Citrus Sinensis ID: 042807
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 343 | ||||||
| 224080213 | 209 | predicted protein [Populus trichocarpa] | 0.609 | 1.0 | 0.722 | 9e-87 | |
| 225451723 | 439 | PREDICTED: uncharacterized protein LOC10 | 0.644 | 0.503 | 0.585 | 5e-85 | |
| 255547163 | 576 | conserved hypothetical protein [Ricinus | 0.839 | 0.5 | 0.508 | 9e-80 | |
| 255573416 | 340 | conserved hypothetical protein [Ricinus | 0.714 | 0.720 | 0.636 | 2e-78 | |
| 388490814 | 272 | unknown [Medicago truncatula] | 0.629 | 0.794 | 0.596 | 3e-77 | |
| 225456581 | 652 | PREDICTED: uncharacterized protein LOC10 | 0.696 | 0.366 | 0.585 | 3e-76 | |
| 297818666 | 379 | predicted protein [Arabidopsis lyrata su | 0.597 | 0.540 | 0.621 | 4e-76 | |
| 296082211 | 223 | unnamed protein product [Vitis vinifera] | 0.524 | 0.807 | 0.699 | 7e-74 | |
| 11994485 | 559 | unnamed protein product [Arabidopsis tha | 0.568 | 0.348 | 0.594 | 2e-73 | |
| 449441105 | 593 | PREDICTED: uncharacterized protein LOC10 | 0.626 | 0.362 | 0.590 | 7e-73 |
| >gi|224080213|ref|XP_002306055.1| predicted protein [Populus trichocarpa] gi|222849019|gb|EEE86566.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 326 bits (836), Expect = 9e-87, Method: Compositional matrix adjust.
Identities = 151/209 (72%), Positives = 177/209 (84%)
Query: 124 RKKLLVLDLNGLLADIVSPPPKDCKADKKIARHAVFKRPFCHDFLRFCFERFDVGVWSSR 183
RKKLL+LD+NG+L DIVS PPK AD KIA+ AVF+RPFC DFL+FCFERF+VGVWSSR
Sbjct: 1 RKKLLILDINGVLVDIVSAPPKGHIADIKIAKKAVFRRPFCFDFLKFCFERFEVGVWSSR 60
Query: 184 TQKNVERVVDFLMGDMKHKLLFCWDLSYCTATSFKALENKYKALVFKELRKVWEISDPNC 243
T+KNV+RVV+F+MGDMK KLLFCWDLS CTAT F LENK+K LVFKELR++WE D
Sbjct: 61 TRKNVDRVVEFVMGDMKKKLLFCWDLSKCTATQFCTLENKHKPLVFKELRRIWEKDDSEL 120
Query: 244 PWAKGDYNESNTVLLDDSPYKALLNPPYTAIFPCSYKYQNPSDNSLGAGGDLRVYLEMLA 303
PW KGDY+ESNT+LLDDSPYKALLNP +TAIFP Y++QN +DNSLGAGGDLRVYLE LA
Sbjct: 121 PWEKGDYSESNTMLLDDSPYKALLNPAHTAIFPYPYQFQNSNDNSLGAGGDLRVYLEELA 180
Query: 304 EAENVQRFIQHNPFGQSAITNRSEYWAFY 332
A+NVQ F++H+PFGQ AI+ RS W F+
Sbjct: 181 AADNVQEFVEHHPFGQRAISQRSPNWGFF 209
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225451723|ref|XP_002276922.1| PREDICTED: uncharacterized protein LOC100244680 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255547163|ref|XP_002514639.1| conserved hypothetical protein [Ricinus communis] gi|223546243|gb|EEF47745.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255573416|ref|XP_002527634.1| conserved hypothetical protein [Ricinus communis] gi|223533008|gb|EEF34773.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|388490814|gb|AFK33473.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|225456581|ref|XP_002265588.1| PREDICTED: uncharacterized protein LOC100263840 [Vitis vinifera] gi|297734071|emb|CBI15318.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297818666|ref|XP_002877216.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297323054|gb|EFH53475.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|296082211|emb|CBI21216.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|11994485|dbj|BAB02526.1| unnamed protein product [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449441105|ref|XP_004138324.1| PREDICTED: uncharacterized protein LOC101219396 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 343 | ||||||
| TAIR|locus:2091823 | 465 | AT3G29760 "AT3G29760" [Arabido | 0.399 | 0.294 | 0.652 | 7.7e-52 | |
| TAIR|locus:2044862 | 249 | AT2G36540 "AT2G36540" [Arabido | 0.329 | 0.453 | 0.446 | 3.9e-21 | |
| POMBASE|SPBC1271.03c | 244 | SPBC1271.03c "NLI interacting | 0.431 | 0.606 | 0.292 | 7.7e-09 | |
| UNIPROTKB|Q0BYG6 | 197 | HNE_2798 "Phosphoprotein phosp | 0.466 | 0.812 | 0.292 | 1.1e-08 | |
| UNIPROTKB|G4MNF1 | 485 | MGG_06937 "NIF domain-containi | 0.451 | 0.319 | 0.287 | 1.3e-06 | |
| ASPGD|ASPL0000001456 | 619 | AN6562 [Emericella nidulans (t | 0.419 | 0.232 | 0.295 | 8.9e-05 |
| TAIR|locus:2091823 AT3G29760 "AT3G29760" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 512 (185.3 bits), Expect = 7.7e-52, Sum P(2) = 7.7e-52
Identities = 90/138 (65%), Positives = 110/138 (79%)
Query: 137 ADIVSPPPKDCKADKKIARHAVFKRPFCHDFLRFCFERFDVGVWSSRTQKNVERVVDFLM 196
ADIV+P KD AD I R A+FKRPFC +FLRFCF++F+VG+WSSR Q NV R+ +FL+
Sbjct: 318 ADIVTPL-KDVPADINIGRRAIFKRPFCDEFLRFCFDKFEVGIWSSRKQNNVVRITEFLL 376
Query: 197 GDMKHKLLFCWDLSYCTATSFKALENKYKALVFKELRKVWEISDPNCPWAKGDYNESNTV 256
GD+K KLLFCWD+SYC TS +LEN+YK +VFK+L ++WE DP PW GDYNE+NTV
Sbjct: 377 GDLKSKLLFCWDMSYCATTSVGSLENRYKYVVFKDLNRLWEKHDPRLPWKMGDYNETNTV 436
Query: 257 LLDDSPYKALLNPPYTAI 274
LLDDSPYKALLNP Y+ I
Sbjct: 437 LLDDSPYKALLNPQYSLI 454
|
|
| TAIR|locus:2044862 AT2G36540 "AT2G36540" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC1271.03c SPBC1271.03c "NLI interacting factor family phosphatase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0BYG6 HNE_2798 "Phosphoprotein phosphatase" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4MNF1 MGG_06937 "NIF domain-containing protein" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000001456 AN6562 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 343 | |||
| pfam03031 | 153 | pfam03031, NIF, NLI interacting factor-like phosph | 4e-18 | |
| smart00577 | 148 | smart00577, CPDc, catalytic domain of ctd-like pho | 2e-13 | |
| TIGR02251 | 162 | TIGR02251, HIF-SF_euk, Dullard-like phosphatase do | 8e-07 | |
| TIGR02245 | 195 | TIGR02245, HAD_IIID1, HAD-superfamily subfamily II | 4e-06 |
| >gnl|CDD|217328 pfam03031, NIF, NLI interacting factor-like phosphatase | Back alignment and domain information |
|---|
Score = 80.0 bits (198), Expect = 4e-18
Identities = 39/192 (20%), Positives = 72/192 (37%), Gaps = 47/192 (24%)
Query: 126 KLLVLDLNGLLADIVSPPPKDCKADKKIARHA-VFKRPFCHDFLRFCFERFDVGVWSSRT 184
K LVLDL+ L P V KRP +FL+ + +++ ++++ +
Sbjct: 1 KTLVLDLDETLVHSSFEPDLPFDFVLNFNHGVYVKKRPGLDEFLQELSKYYEIVIFTASS 60
Query: 185 QKNVERVVDFLM--GDMKHKLLF---CWDLSYCTATSFKALENKYKALVFKELRKVWEIS 239
++ + V+D L L+ C K+L +
Sbjct: 61 KEYADPVLDKLDPKKKYFKHRLYRESCT-------------------FYVKDLSLLGR-- 99
Query: 240 DPNCPWAKGDYNESNTVLLDDSPYKALLNPPYTAIFPCSYKYQNPSDNSLGAGGDLRV-- 297
+ S V++D+SP LL P P + Y +P D L L++
Sbjct: 100 -----------DLSRVVIVDNSPRSFLLQPDNGIPIP-PF-YGDPDDTEL-----LKLLP 141
Query: 298 YLEMLAEAENVQ 309
+L+ LA+ ++V+
Sbjct: 142 FLKELAKVDDVR 153
|
This family contains a number of NLI interacting factor isoforms and also an N-terminal regions of RNA polymerase II CTC phosphatase and FCP1 serine phosphatase. This region has been identified as the minimal phosphatase domain. Length = 153 |
| >gnl|CDD|214729 smart00577, CPDc, catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >gnl|CDD|233801 TIGR02251, HIF-SF_euk, Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|131299 TIGR02245, HAD_IIID1, HAD-superfamily subfamily IIID hydrolase, TIGR02245 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 343 | |||
| TIGR02245 | 195 | HAD_IIID1 HAD-superfamily subfamily IIID hydrolase | 100.0 | |
| KOG1605 | 262 | consensus TFIIF-interacting CTD phosphatase, inclu | 100.0 | |
| PF03031 | 159 | NIF: NLI interacting factor-like phosphatase; Inte | 100.0 | |
| TIGR02251 | 162 | HIF-SF_euk Dullard-like phosphatase domain. This d | 100.0 | |
| TIGR02250 | 156 | FCP1_euk FCP1-like phosphatase, phosphatase domain | 99.93 | |
| KOG2832 | 393 | consensus TFIIF-interacting CTD phosphatase, inclu | 99.93 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 99.87 | |
| COG5190 | 390 | FCP1 TFIIF-interacting CTD phosphatases, including | 99.84 | |
| KOG0323 | 635 | consensus TFIIF-interacting CTD phosphatases, incl | 99.33 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 97.69 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 97.55 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 97.52 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 97.34 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 97.24 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 97.17 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 96.73 | |
| PF12689 | 169 | Acid_PPase: Acid Phosphatase; InterPro: IPR010036 | 96.72 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 96.68 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 96.57 | |
| PF05152 | 297 | DUF705: Protein of unknown function (DUF705); Inte | 96.55 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 96.33 | |
| COG5190 | 390 | FCP1 TFIIF-interacting CTD phosphatases, including | 95.92 | |
| TIGR01689 | 126 | EcbF-BcbF capsule biosynthesis phosphatase. Due to | 95.86 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 95.77 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 95.42 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 95.26 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 95.19 | |
| PF08645 | 159 | PNK3P: Polynucleotide kinase 3 phosphatase; InterP | 94.96 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 94.9 | |
| PLN02954 | 224 | phosphoserine phosphatase | 94.39 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 94.39 | |
| KOG1872 | 473 | consensus Ubiquitin-specific protease [Posttransla | 93.62 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 93.27 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 93.21 | |
| PRK06769 | 173 | hypothetical protein; Validated | 93.13 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 93.06 | |
| PRK10187 | 266 | trehalose-6-phosphate phosphatase; Provisional | 92.87 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 92.86 | |
| COG4996 | 164 | Predicted phosphatase [General function prediction | 92.61 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 92.4 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 92.39 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 92.32 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 91.66 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 91.59 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 91.48 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 91.46 | |
| PF13344 | 101 | Hydrolase_6: Haloacid dehalogenase-like hydrolase; | 91.41 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 91.4 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 91.4 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 91.19 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 91.07 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 91.03 | |
| PRK08238 | 479 | hypothetical protein; Validated | 91.03 | |
| COG3882 | 574 | FkbH Predicted enzyme involved in methoxymalonyl-A | 90.78 | |
| PTZ00445 | 219 | p36-lilke protein; Provisional | 90.5 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 90.4 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 90.37 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 90.22 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 89.79 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 89.56 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 89.47 | |
| COG1877 | 266 | OtsB Trehalose-6-phosphatase [Carbohydrate transpo | 89.18 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 88.99 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 88.98 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 88.58 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 88.55 | |
| PRK10444 | 248 | UMP phosphatase; Provisional | 87.86 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 87.1 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 86.68 | |
| PLN02423 | 245 | phosphomannomutase | 85.9 | |
| PLN02151 | 354 | trehalose-phosphatase | 84.58 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 84.42 | |
| TIGR00685 | 244 | T6PP trehalose-phosphatase. At least 18 distinct s | 84.29 | |
| COG2503 | 274 | Predicted secreted acid phosphatase [General funct | 83.76 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 83.67 | |
| PTZ00174 | 247 | phosphomannomutase; Provisional | 83.62 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 83.62 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 83.35 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 83.22 | |
| TIGR01458 | 257 | HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr | 83.21 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 83.18 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 83.15 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 83.06 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 82.8 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 82.63 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 82.53 | |
| PLN02580 | 384 | trehalose-phosphatase | 82.08 | |
| TIGR01675 | 229 | plant-AP plant acid phosphatase. This model explic | 81.43 | |
| TIGR01485 | 249 | SPP_plant-cyano sucrose-6F-phosphate phosphohydrol | 81.31 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 81.1 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 81.08 | |
| PRK14502 | 694 | bifunctional mannosyl-3-phosphoglycerate synthase/ | 80.47 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 80.23 |
| >TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.1e-44 Score=330.01 Aligned_cols=184 Identities=26% Similarity=0.330 Sum_probs=151.4
Q ss_pred hhhhccccCCCC-CCCCCCCcEEEEeCCCceeeecCCCCCCCCCCceecceeEEeCCChHHHHHHHhcCceEEEEcCCch
Q 042807 107 LSRISLSSQFSA-PISRLRKKLLVLDLNGLLADIVSPPPKDCKADKKIARHAVFKRPFCHDFLRFCFERFDVGVWSSRTQ 185 (343)
Q Consensus 107 ~~~~~~~~~i~~-~~~~~~KklLVLDLDeTLi~~~~~~~~~~~~Df~~~~~~v~~RP~L~eFL~~l~~~yEIvIwTSa~~ 185 (343)
+.++++++.++. ++++++|+||||||||||||+.+..+ ..++++||||++||++|+++|||+|||||++
T Consensus 2 ~~~~~~~~~~~~~~~~~~~kklLVLDLDeTLvh~~~~~~----------~~~~~kRP~l~eFL~~~~~~feIvVwTAa~~ 71 (195)
T TIGR02245 2 LLRRIEQYKIKLLNPPREGKKLLVLDIDYTLFDHRSPAE----------TGEELMRPYLHEFLTSAYEDYDIVIWSATSM 71 (195)
T ss_pred hhHHHHhcCccccCCCCCCCcEEEEeCCCceEcccccCC----------CceEEeCCCHHHHHHHHHhCCEEEEEecCCH
Confidence 457788888877 77899999999999999999865433 3478999999999999999999999999999
Q ss_pred HHHHHHHHHHcC--CCCceEEEEEecCceeeccccccccccccceeeecccccccCCCCCCCCCCCCCCCcEEEEECCch
Q 042807 186 KNVERVVDFLMG--DMKHKLLFCWDLSYCTATSFKALENKYKALVFKELRKVWEISDPNCPWAKGDYNESNTVLLDDSPY 263 (343)
Q Consensus 186 ~ya~~il~~Ldp--~~~~~i~~vl~Rd~C~~~~~~~~e~~~k~~~vKDL~~Lw~~~~p~~p~~~G~rdl~ntIlIDDsp~ 263 (343)
+||+++++.++. ++.+++.++|++..|...+. ...+..++|||+.+|++++ +.++++|||||||+|.
T Consensus 72 ~ya~~~l~~l~~~~~~~~~i~~~ld~~~~~~~~~----~~~g~~~vKdL~~lw~~l~-------~~~~~~ntiiVDd~p~ 140 (195)
T TIGR02245 72 KWIEIKMTELGVLTNPNYKITFLLDSTAMITVHT----PRRGKFDVKPLGVIWALLP-------EFYSMKNTIMFDDLRR 140 (195)
T ss_pred HHHHHHHHHhcccCCccceEEEEeccccceeeEe----eccCcEEEeecHHhhhhcc-------cCCCcccEEEEeCCHH
Confidence 999999998853 44567888886555543332 2334457999999998763 2379999999999999
Q ss_pred hcccCCCCceecCCCCCCCCCCCCCCCccchHHHHHHHhhcCcCHHHHH
Q 042807 264 KALLNPPYTAIFPCSYKYQNPSDNSLGAGGDLRVYLEMLAEAENVQRFI 312 (343)
Q Consensus 264 ~~~~qP~NgiiIP~~f~~~~~~D~~L~~L~~L~~yL~~La~~eDVr~~l 312 (343)
+|.+||+|||.|+ +|.+++.+|..+.+|+.|++||+.|+.++|||++.
T Consensus 141 ~~~~~P~N~i~I~-~f~~~~~~~~~D~eL~~L~~yL~~la~~~Dvr~~~ 188 (195)
T TIGR02245 141 NFLMNPQNGLKIR-PFKKAHANRGTDQELLKLTQYLKTIAELEDFSSLD 188 (195)
T ss_pred HHhcCCCCccccC-CccccCCCCcccHHHHHHHHHHHHHhcCcccchhh
Confidence 9999999999995 68876555556667779999999999999999943
|
This family of sequences appears to belong to the Haloacid Dehalogenase (HAD) superfamily of enzymes by virtue of the presence of three catalytic domains, in this case: LLVLD(ILV)D(YH)T, I(VMG)IWS, and (DN)(VC)K(PA)Lx{15-17}T(IL)(MH)(FV)DD(IL)(GRS)(RK)N. Since this family has no large "cap" domain between motifs 1 and 2 or between 2 and 3, it is formally a "class III" HAD. |
| >KOG1605 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] | Back alignment and domain information |
|---|
| >PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear | Back alignment and domain information |
|---|
| >TIGR02251 HIF-SF_euk Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain | Back alignment and domain information |
|---|
| >KOG2832 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0323 consensus TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >KOG1872 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >PRK10187 trehalose-6-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >COG4996 Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PTZ00445 p36-lilke protein; Provisional | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10444 UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02423 phosphomannomutase | Back alignment and domain information |
|---|
| >PLN02151 trehalose-phosphatase | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR00685 T6PP trehalose-phosphatase | Back alignment and domain information |
|---|
| >COG2503 Predicted secreted acid phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00174 phosphomannomutase; Provisional | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >PLN02580 trehalose-phosphatase | Back alignment and domain information |
|---|
| >TIGR01675 plant-AP plant acid phosphatase | Back alignment and domain information |
|---|
| >TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 343 | ||||
| 3shq_A | 320 | Crystal Structure Of Ublcp1 Length = 320 | 5e-05 |
| >pdb|3SHQ|A Chain A, Crystal Structure Of Ublcp1 Length = 320 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 343 | |||
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 3e-25 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 9e-14 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 1e-13 | |
| 3qle_A | 204 | TIM50P; chaperone, mitochondrion, preprotein trans | 4e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-06 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 5e-04 | |
| 3ef1_A | 442 | RNA polymerase II subunit A C-terminal domain phos | 5e-04 |
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Length = 320 | Back alignment and structure |
|---|
Score = 102 bits (256), Expect = 3e-25
Identities = 44/205 (21%), Positives = 79/205 (38%), Gaps = 25/205 (12%)
Query: 124 RKKLLVLDLNGLLADIVSPPPKDCKADKKIARHAVFKRPFCHDFLRFCFERFDVGVWSSR 183
KKLLVLD++ L D SP RP+ H+FL +E +D+ +WS+
Sbjct: 139 GKKLLVLDIDYTLFDHRSPAETGT----------ELMRPYLHEFLTSAYEDYDIVIWSAT 188
Query: 184 TQKNVERVVDFLM--GDMKHKLLFCWDLSYCTATSFKALENKYKALVFKELRKVWEISDP 241
+ + +E + L + +K++F D + + + K L +W +
Sbjct: 189 SMRWIEEKMRLLGVASNDNYKVMFYLDSTAM----ISVHVPERGVVDVKPLGVIWALYK- 243
Query: 242 NCPWAKGDYNESNTVLLDDSPYKALLNPPYTAIFPCSYKYQNPSDNSLGAGGDLRVYLEM 301
YN SNT++ DD L+N P + + ++ + + + L YL
Sbjct: 244 -------QYNSSNTIMFDDIRRNFLMN-PKSGLKIRPFRQAHLNRGTDTELLKLSDYLRK 295
Query: 302 LAEAENVQRFIQHNPFGQSAITNRS 326
+A + H + S
Sbjct: 296 IAHHCPDFNSLNHRKWEHYHPKKNS 320
|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Length = 181 | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Length = 204 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Length = 372 | Back alignment and structure |
|---|
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Length = 442 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 343 | |||
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 100.0 | |
| 3qle_A | 204 | TIM50P; chaperone, mitochondrion, preprotein trans | 100.0 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 100.0 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 99.97 | |
| 3ef1_A | 442 | RNA polymerase II subunit A C-terminal domain phos | 99.93 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 99.92 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 97.46 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 97.34 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 97.29 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 97.21 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 97.19 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 97.14 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 96.84 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 96.53 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 96.47 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 96.43 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 96.36 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 96.31 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 96.29 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 96.14 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 96.13 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 96.09 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 96.04 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 96.01 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 95.91 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 95.9 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 95.77 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 95.65 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 95.65 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 95.58 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 95.48 | |
| 2obb_A | 142 | Hypothetical protein; structural genomics, PSI-2, | 95.44 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 95.36 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 95.13 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 95.04 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 95.03 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 95.0 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 94.89 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 94.56 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 94.52 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 94.0 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 93.76 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 93.6 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 93.44 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 93.37 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 93.36 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 93.31 | |
| 1xpj_A | 126 | Hypothetical protein; structural genomics, MCSG, p | 93.23 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 93.07 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 92.87 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 92.62 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 92.52 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 92.47 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 92.24 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 92.12 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 92.04 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 91.88 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 91.75 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 91.61 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 91.03 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 90.26 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 90.24 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 90.06 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 89.96 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 89.91 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 89.77 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 89.7 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 89.66 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 89.56 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 89.37 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 89.15 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 89.12 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 89.1 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 88.82 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 88.78 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 88.39 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 88.3 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 88.14 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 87.72 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 87.51 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 87.08 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 86.98 | |
| 3l7y_A | 304 | Putative uncharacterized protein SMU.1108C; hydrol | 86.4 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 86.26 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 86.25 | |
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 86.03 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 85.85 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 85.18 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 84.53 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 84.39 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 83.87 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 83.5 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 83.4 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 83.32 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 82.7 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 82.4 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 82.09 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 82.05 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 81.96 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 81.83 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 81.73 | |
| 1q92_A | 197 | 5(3)-deoxyribonucleotidase; alpha-beta rossman fol | 81.69 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 81.43 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 81.35 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 81.09 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 80.77 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 80.56 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 80.44 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 80.44 |
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
Probab=100.00 E-value=8.3e-45 Score=351.87 Aligned_cols=279 Identities=20% Similarity=0.279 Sum_probs=195.5
Q ss_pred eeeeccccceee---ecccchhHHHHHHHHhccCCccCCCcccccccchhhhccC-CccCccCCCC----------ccee
Q 042807 16 NITRTKTGTEIA---TRSDFGVEIKNRMEKLNQLKTIPANELHEDVRLPKMVQKN-NNMSTLSLPD----------EKYT 81 (343)
Q Consensus 16 ~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~-~~~~~~~~~~----------~k~~ 81 (343)
+|+=.-+|.++. ..++=.-++|.++++.+| ||+.-+.... .|++||. .+..+.+..+ ++.+
T Consensus 7 ~i~Vk~~g~~~~v~v~~~~Tv~~lK~~I~~~tg---Vpp~~QkLi~--~k~~Gk~l~D~~~L~~~~ik~g~~l~L~gs~~ 81 (320)
T 3shq_A 7 VVIVKWSGKEYPVDLTDQDTVEVLRHEIFRKTQ---VRPERQKLLN--LKYKGKTAADNVKISALELKPNFKLMMVGSTE 81 (320)
T ss_dssp EEEEEETTEEEEEEEETTSBHHHHHHHHHHHHC---CCGGGCEETT--CBSSSSBCCTTSBTTSSCCC--CEEEEECCCC
T ss_pred EEEEEECCEEEEEEECCCCcHHHHHHHHHHHHC---cCHHHeEEee--cccCCcccCccccHHHcCCCCCCEEEEEccch
Confidence 343334555442 334556789999999988 6666443331 1234432 2221222222 1222
Q ss_pred ccee-----------eeccCCccccceeeecccCcc---hhhhccccCCCC-CCCCCCCcEEEEeCCCceeeecCCCCCC
Q 042807 82 AEKV-----------ISSEADETQDATLTFSYREDN---LSRISLSSQFSA-PISRLRKKLLVLDLNGLLADIVSPPPKD 146 (343)
Q Consensus 82 ~~~i-----------~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~i~~-~~~~~~KklLVLDLDeTLi~~~~~~~~~ 146 (343)
.+.+ +..+-..+.+++.++.+++.| +.++++++.++. +|++++|+||||||||||||+.+..
T Consensus 82 ~~i~~~~~~p~~~~~~~eD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~k~tLVLDLDeTLvh~~~~~--- 158 (320)
T 3shq_A 82 ADIEDACSLPDNIGEVVDDFDDADEREESVAHSAVYLAKVQRRVRDYKIKELAPPREGKKLLVLDIDYTLFDHRSPA--- 158 (320)
T ss_dssp ----------CCCSCCCCTTCCCCC--CCSTTSHHHHHHHHHHHHHCCCCCSSCCCTTCEEEEECCBTTTBCSSSCC---
T ss_pred hhhcccccCCCcCCcccccCCCcccchhhhhhhhhhHHHHHHHHHhcCCCcCCCCcCCCcEEEEeccccEEcccccC---
Confidence 2211 111111224555667777766 777888999988 7889999999999999999997533
Q ss_pred CCCCceecceeEEeCCChHHHHHHHhcCceEEEEcCCchHHHHHHHHHHcCCCCceEEEEEecCceeecccccccccccc
Q 042807 147 CKADKKIARHAVFKRPFCHDFLRFCFERFDVGVWSSRTQKNVERVVDFLMGDMKHKLLFCWDLSYCTATSFKALENKYKA 226 (343)
Q Consensus 147 ~~~Df~~~~~~v~~RP~L~eFL~~l~~~yEIvIwTSa~~~ya~~il~~Ldp~~~~~i~~vl~Rd~C~~~~~~~~e~~~k~ 226 (343)
.++++++||||++||++|+++|||+||||+++.||++|++.|++.....+.++++|++|....... +.++.
T Consensus 159 -------~~~~~~~RP~l~eFL~~l~~~yeivIfTas~~~ya~~vld~Ld~~~~~~~~~~~~r~~~~~~~~~~--~~~g~ 229 (320)
T 3shq_A 159 -------ETGTELMRPYLHEFLTSAYEDYDIVIWSATSMRWIEEKMRLLGVASNDNYKVMFYLDSTAMISVHV--PERGV 229 (320)
T ss_dssp -------SSHHHHBCTTHHHHHHHHHHHEEEEEECSSCHHHHHHHHHHTTCTTCSSCCCCEEECGGGCEEEEE--TTTEE
T ss_pred -------CCcceEeCCCHHHHHHHHHhCCEEEEEcCCcHHHHHHHHHHhCCCCCcceeEEEEEcCCccccccc--cCCCC
Confidence 245899999999999999999999999999999999999999986532223445678875322101 22344
Q ss_pred ceeeecccccccCCCCCCCCCCCCCCCcEEEEECCchhcccCCCCceecCCCCCCCC---CCCCCCCccchHHHHHHHhh
Q 042807 227 LVFKELRKVWEISDPNCPWAKGDYNESNTVLLDDSPYKALLNPPYTAIFPCSYKYQN---PSDNSLGAGGDLRVYLEMLA 303 (343)
Q Consensus 227 ~~vKDL~~Lw~~~~p~~p~~~G~rdl~ntIlIDDsp~~~~~qP~NgiiIP~~f~~~~---~~D~~L~~L~~L~~yL~~La 303 (343)
.++|||++||++|+ | |+++|||||||+|.+|.+||+|||.| .+|.+++ .+|++ |..|++||+.|+
T Consensus 230 ~~vKdLs~Lw~~~p-------~-rdl~~tIiIDdsp~~~~~~p~NgI~I-~~~~~~~~~~~~D~e---L~~L~~~L~~L~ 297 (320)
T 3shq_A 230 VDVKPLGVIWALYK-------Q-YNSSNTIMFDDIRRNFLMNPKSGLKI-RPFRQAHLNRGTDTE---LLKLSDYLRKIA 297 (320)
T ss_dssp EEECCHHHHHHHCT-------T-CCGGGEEEEESCGGGGTTSGGGEEEC-CCCCCHHHHTTTCCH---HHHHHHHHHHHH
T ss_pred EEEEEhHHhhcccC-------C-CChhHEEEEeCChHHhccCcCceEEe-CeEcCCCCCCCccHH---HHHHHHHHHHHh
Confidence 69999999999985 4 99999999999999999999999998 4687652 45654 559999999999
Q ss_pred -cCcCHHHHHhcCCCCCCcccCCCcchHHHHHHh
Q 042807 304 -EAENVQRFIQHNPFGQSAITNRSEYWAFYLRAM 336 (343)
Q Consensus 304 -~~eDVr~~lk~~pf~~~~I~~~~~~w~~y~~~~ 336 (343)
.++|||+ -+|++|+.|..+.
T Consensus 298 ~~~~DVr~-------------~~~~~w~~~~~~~ 318 (320)
T 3shq_A 298 HHCPDFNS-------------LNHRKWEHYHPKK 318 (320)
T ss_dssp HHCSCGGG-------------CCGGGGGGCCC--
T ss_pred ccCcchhH-------------HHHHHHHHhhhhh
Confidence 9999999 5788899887654
|
| >3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 343 | ||||
| d1ta0a_ | 181 | c.108.1.16 (A:) Carboxy-terminal domain RNA polyme | 2e-21 |
| >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 181 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: NLI interacting factor-like phosphatase domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 87.8 bits (217), Expect = 2e-21
Identities = 38/196 (19%), Positives = 71/196 (36%), Gaps = 35/196 (17%)
Query: 124 RKKLLVLDLNGLLADIVSPPPKDCK------ADKKIARHAVFKRPFCHDFLRFCFERFDV 177
K +V+DL+ L P + D + + V KRP +FL+ E F+
Sbjct: 14 DKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFEC 73
Query: 178 GVWSSRTQKNVERVVDFLMGDMKHKLLFCWDLSYCTATSFKALENKYKALVFKELRKVWE 237
++++ K + V D L C + K+L ++
Sbjct: 74 VLFTASLAKYADPVADLLD--KWGAFRARLFRESCVFHRGNYV---------KDLSRLG- 121
Query: 238 ISDPNCPWAKGDYNESNTVLLDDSPYKALLNPPYTAIFPCSYKYQNPSDNSLGAGGDLRV 297
+ ++LD+SP + + P A+ S+ + N SD L DL
Sbjct: 122 ------------RDLRRVLILDNSPASYVFH-PDNAVPVASW-FDNMSDTEL---HDLLP 164
Query: 298 YLEMLAEAENVQRFIQ 313
+ E L+ ++V ++
Sbjct: 165 FFEQLSRVDDVYSVLR 180
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 343 | |||
| d1ta0a_ | 181 | Carboxy-terminal domain RNA polymerase II polypept | 100.0 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 97.84 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 97.15 | |
| d2obba1 | 122 | Hypothetical protein BT0820 {Bacteroides thetaiota | 97.14 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 96.99 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 96.88 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 96.72 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 96.54 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 96.54 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 96.32 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 96.29 | |
| d1xpja_ | 124 | Hypothetical protein VC0232 {Vibrio cholerae [TaxI | 96.26 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 96.21 | |
| d1yj5a1 | 195 | 5' polynucleotide kinase-3' phosphatase, middle do | 95.09 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 94.48 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 94.47 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 94.17 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 93.73 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 93.2 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 93.1 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 92.82 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 92.71 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 92.61 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 92.41 | |
| d1vjra_ | 261 | Hypothetical protein TM1742 {Thermotoga maritima [ | 91.67 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 91.58 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 91.37 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 90.28 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 90.13 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 89.21 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 89.15 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 88.89 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 87.74 | |
| d1yv9a1 | 253 | Putative hydrolase EF1188 {Enterococcus faecalis [ | 87.4 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 87.03 | |
| d1wvia_ | 253 | Putative phosphatase SMU.1415c {Streptococcus muta | 86.81 | |
| d1rkua_ | 206 | Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta | 85.63 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 82.2 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 82.03 |
| >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: NLI interacting factor-like phosphatase domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=5.2e-41 Score=298.10 Aligned_cols=171 Identities=22% Similarity=0.274 Sum_probs=145.9
Q ss_pred ccCCCC-CCCCCCCcEEEEeCCCceeeecCCCCCCCCCCce--------ecceeEEeCCChHHHHHHHhcCceEEEEcCC
Q 042807 113 SSQFSA-PISRLRKKLLVLDLNGLLADIVSPPPKDCKADKK--------IARHAVFKRPFCHDFLRFCFERFDVGVWSSR 183 (343)
Q Consensus 113 ~~~i~~-~~~~~~KklLVLDLDeTLi~~~~~~~~~~~~Df~--------~~~~~v~~RP~L~eFL~~l~~~yEIvIwTSa 183 (343)
++.+++ ++...+|+||||||||||||+...... .+|+. ...+++++|||+++||++|+++|||+|||||
T Consensus 2 ~~llp~~~~~~~~k~~LVLDLDeTLihs~~~~~~--~~~~~~~~~~~~~~~~~~v~~RP~l~eFL~~l~~~yei~I~Ta~ 79 (181)
T d1ta0a_ 2 QYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVN--NADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTAS 79 (181)
T ss_dssp CCSSCCCCGGGTTSCEEEECCBTTTEEEESSCCT--TCSEEEEEEETTEEEEEEEEECTTHHHHHHHHHHHSEEEEECSS
T ss_pred CccCCCCCcccCCCeEEEEeCCCCEEccccCCCC--CccceeeecccceeeeeEEecCCCHHHHHHHHHhceEEEEEcCC
Confidence 345665 455678999999999999999765432 33432 3467999999999999999999999999999
Q ss_pred chHHHHHHHHHHcCCCCceEEEEEecCceeeccccccccccccceeeecccccccCCCCCCCCCCCCCCCcEEEEECCch
Q 042807 184 TQKNVERVVDFLMGDMKHKLLFCWDLSYCTATSFKALENKYKALVFKELRKVWEISDPNCPWAKGDYNESNTVLLDDSPY 263 (343)
Q Consensus 184 ~~~ya~~il~~Ldp~~~~~i~~vl~Rd~C~~~~~~~~e~~~k~~~vKDL~~Lw~~~~p~~p~~~G~rdl~ntIlIDDsp~ 263 (343)
++.||++|++.|+|+. .+.++|+|++|...+. .++|||+++ | |++++||||||++.
T Consensus 80 ~~~YA~~il~~ldp~~--~~~~~~~r~~c~~~~~---------~~~KdL~~l------------~-~~l~~vvivDd~~~ 135 (181)
T d1ta0a_ 80 LAKYADPVADLLDKWG--AFRARLFRESCVFHRG---------NYVKDLSRL------------G-RDLRRVLILDNSPA 135 (181)
T ss_dssp CHHHHHHHHHHHCSSC--CEEEEECGGGSEEETT---------EEECCGGGS------------C-SCGGGEEEECSCGG
T ss_pred cHHHHHHHHHHhccCC--ceeEEEEeeeeeecCC---------cccccHhhc------------C-CCHHHeEEEcCChh
Confidence 9999999999999965 4778999999986543 489999999 4 99999999999999
Q ss_pred hcccCCCCceecCCCCCCCCCCCCCCCccchHHHHHHHhhcCcCHHHHHhc
Q 042807 264 KALLNPPYTAIFPCSYKYQNPSDNSLGAGGDLRVYLEMLAEAENVQRFIQH 314 (343)
Q Consensus 264 ~~~~qP~NgiiIP~~f~~~~~~D~~L~~L~~L~~yL~~La~~eDVr~~lk~ 314 (343)
++..||+|+|.| .+|.++ .+|++|. .|++||+.|+.++|||++|++
T Consensus 136 ~~~~~~~N~I~I-~~f~~~-~~D~eL~---~l~~~L~~l~~~~DVR~~l~~ 181 (181)
T d1ta0a_ 136 SYVFHPDNAVPV-ASWFDN-MSDTELH---DLLPFFEQLSRVDDVYSVLRQ 181 (181)
T ss_dssp GGTTCGGGBCCC-CCCSSC-TTCCHHH---HHHHHHHHHTTCSCHHHHHCC
T ss_pred hhhcCccCeeEe-cCcCCC-CCcHHHH---HHHHHHHHHccCCcHHHHhcC
Confidence 999999999998 468764 5687665 999999999999999999974
|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|