Citrus Sinensis ID: 042807


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340---
DTLFGIESILQPPFVNITRTKTGTEIATRSDFGVEIKNRMEKLNQLKTIPANELHEDVRLPKMVQKNNNMSTLSLPDEKYTAEKVISSEADETQDATLTFSYREDNLSRISLSSQFSAPISRLRKKLLVLDLNGLLADIVSPPPKDCKADKKIARHAVFKRPFCHDFLRFCFERFDVGVWSSRTQKNVERVVDFLMGDMKHKLLFCWDLSYCTATSFKALENKYKALVFKELRKVWEISDPNCPWAKGDYNESNTVLLDDSPYKALLNPPYTAIFPCSYKYQNPSDNSLGAGGDLRVYLEMLAEAENVQRFIQHNPFGQSAITNRSEYWAFYLRAMNTIYFAN
cccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccEEEEEcccEEEEEcccccccccccEEEEEEEEEccccHHHHHHHHHHccEEEEEccccccHHHHHHHHHcccccccEEEEEEccccEEEccccccccccEEEEEccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHccccHHHHHHHccccccccccccccHHHHHHHHHHHHccc
cccccHHHHcccccEEcccccccEEHHHHHHcccEcccccHHHHHccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccEEEEcccccccccccccccccccEEccccHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHccccccEEEEEEcccccccccccccccccEEEEHcHHHHHHHccccccccccccccccEEEEEcccHHHHccccccEEEcccccccccccccccccHHHHHHHHHHHccccHHHHHHHccccccccccccccHHHHHHHHHHHcccc
DTLFGiesilqppfvnitrtktgteiatrsDFGVEIKNRMEKLNqlktipanelhedvrlpkmvqknnnmstlslpdekytaEKVIsseadetqdatltfsyrednlsrislssqfsaPISRLRKKLLVLDLNglladivspppkdckadkkiarhavfkrpfchDFLRFCFErfdvgvwssrtqKNVERVVDFLMGDMKHKLLFCWDLSYCTATSFKALENKYKALVFKELRKVWeisdpncpwakgdynesntvllddspykallnppytaifpcsykyqnpsdnslgaggDLRVYLEMLAEAENVQRFiqhnpfgqsaitNRSEYWAFYLRAMNTIYFAN
dtlfgiesilqppfvnitrtktgteiatrsdfgveIKNRMEKLnqlktipanelhedvrlpkmvqknnnmstlslpdekYTAEKVisseadetqdATLTFsyrednlsrislssqfsapISRLRKKLLVLDLNGLladivspppkdcKADKKIARHAVFKRPFCHDFLRFCFERFdvgvwssrtqkNVERVVDFLMGDMKHKLLFCWDLSYCTATSFKALENKYKALVFKELRKVWEISDPNCPWAKGDYNESNTVLLDDSPYKALLNPPYTAIFPCSYKYQNPSDNSLGAGGDLRVYLEMLAEAENVQRFIQHNPFGQSAITNRSEYWAFYLRAMNTIYFAN
DTLFGIESILQPPFVNITRTKTGTEIATRSDFGVEIKNRMEKLNQLKTIPANELHEDVRLPKMVQKNNNMSTLSLPDEKYTAEKVISSEADETQDATLTFSYREDNLSRISLSSQFSAPISrlrkkllvldlngllADIVSPPPKDCKADKKIARHAVFKRPFCHDFLRFCFERFDVGVWSSRTQKNVERVVDFLMGDMKHKLLFCWDLSYCTATSFKALENKYKALVFKELRKVWEISDPNCPWAKGDYNESNTVLLDDSPYKALLNPPYTAIFPCSYKYQNPSDNSLGAGGDLRVYLEMLAEAENVQRFIQHNPFGQSAITNRSEYWAFYLRAMNTIYFAN
***FGIESILQPPFVNITRTKTGTEIATRSDFGVEIK******************************************************************************FSAPISRLRKKLLVLDLNGLLADIVSPPPKDCKADKKIARHAVFKRPFCHDFLRFCFERFDVGVWSSRTQKNVERVVDFLMGDMKHKLLFCWDLSYCTATSFKALENKYKALVFKELRKVWEISDPNCPWAKGDYNESNTVLLDDSPYKALLNPPYTAIFPCSYKYQNPSDNSLGAGGDLRVYLEMLAEAENVQRFIQHNPFGQSAITNRSEYWAFYLRAMNTIYF**
****G*ESILQ*******************************************************************************************************************LLVLDLNGLLADIVSPPPKD*KADKKIARHAVFKRPFCHDFLRFCFERFDVGVWSSRTQKNVERVVDFLMGDMKHKLLFCWDLSYCTATSFKALENKYKALVFKELRKVWEISDPNCPW*KGDYNESNTVLLDDSPYKALLNPPYTAIFPCSYKYQNPSDNSLGAGGDLRVYLEMLAEAENVQRFIQHNPFGQSAITNRSEYWAFYLRAMNTIY***
DTLFGIESILQPPFVNITRTKTGTEIATRSDFGVEIKNRMEKLNQLKTIPANELHEDVRLPKMVQKNNNMSTLSLPDEKYTAEKVISSEADETQDATLTFSYREDNLSRISLSSQFSAPISRLRKKLLVLDLNGLLADIVSPPPKDCKADKKIARHAVFKRPFCHDFLRFCFERFDVGVWSSRTQKNVERVVDFLMGDMKHKLLFCWDLSYCTATSFKALENKYKALVFKELRKVWEISDPNCPWAKGDYNESNTVLLDDSPYKALLNPPYTAIFPCSYKYQNPSDNSLGAGGDLRVYLEMLAEAENVQRFIQHNPFGQSAITNRSEYWAFYLRAMNTIYFAN
*TLFGIESILQPPFVNITRTKTGTEIATRSDFGVEIKNRMEKLNQLKT*PA*E*HEDVRLP***********************************************************SRLRKKLLVLDLNGLLADIVSPPPKDCKADKKIARHAVFKRPFCHDFLRFCFERFDVGVWSSRTQKNVERVVDFLMGDMKHKLLFCWDLSYCTATSFKALENKYKALVFKELRKVWEISDPNCPWAKGDYNESNTVLLDDSPYKALLNPPYTAIFPCSYKYQNPSDNSLGAGGDLRVYLEMLAEAENVQRFIQHNPFGQSAITNRSEYWAFYLRAMNTIYFA*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DTLFGIESILQPPFVNITRTKTGTEIATRSDFGVEIKNRMEKLNQLKTIPANELHEDVRLPKMVQKNNNMSTLSLPDEKYTAEKVISSEADETQDATLTFSYREDNLSRISLSSQFSAPISRLRKKLLVLDLNGLLADIVSPPPKDCKADKKIARHAVFKRPFCHDFLRFCFERFDVGVWSSRTQKNVERVVDFLMGDMKHKLLFCWDLSYCTATSFKALENKYKALVFKELRKVWEISDPNCPWAKGDYNESNTVLLDDSPYKALLNPPYTAIFPCSYKYQNPSDNSLGAGGDLRVYLEMLAEAENVQRFIQHNPFGQSAITNRSEYWAFYLRAMNTIYFAN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query343 2.2.26 [Sep-21-2011]
O94336244 Uncharacterized FCP1 homo yes no 0.510 0.717 0.280 1e-09
Q6DI37318 Ubiquitin-like domain-con yes no 0.419 0.452 0.297 9e-06
Q28EX9318 Ubiquitin-like domain-con yes no 0.361 0.389 0.274 0.0002
>sp|O94336|YHM3_SCHPO Uncharacterized FCP1 homology domain-containing protein C1271.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.03c PE=4 SV=1 Back     alignment and function desciption
 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 93/207 (44%), Gaps = 32/207 (15%)

Query: 125 KKLLVLDLNGLLADIVSPPPKDCKADKKIARHAVFK-------RPFCHDFLRFCFERFDV 177
           +KL++LDLNG L          C+A    +  +V++       RP  H+FL++ F  F V
Sbjct: 23  RKLVILDLNGTLL---------CRALAVRSEKSVYEASRNPIPRPGLHNFLKYIFANFSV 73

Query: 178 GVWSSRTQKNVERVVDFLMGDMKHK-LLFCWDLSYCTATSFKALENKY--KALVFKELRK 234
            V+SS    NV+ ++  +M + + K L+ CW     T    K  ++++  K   +K L  
Sbjct: 74  MVFSSSKPHNVQAMLSAIMNEEQKKALIACW-----TRVDMKLTKHQFDRKVQTYKNLDT 128

Query: 235 VWEISDPNCPWAKGDYNESNTVLLDDSPYKALLNPPYTAI----FPCSYKYQNPSDNSLG 290
           VWE    +       +++ NT+++DDS  K   + PY  I    F        P D  L 
Sbjct: 129 VWEKIHHDSTGKPVSWSQYNTIIVDDSKTKCAAH-PYNHIAVSDFVAKSHSNIPKDIELA 187

Query: 291 AGGDLRVYLEMLAEAENVQRFIQHNPF 317
               +  YL+ L    NV  +I   PF
Sbjct: 188 C---VIRYLKHLKSVPNVSYYIYKFPF 211





Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|Q6DI37|UBCP1_DANRE Ubiquitin-like domain-containing CTD phosphatase 1 OS=Danio rerio GN=ublcp1 PE=2 SV=1 Back     alignment and function description
>sp|Q28EX9|UBCP1_XENTR Ubiquitin-like domain-containing CTD phosphatase 1 OS=Xenopus tropicalis GN=ublcp1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query343
224080213209 predicted protein [Populus trichocarpa] 0.609 1.0 0.722 9e-87
225451723439 PREDICTED: uncharacterized protein LOC10 0.644 0.503 0.585 5e-85
255547163 576 conserved hypothetical protein [Ricinus 0.839 0.5 0.508 9e-80
255573416340 conserved hypothetical protein [Ricinus 0.714 0.720 0.636 2e-78
388490814272 unknown [Medicago truncatula] 0.629 0.794 0.596 3e-77
225456581 652 PREDICTED: uncharacterized protein LOC10 0.696 0.366 0.585 3e-76
297818666379 predicted protein [Arabidopsis lyrata su 0.597 0.540 0.621 4e-76
296082211223 unnamed protein product [Vitis vinifera] 0.524 0.807 0.699 7e-74
11994485 559 unnamed protein product [Arabidopsis tha 0.568 0.348 0.594 2e-73
449441105 593 PREDICTED: uncharacterized protein LOC10 0.626 0.362 0.590 7e-73
>gi|224080213|ref|XP_002306055.1| predicted protein [Populus trichocarpa] gi|222849019|gb|EEE86566.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  326 bits (836), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 177/209 (84%)

Query: 124 RKKLLVLDLNGLLADIVSPPPKDCKADKKIARHAVFKRPFCHDFLRFCFERFDVGVWSSR 183
           RKKLL+LD+NG+L DIVS PPK   AD KIA+ AVF+RPFC DFL+FCFERF+VGVWSSR
Sbjct: 1   RKKLLILDINGVLVDIVSAPPKGHIADIKIAKKAVFRRPFCFDFLKFCFERFEVGVWSSR 60

Query: 184 TQKNVERVVDFLMGDMKHKLLFCWDLSYCTATSFKALENKYKALVFKELRKVWEISDPNC 243
           T+KNV+RVV+F+MGDMK KLLFCWDLS CTAT F  LENK+K LVFKELR++WE  D   
Sbjct: 61  TRKNVDRVVEFVMGDMKKKLLFCWDLSKCTATQFCTLENKHKPLVFKELRRIWEKDDSEL 120

Query: 244 PWAKGDYNESNTVLLDDSPYKALLNPPYTAIFPCSYKYQNPSDNSLGAGGDLRVYLEMLA 303
           PW KGDY+ESNT+LLDDSPYKALLNP +TAIFP  Y++QN +DNSLGAGGDLRVYLE LA
Sbjct: 121 PWEKGDYSESNTMLLDDSPYKALLNPAHTAIFPYPYQFQNSNDNSLGAGGDLRVYLEELA 180

Query: 304 EAENVQRFIQHNPFGQSAITNRSEYWAFY 332
            A+NVQ F++H+PFGQ AI+ RS  W F+
Sbjct: 181 AADNVQEFVEHHPFGQRAISQRSPNWGFF 209




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225451723|ref|XP_002276922.1| PREDICTED: uncharacterized protein LOC100244680 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255547163|ref|XP_002514639.1| conserved hypothetical protein [Ricinus communis] gi|223546243|gb|EEF47745.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|255573416|ref|XP_002527634.1| conserved hypothetical protein [Ricinus communis] gi|223533008|gb|EEF34773.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|388490814|gb|AFK33473.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|225456581|ref|XP_002265588.1| PREDICTED: uncharacterized protein LOC100263840 [Vitis vinifera] gi|297734071|emb|CBI15318.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297818666|ref|XP_002877216.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297323054|gb|EFH53475.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|296082211|emb|CBI21216.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|11994485|dbj|BAB02526.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449441105|ref|XP_004138324.1| PREDICTED: uncharacterized protein LOC101219396 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query343
TAIR|locus:2091823465 AT3G29760 "AT3G29760" [Arabido 0.399 0.294 0.652 7.7e-52
TAIR|locus:2044862249 AT2G36540 "AT2G36540" [Arabido 0.329 0.453 0.446 3.9e-21
POMBASE|SPBC1271.03c244 SPBC1271.03c "NLI interacting 0.431 0.606 0.292 7.7e-09
UNIPROTKB|Q0BYG6197 HNE_2798 "Phosphoprotein phosp 0.466 0.812 0.292 1.1e-08
UNIPROTKB|G4MNF1485 MGG_06937 "NIF domain-containi 0.451 0.319 0.287 1.3e-06
ASPGD|ASPL0000001456 619 AN6562 [Emericella nidulans (t 0.419 0.232 0.295 8.9e-05
TAIR|locus:2091823 AT3G29760 "AT3G29760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 512 (185.3 bits), Expect = 7.7e-52, Sum P(2) = 7.7e-52
 Identities = 90/138 (65%), Positives = 110/138 (79%)

Query:   137 ADIVSPPPKDCKADKKIARHAVFKRPFCHDFLRFCFERFDVGVWSSRTQKNVERVVDFLM 196
             ADIV+P  KD  AD  I R A+FKRPFC +FLRFCF++F+VG+WSSR Q NV R+ +FL+
Sbjct:   318 ADIVTPL-KDVPADINIGRRAIFKRPFCDEFLRFCFDKFEVGIWSSRKQNNVVRITEFLL 376

Query:   197 GDMKHKLLFCWDLSYCTATSFKALENKYKALVFKELRKVWEISDPNCPWAKGDYNESNTV 256
             GD+K KLLFCWD+SYC  TS  +LEN+YK +VFK+L ++WE  DP  PW  GDYNE+NTV
Sbjct:   377 GDLKSKLLFCWDMSYCATTSVGSLENRYKYVVFKDLNRLWEKHDPRLPWKMGDYNETNTV 436

Query:   257 LLDDSPYKALLNPPYTAI 274
             LLDDSPYKALLNP Y+ I
Sbjct:   437 LLDDSPYKALLNPQYSLI 454


GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2044862 AT2G36540 "AT2G36540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPBC1271.03c SPBC1271.03c "NLI interacting factor family phosphatase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|Q0BYG6 HNE_2798 "Phosphoprotein phosphatase" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms
UNIPROTKB|G4MNF1 MGG_06937 "NIF domain-containing protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ASPGD|ASPL0000001456 AN6562 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query343
pfam03031153 pfam03031, NIF, NLI interacting factor-like phosph 4e-18
smart00577148 smart00577, CPDc, catalytic domain of ctd-like pho 2e-13
TIGR02251162 TIGR02251, HIF-SF_euk, Dullard-like phosphatase do 8e-07
TIGR02245195 TIGR02245, HAD_IIID1, HAD-superfamily subfamily II 4e-06
>gnl|CDD|217328 pfam03031, NIF, NLI interacting factor-like phosphatase Back     alignment and domain information
 Score = 80.0 bits (198), Expect = 4e-18
 Identities = 39/192 (20%), Positives = 72/192 (37%), Gaps = 47/192 (24%)

Query: 126 KLLVLDLNGLLADIVSPPPKDCKADKKIARHA-VFKRPFCHDFLRFCFERFDVGVWSSRT 184
           K LVLDL+  L      P               V KRP   +FL+   + +++ ++++ +
Sbjct: 1   KTLVLDLDETLVHSSFEPDLPFDFVLNFNHGVYVKKRPGLDEFLQELSKYYEIVIFTASS 60

Query: 185 QKNVERVVDFLM--GDMKHKLLF---CWDLSYCTATSFKALENKYKALVFKELRKVWEIS 239
           ++  + V+D L          L+   C                       K+L  +    
Sbjct: 61  KEYADPVLDKLDPKKKYFKHRLYRESCT-------------------FYVKDLSLLGR-- 99

Query: 240 DPNCPWAKGDYNESNTVLLDDSPYKALLNPPYTAIFPCSYKYQNPSDNSLGAGGDLRV-- 297
                      + S  V++D+SP   LL P      P  + Y +P D  L     L++  
Sbjct: 100 -----------DLSRVVIVDNSPRSFLLQPDNGIPIP-PF-YGDPDDTEL-----LKLLP 141

Query: 298 YLEMLAEAENVQ 309
           +L+ LA+ ++V+
Sbjct: 142 FLKELAKVDDVR 153


This family contains a number of NLI interacting factor isoforms and also an N-terminal regions of RNA polymerase II CTC phosphatase and FCP1 serine phosphatase. This region has been identified as the minimal phosphatase domain. Length = 153

>gnl|CDD|214729 smart00577, CPDc, catalytic domain of ctd-like phosphatases Back     alignment and domain information
>gnl|CDD|233801 TIGR02251, HIF-SF_euk, Dullard-like phosphatase domain Back     alignment and domain information
>gnl|CDD|131299 TIGR02245, HAD_IIID1, HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 343
TIGR02245195 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase 100.0
KOG1605262 consensus TFIIF-interacting CTD phosphatase, inclu 100.0
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 100.0
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 100.0
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 99.93
KOG2832393 consensus TFIIF-interacting CTD phosphatase, inclu 99.93
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 99.87
COG5190390 FCP1 TFIIF-interacting CTD phosphatases, including 99.84
KOG0323 635 consensus TFIIF-interacting CTD phosphatases, incl 99.33
TIGR01684301 viral_ppase viral phosphatase. These proteins also 97.69
PHA03398303 viral phosphatase superfamily protein; Provisional 97.55
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 97.52
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 97.34
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 97.24
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 97.17
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 96.73
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 96.72
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 96.68
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 96.57
PF05152297 DUF705: Protein of unknown function (DUF705); Inte 96.55
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 96.33
COG5190 390 FCP1 TFIIF-interacting CTD phosphatases, including 95.92
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase. Due to 95.86
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 95.77
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 95.42
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 95.26
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 95.19
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 94.96
PRK13582205 thrH phosphoserine phosphatase; Provisional 94.9
PLN02954224 phosphoserine phosphatase 94.39
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 94.39
KOG1872 473 consensus Ubiquitin-specific protease [Posttransla 93.62
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 93.27
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 93.21
PRK06769173 hypothetical protein; Validated 93.13
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 93.06
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 92.87
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 92.86
COG4996164 Predicted phosphatase [General function prediction 92.61
COG0561264 Cof Predicted hydrolases of the HAD superfamily [G 92.4
PHA02530300 pseT polynucleotide kinase; Provisional 92.39
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 92.32
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 91.66
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 91.59
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 91.48
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 91.46
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 91.41
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 91.4
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 91.4
PRK11133322 serB phosphoserine phosphatase; Provisional 91.19
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 91.07
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 91.03
PRK08238 479 hypothetical protein; Validated 91.03
COG3882 574 FkbH Predicted enzyme involved in methoxymalonyl-A 90.78
PTZ00445219 p36-lilke protein; Provisional 90.5
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 90.4
PRK12702302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 90.37
PRK01158230 phosphoglycolate phosphatase; Provisional 90.22
PRK10513270 sugar phosphate phosphatase; Provisional 89.79
PLN02645311 phosphoglycolate phosphatase 89.56
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 89.47
COG1877266 OtsB Trehalose-6-phosphatase [Carbohydrate transpo 89.18
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 88.99
TIGR01486256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 88.98
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 88.58
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 88.55
PRK10444248 UMP phosphatase; Provisional 87.86
PRK15126272 thiamin pyrimidine pyrophosphate hydrolase; Provis 87.1
PRK10976266 putative hydrolase; Provisional 86.68
PLN02423245 phosphomannomutase 85.9
PLN02151354 trehalose-phosphatase 84.58
PRK13222226 phosphoglycolate phosphatase; Provisional 84.42
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 84.29
COG2503274 Predicted secreted acid phosphatase [General funct 83.76
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 83.67
PTZ00174247 phosphomannomutase; Provisional 83.62
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 83.62
PRK13288214 pyrophosphatase PpaX; Provisional 83.35
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 83.22
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 83.21
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 83.18
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 83.15
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 83.06
PRK09449224 dUMP phosphatase; Provisional 82.8
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 82.63
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 82.53
PLN02580384 trehalose-phosphatase 82.08
TIGR01675229 plant-AP plant acid phosphatase. This model explic 81.43
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 81.31
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 81.1
PRK11587218 putative phosphatase; Provisional 81.08
PRK14502694 bifunctional mannosyl-3-phosphoglycerate synthase/ 80.47
PHA02597197 30.2 hypothetical protein; Provisional 80.23
>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information
Probab=100.00  E-value=1.1e-44  Score=330.01  Aligned_cols=184  Identities=26%  Similarity=0.330  Sum_probs=151.4

Q ss_pred             hhhhccccCCCC-CCCCCCCcEEEEeCCCceeeecCCCCCCCCCCceecceeEEeCCChHHHHHHHhcCceEEEEcCCch
Q 042807          107 LSRISLSSQFSA-PISRLRKKLLVLDLNGLLADIVSPPPKDCKADKKIARHAVFKRPFCHDFLRFCFERFDVGVWSSRTQ  185 (343)
Q Consensus       107 ~~~~~~~~~i~~-~~~~~~KklLVLDLDeTLi~~~~~~~~~~~~Df~~~~~~v~~RP~L~eFL~~l~~~yEIvIwTSa~~  185 (343)
                      +.++++++.++. ++++++|+||||||||||||+.+..+          ..++++||||++||++|+++|||+|||||++
T Consensus         2 ~~~~~~~~~~~~~~~~~~~kklLVLDLDeTLvh~~~~~~----------~~~~~kRP~l~eFL~~~~~~feIvVwTAa~~   71 (195)
T TIGR02245         2 LLRRIEQYKIKLLNPPREGKKLLVLDIDYTLFDHRSPAE----------TGEELMRPYLHEFLTSAYEDYDIVIWSATSM   71 (195)
T ss_pred             hhHHHHhcCccccCCCCCCCcEEEEeCCCceEcccccCC----------CceEEeCCCHHHHHHHHHhCCEEEEEecCCH
Confidence            457788888877 77899999999999999999865433          3478999999999999999999999999999


Q ss_pred             HHHHHHHHHHcC--CCCceEEEEEecCceeeccccccccccccceeeecccccccCCCCCCCCCCCCCCCcEEEEECCch
Q 042807          186 KNVERVVDFLMG--DMKHKLLFCWDLSYCTATSFKALENKYKALVFKELRKVWEISDPNCPWAKGDYNESNTVLLDDSPY  263 (343)
Q Consensus       186 ~ya~~il~~Ldp--~~~~~i~~vl~Rd~C~~~~~~~~e~~~k~~~vKDL~~Lw~~~~p~~p~~~G~rdl~ntIlIDDsp~  263 (343)
                      +||+++++.++.  ++.+++.++|++..|...+.    ...+..++|||+.+|++++       +.++++|||||||+|.
T Consensus        72 ~ya~~~l~~l~~~~~~~~~i~~~ld~~~~~~~~~----~~~g~~~vKdL~~lw~~l~-------~~~~~~ntiiVDd~p~  140 (195)
T TIGR02245        72 KWIEIKMTELGVLTNPNYKITFLLDSTAMITVHT----PRRGKFDVKPLGVIWALLP-------EFYSMKNTIMFDDLRR  140 (195)
T ss_pred             HHHHHHHHHhcccCCccceEEEEeccccceeeEe----eccCcEEEeecHHhhhhcc-------cCCCcccEEEEeCCHH
Confidence            999999998853  44567888886555543332    2334457999999998763       2379999999999999


Q ss_pred             hcccCCCCceecCCCCCCCCCCCCCCCccchHHHHHHHhhcCcCHHHHH
Q 042807          264 KALLNPPYTAIFPCSYKYQNPSDNSLGAGGDLRVYLEMLAEAENVQRFI  312 (343)
Q Consensus       264 ~~~~qP~NgiiIP~~f~~~~~~D~~L~~L~~L~~yL~~La~~eDVr~~l  312 (343)
                      +|.+||+|||.|+ +|.+++.+|..+.+|+.|++||+.|+.++|||++.
T Consensus       141 ~~~~~P~N~i~I~-~f~~~~~~~~~D~eL~~L~~yL~~la~~~Dvr~~~  188 (195)
T TIGR02245       141 NFLMNPQNGLKIR-PFKKAHANRGTDQELLKLTQYLKTIAELEDFSSLD  188 (195)
T ss_pred             HHhcCCCCccccC-CccccCCCCcccHHHHHHHHHHHHHhcCcccchhh
Confidence            9999999999995 68876555556667779999999999999999943



This family of sequences appears to belong to the Haloacid Dehalogenase (HAD) superfamily of enzymes by virtue of the presence of three catalytic domains, in this case: LLVLD(ILV)D(YH)T, I(VMG)IWS, and (DN)(VC)K(PA)Lx{15-17}T(IL)(MH)(FV)DD(IL)(GRS)(RK)N. Since this family has no large "cap" domain between motifs 1 and 2 or between 2 and 3, it is formally a "class III" HAD.

>KOG1605 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>KOG2832 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>KOG0323 consensus TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>KOG1872 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>COG4996 Predicted phosphatase [General function prediction only] Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PTZ00445 p36-lilke protein; Provisional Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>PLN02151 trehalose-phosphatase Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>COG2503 Predicted secreted acid phosphatase [General function prediction only] Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>PLN02580 trehalose-phosphatase Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query343
3shq_A320 Crystal Structure Of Ublcp1 Length = 320 5e-05
>pdb|3SHQ|A Chain A, Crystal Structure Of Ublcp1 Length = 320 Back     alignment and structure

Iteration: 1

Score = 45.1 bits (105), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 29/112 (25%), Positives = 55/112 (49%), Gaps = 16/112 (14%) Query: 161 RPFCHDFLRFCFERFDVGVWSSRTQKNVERVVDFL--MGDMKHKLLFCWDLSYCTATSFK 218 RP+ H+FL +E +D+ +WS+ + + +E + L + +K++F Y +T+ Sbjct: 166 RPYLHEFLTSAYEDYDIVIWSATSMRWIEEKMRLLGVASNDNYKVMF-----YLDSTAMI 220 Query: 219 ALENKYKALV-FKELRKVWEISDPNCPWAKGDYNESNTVLLDDSPYKALLNP 269 ++ + +V K L +W + YN SNT++ DD L+NP Sbjct: 221 SVHVPERGVVDVKPLGVIWALY--------KQYNSSNTIMFDDIRRNFLMNP 264

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query343
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 3e-25
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 9e-14
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 1e-13
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 5e-04
3ef1_A 442 RNA polymerase II subunit A C-terminal domain phos 5e-04
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Length = 320 Back     alignment and structure
 Score =  102 bits (256), Expect = 3e-25
 Identities = 44/205 (21%), Positives = 79/205 (38%), Gaps = 25/205 (12%)

Query: 124 RKKLLVLDLNGLLADIVSPPPKDCKADKKIARHAVFKRPFCHDFLRFCFERFDVGVWSSR 183
            KKLLVLD++  L D  SP                  RP+ H+FL   +E +D+ +WS+ 
Sbjct: 139 GKKLLVLDIDYTLFDHRSPAETGT----------ELMRPYLHEFLTSAYEDYDIVIWSAT 188

Query: 184 TQKNVERVVDFLM--GDMKHKLLFCWDLSYCTATSFKALENKYKALVFKELRKVWEISDP 241
           + + +E  +  L    +  +K++F  D +            +   +  K L  +W +   
Sbjct: 189 SMRWIEEKMRLLGVASNDNYKVMFYLDSTAM----ISVHVPERGVVDVKPLGVIWALYK- 243

Query: 242 NCPWAKGDYNESNTVLLDDSPYKALLNPPYTAIFPCSYKYQNPSDNSLGAGGDLRVYLEM 301
                   YN SNT++ DD     L+N P + +    ++  + +  +      L  YL  
Sbjct: 244 -------QYNSSNTIMFDDIRRNFLMN-PKSGLKIRPFRQAHLNRGTDTELLKLSDYLRK 295

Query: 302 LAEAENVQRFIQHNPFGQSAITNRS 326
           +A        + H  +        S
Sbjct: 296 IAHHCPDFNSLNHRKWEHYHPKKNS 320


>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Length = 181 Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Length = 195 Back     alignment and structure
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Length = 204 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Length = 372 Back     alignment and structure
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Length = 442 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query343
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 100.0
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 100.0
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 100.0
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 99.97
3ef1_A 442 RNA polymerase II subunit A C-terminal domain phos 99.93
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 99.92
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 97.46
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 97.34
3ib6_A189 Uncharacterized protein; structural genomics, unkn 97.29
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 97.21
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 97.19
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 97.14
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 96.84
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 96.53
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 96.47
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 96.43
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 96.36
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 96.31
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 96.29
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 96.14
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 96.13
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 96.09
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 96.04
3sd7_A240 Putative phosphatase; structural genomics, haloaci 96.01
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 95.91
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 95.9
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 95.77
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 95.65
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 95.65
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 95.58
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 95.48
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 95.44
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 95.36
3mmz_A176 Putative HAD family hydrolase; structural genomics 95.13
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 95.04
3mn1_A189 Probable YRBI family phosphatase; structural genom 95.03
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 95.0
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 94.89
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 94.56
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 94.52
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 94.0
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 93.76
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 93.6
2o2x_A218 Hypothetical protein; structural genomics, joint c 93.44
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 93.37
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 93.36
1l6r_A227 Hypothetical protein TA0175; structural genomics, 93.31
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 93.23
3mpo_A279 Predicted hydrolase of the HAD superfamily; SGX, P 93.07
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 92.87
4dw8_A279 Haloacid dehalogenase-like hydrolase; HAD, putativ 92.62
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 92.52
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 92.47
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 92.24
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 92.12
1nrw_A288 Hypothetical protein, haloacid dehalogenase-like h 92.04
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 91.88
3dnp_A290 Stress response protein YHAX; structural PSI-2, pr 91.75
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 91.61
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 91.03
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 90.26
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 90.24
1rkq_A282 Hypothetical protein YIDA; two domain structure wi 90.06
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 89.96
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 89.91
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 89.77
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 89.7
3dao_A283 Putative phosphatse; structural genomics, joint ce 89.66
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 89.56
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 89.37
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 89.15
3fzq_A274 Putative hydrolase; YP_001086940.1, putative haloa 89.12
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 89.1
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 88.82
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 88.78
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 88.39
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 88.3
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 88.14
2oyc_A306 PLP phosphatase, pyridoxal phosphate phosphatase; 87.72
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 87.51
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 87.08
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 86.98
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 86.4
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 86.26
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 86.25
3kc2_A 352 Uncharacterized protein YKR070W; HAD-like, mitocho 86.03
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 85.85
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 85.18
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 84.53
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 84.39
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 83.87
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 83.5
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 83.4
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 83.32
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 82.7
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 82.4
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 82.09
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 82.05
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 81.96
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 81.83
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 81.73
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 81.69
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 81.43
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 81.35
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 81.09
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 80.77
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 80.56
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 80.44
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 80.44
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=8.3e-45  Score=351.87  Aligned_cols=279  Identities=20%  Similarity=0.279  Sum_probs=195.5

Q ss_pred             eeeeccccceee---ecccchhHHHHHHHHhccCCccCCCcccccccchhhhccC-CccCccCCCC----------ccee
Q 042807           16 NITRTKTGTEIA---TRSDFGVEIKNRMEKLNQLKTIPANELHEDVRLPKMVQKN-NNMSTLSLPD----------EKYT   81 (343)
Q Consensus        16 ~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~-~~~~~~~~~~----------~k~~   81 (343)
                      +|+=.-+|.++.   ..++=.-++|.++++.+|   ||+.-+....  .|++||. .+..+.+..+          ++.+
T Consensus         7 ~i~Vk~~g~~~~v~v~~~~Tv~~lK~~I~~~tg---Vpp~~QkLi~--~k~~Gk~l~D~~~L~~~~ik~g~~l~L~gs~~   81 (320)
T 3shq_A            7 VVIVKWSGKEYPVDLTDQDTVEVLRHEIFRKTQ---VRPERQKLLN--LKYKGKTAADNVKISALELKPNFKLMMVGSTE   81 (320)
T ss_dssp             EEEEEETTEEEEEEEETTSBHHHHHHHHHHHHC---CCGGGCEETT--CBSSSSBCCTTSBTTSSCCC--CEEEEECCCC
T ss_pred             EEEEEECCEEEEEEECCCCcHHHHHHHHHHHHC---cCHHHeEEee--cccCCcccCccccHHHcCCCCCCEEEEEccch
Confidence            343334555442   334556789999999988   6666443331  1234432 2221222222          1222


Q ss_pred             ccee-----------eeccCCccccceeeecccCcc---hhhhccccCCCC-CCCCCCCcEEEEeCCCceeeecCCCCCC
Q 042807           82 AEKV-----------ISSEADETQDATLTFSYREDN---LSRISLSSQFSA-PISRLRKKLLVLDLNGLLADIVSPPPKD  146 (343)
Q Consensus        82 ~~~i-----------~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~i~~-~~~~~~KklLVLDLDeTLi~~~~~~~~~  146 (343)
                      .+.+           +..+-..+.+++.++.+++.|   +.++++++.++. +|++++|+||||||||||||+.+..   
T Consensus        82 ~~i~~~~~~p~~~~~~~eD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~k~tLVLDLDeTLvh~~~~~---  158 (320)
T 3shq_A           82 ADIEDACSLPDNIGEVVDDFDDADEREESVAHSAVYLAKVQRRVRDYKIKELAPPREGKKLLVLDIDYTLFDHRSPA---  158 (320)
T ss_dssp             ----------CCCSCCCCTTCCCCC--CCSTTSHHHHHHHHHHHHHCCCCCSSCCCTTCEEEEECCBTTTBCSSSCC---
T ss_pred             hhhcccccCCCcCCcccccCCCcccchhhhhhhhhhHHHHHHHHHhcCCCcCCCCcCCCcEEEEeccccEEcccccC---
Confidence            2211           111111224555667777766   777888999988 7889999999999999999997533   


Q ss_pred             CCCCceecceeEEeCCChHHHHHHHhcCceEEEEcCCchHHHHHHHHHHcCCCCceEEEEEecCceeecccccccccccc
Q 042807          147 CKADKKIARHAVFKRPFCHDFLRFCFERFDVGVWSSRTQKNVERVVDFLMGDMKHKLLFCWDLSYCTATSFKALENKYKA  226 (343)
Q Consensus       147 ~~~Df~~~~~~v~~RP~L~eFL~~l~~~yEIvIwTSa~~~ya~~il~~Ldp~~~~~i~~vl~Rd~C~~~~~~~~e~~~k~  226 (343)
                             .++++++||||++||++|+++|||+||||+++.||++|++.|++.....+.++++|++|.......  +.++.
T Consensus       159 -------~~~~~~~RP~l~eFL~~l~~~yeivIfTas~~~ya~~vld~Ld~~~~~~~~~~~~r~~~~~~~~~~--~~~g~  229 (320)
T 3shq_A          159 -------ETGTELMRPYLHEFLTSAYEDYDIVIWSATSMRWIEEKMRLLGVASNDNYKVMFYLDSTAMISVHV--PERGV  229 (320)
T ss_dssp             -------SSHHHHBCTTHHHHHHHHHHHEEEEEECSSCHHHHHHHHHHTTCTTCSSCCCCEEECGGGCEEEEE--TTTEE
T ss_pred             -------CCcceEeCCCHHHHHHHHHhCCEEEEEcCCcHHHHHHHHHHhCCCCCcceeEEEEEcCCccccccc--cCCCC
Confidence                   245899999999999999999999999999999999999999986532223445678875322101  22344


Q ss_pred             ceeeecccccccCCCCCCCCCCCCCCCcEEEEECCchhcccCCCCceecCCCCCCCC---CCCCCCCccchHHHHHHHhh
Q 042807          227 LVFKELRKVWEISDPNCPWAKGDYNESNTVLLDDSPYKALLNPPYTAIFPCSYKYQN---PSDNSLGAGGDLRVYLEMLA  303 (343)
Q Consensus       227 ~~vKDL~~Lw~~~~p~~p~~~G~rdl~ntIlIDDsp~~~~~qP~NgiiIP~~f~~~~---~~D~~L~~L~~L~~yL~~La  303 (343)
                      .++|||++||++|+       | |+++|||||||+|.+|.+||+|||.| .+|.+++   .+|++   |..|++||+.|+
T Consensus       230 ~~vKdLs~Lw~~~p-------~-rdl~~tIiIDdsp~~~~~~p~NgI~I-~~~~~~~~~~~~D~e---L~~L~~~L~~L~  297 (320)
T 3shq_A          230 VDVKPLGVIWALYK-------Q-YNSSNTIMFDDIRRNFLMNPKSGLKI-RPFRQAHLNRGTDTE---LLKLSDYLRKIA  297 (320)
T ss_dssp             EEECCHHHHHHHCT-------T-CCGGGEEEEESCGGGGTTSGGGEEEC-CCCCCHHHHTTTCCH---HHHHHHHHHHHH
T ss_pred             EEEEEhHHhhcccC-------C-CChhHEEEEeCChHHhccCcCceEEe-CeEcCCCCCCCccHH---HHHHHHHHHHHh
Confidence            69999999999985       4 99999999999999999999999998 4687652   45654   559999999999


Q ss_pred             -cCcCHHHHHhcCCCCCCcccCCCcchHHHHHHh
Q 042807          304 -EAENVQRFIQHNPFGQSAITNRSEYWAFYLRAM  336 (343)
Q Consensus       304 -~~eDVr~~lk~~pf~~~~I~~~~~~w~~y~~~~  336 (343)
                       .++|||+             -+|++|+.|..+.
T Consensus       298 ~~~~DVr~-------------~~~~~w~~~~~~~  318 (320)
T 3shq_A          298 HHCPDFNS-------------LNHRKWEHYHPKK  318 (320)
T ss_dssp             HHCSCGGG-------------CCGGGGGGCCC--
T ss_pred             ccCcchhH-------------HHHHHHHHhhhhh
Confidence             9999999             5788899887654



>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 343
d1ta0a_181 c.108.1.16 (A:) Carboxy-terminal domain RNA polyme 2e-21
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 181 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NLI interacting factor-like phosphatase
domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 87.8 bits (217), Expect = 2e-21
 Identities = 38/196 (19%), Positives = 71/196 (36%), Gaps = 35/196 (17%)

Query: 124 RKKLLVLDLNGLLADIVSPPPKDCK------ADKKIARHAVFKRPFCHDFLRFCFERFDV 177
            K  +V+DL+  L      P  +         D  + +  V KRP   +FL+   E F+ 
Sbjct: 14  DKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFEC 73

Query: 178 GVWSSRTQKNVERVVDFLMGDMKHKLLFCWDLSYCTATSFKALENKYKALVFKELRKVWE 237
            ++++   K  + V D L                C       +         K+L ++  
Sbjct: 74  VLFTASLAKYADPVADLLD--KWGAFRARLFRESCVFHRGNYV---------KDLSRLG- 121

Query: 238 ISDPNCPWAKGDYNESNTVLLDDSPYKALLNPPYTAIFPCSYKYQNPSDNSLGAGGDLRV 297
                        +    ++LD+SP   + + P  A+   S+ + N SD  L    DL  
Sbjct: 122 ------------RDLRRVLILDNSPASYVFH-PDNAVPVASW-FDNMSDTEL---HDLLP 164

Query: 298 YLEMLAEAENVQRFIQ 313
           + E L+  ++V   ++
Sbjct: 165 FFEQLSRVDDVYSVLR 180


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query343
d1ta0a_181 Carboxy-terminal domain RNA polymerase II polypept 100.0
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 97.84
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 97.15
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 97.14
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 96.99
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 96.88
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 96.72
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 96.54
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 96.54
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 96.32
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 96.29
d1xpja_124 Hypothetical protein VC0232 {Vibrio cholerae [TaxI 96.26
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 96.21
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 95.09
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 94.48
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 94.47
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 94.17
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 93.73
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 93.2
d1nrwa_285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 93.1
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 92.82
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 92.71
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 92.61
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 92.41
d1vjra_261 Hypothetical protein TM1742 {Thermotoga maritima [ 91.67
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 91.58
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 91.37
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 90.28
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 90.13
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 89.21
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 89.15
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 88.89
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 87.74
d1yv9a1253 Putative hydrolase EF1188 {Enterococcus faecalis [ 87.4
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 87.03
d1wvia_253 Putative phosphatase SMU.1415c {Streptococcus muta 86.81
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 85.63
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 82.2
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 82.03
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NLI interacting factor-like phosphatase
domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=5.2e-41  Score=298.10  Aligned_cols=171  Identities=22%  Similarity=0.274  Sum_probs=145.9

Q ss_pred             ccCCCC-CCCCCCCcEEEEeCCCceeeecCCCCCCCCCCce--------ecceeEEeCCChHHHHHHHhcCceEEEEcCC
Q 042807          113 SSQFSA-PISRLRKKLLVLDLNGLLADIVSPPPKDCKADKK--------IARHAVFKRPFCHDFLRFCFERFDVGVWSSR  183 (343)
Q Consensus       113 ~~~i~~-~~~~~~KklLVLDLDeTLi~~~~~~~~~~~~Df~--------~~~~~v~~RP~L~eFL~~l~~~yEIvIwTSa  183 (343)
                      ++.+++ ++...+|+||||||||||||+......  .+|+.        ...+++++|||+++||++|+++|||+|||||
T Consensus         2 ~~llp~~~~~~~~k~~LVLDLDeTLihs~~~~~~--~~~~~~~~~~~~~~~~~~v~~RP~l~eFL~~l~~~yei~I~Ta~   79 (181)
T d1ta0a_           2 QYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVN--NADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTAS   79 (181)
T ss_dssp             CCSSCCCCGGGTTSCEEEECCBTTTEEEESSCCT--TCSEEEEEEETTEEEEEEEEECTTHHHHHHHHHHHSEEEEECSS
T ss_pred             CccCCCCCcccCCCeEEEEeCCCCEEccccCCCC--CccceeeecccceeeeeEEecCCCHHHHHHHHHhceEEEEEcCC
Confidence            345665 455678999999999999999765432  33432        3467999999999999999999999999999


Q ss_pred             chHHHHHHHHHHcCCCCceEEEEEecCceeeccccccccccccceeeecccccccCCCCCCCCCCCCCCCcEEEEECCch
Q 042807          184 TQKNVERVVDFLMGDMKHKLLFCWDLSYCTATSFKALENKYKALVFKELRKVWEISDPNCPWAKGDYNESNTVLLDDSPY  263 (343)
Q Consensus       184 ~~~ya~~il~~Ldp~~~~~i~~vl~Rd~C~~~~~~~~e~~~k~~~vKDL~~Lw~~~~p~~p~~~G~rdl~ntIlIDDsp~  263 (343)
                      ++.||++|++.|+|+.  .+.++|+|++|...+.         .++|||+++            | |++++||||||++.
T Consensus        80 ~~~YA~~il~~ldp~~--~~~~~~~r~~c~~~~~---------~~~KdL~~l------------~-~~l~~vvivDd~~~  135 (181)
T d1ta0a_          80 LAKYADPVADLLDKWG--AFRARLFRESCVFHRG---------NYVKDLSRL------------G-RDLRRVLILDNSPA  135 (181)
T ss_dssp             CHHHHHHHHHHHCSSC--CEEEEECGGGSEEETT---------EEECCGGGS------------C-SCGGGEEEECSCGG
T ss_pred             cHHHHHHHHHHhccCC--ceeEEEEeeeeeecCC---------cccccHhhc------------C-CCHHHeEEEcCChh
Confidence            9999999999999965  4778999999986543         489999999            4 99999999999999


Q ss_pred             hcccCCCCceecCCCCCCCCCCCCCCCccchHHHHHHHhhcCcCHHHHHhc
Q 042807          264 KALLNPPYTAIFPCSYKYQNPSDNSLGAGGDLRVYLEMLAEAENVQRFIQH  314 (343)
Q Consensus       264 ~~~~qP~NgiiIP~~f~~~~~~D~~L~~L~~L~~yL~~La~~eDVr~~lk~  314 (343)
                      ++..||+|+|.| .+|.++ .+|++|.   .|++||+.|+.++|||++|++
T Consensus       136 ~~~~~~~N~I~I-~~f~~~-~~D~eL~---~l~~~L~~l~~~~DVR~~l~~  181 (181)
T d1ta0a_         136 SYVFHPDNAVPV-ASWFDN-MSDTELH---DLLPFFEQLSRVDDVYSVLRQ  181 (181)
T ss_dssp             GGTTCGGGBCCC-CCCSSC-TTCCHHH---HHHHHHHHHTTCSCHHHHHCC
T ss_pred             hhhcCccCeeEe-cCcCCC-CCcHHHH---HHHHHHHHHccCCcHHHHhcC
Confidence            999999999998 468764 5687665   999999999999999999974



>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure