQSNANCPLCRTSI 176
           ECAVCL E ++ E+ R +P CGH FH +C+D+WL S++ CPLCR ++
Sbjct: 7   ECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTV 53


>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query337
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.63
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.41
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.35
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.35
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.33
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.27
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.26
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.13
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.03
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.99
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.95
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.92
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.8
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.74
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.71
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.6
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.44
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 89.51
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 88.87
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 80.97
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 80.56
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.63  E-value=6.3e-17  Score=115.13  Aligned_cols=50  Identities=50%  Similarity=1.210  Sum_probs=46.2

Q ss_pred             CCcccccccccccCceeEecCCCCccccHHhHHHHHhcCCCCCcccccCC
Q 042750          128 FCECAVCLNEFQENEKLRIIPNCGHVFHIDCIDVWLQSNANCPLCRTSIS  177 (337)
Q Consensus       128 ~~~C~ICl~~~~~~~~~~~lp~C~H~FH~~Ci~~Wl~~~~~CPlCR~~l~  177 (337)
                      +.+|+||+++|..++.+..++.|+|.||..||.+|++.+.+||+||++|.
T Consensus         5 ~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~   54 (55)
T d1iyma_           5 GVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV   54 (55)
T ss_dssp             SCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred             CCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence            46799999999999999888779999999999999999999999999874



>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure