Citrus Sinensis ID: 042811

---

Local Sequence Feature Prediction

Residue Number Marker
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
Protein Sequence
MNRLHKIQMGLTRVQALETEVDNLGGYYFMNCKSSYEFGKKLAKKLQVLANLKEEENYEDVADRLSEDSVDDRPVETTKLGDVRRNGNNWPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVRDMSL
Secondary Structure (PSIPRED)
cccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEcccccccccccccccccHHHHHHHHHHHHHHccccccEEEEEEEccccc
Secondary Structure Prediction (SSPRO)
cccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccccccccccccccEcccHHHHHHHHHcccccccHHHHHHHHHHHHHccccccEEEEEEEEEcccc
Coil and Loop (DISEMBL)
MNRLHKIQMGLTRVQALETEVDNlggyyfmncksSYEFGKKLAKKLQVLANLKEEENYEDVADRlsedsvddrpvettklgdvrrngnnwpfgveGVGKITslsksypefledegIFLIKMHDVVRDMSL
Flexible Loop (DISEMBL)
MNRLHKIQMGLTRVQALETEVDNLGGYYFMNCKSSYEFGKKLAKKLQVLANLKEEENYEDVadrlsedsvddrpvettklgdvrrngnnwpfgveGVGKITSLSKSYPefledegifliKMHDVVRDMSL
Low Complexity Region (SEG)
MNRLHKIQMGLTRVQALETEVDNLGGYYFMNCKSSYEFGKKLAKKLQVLANLKEEENYEDVADRLSEDSVDDRPVETTKLGDVRRNGNNWPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVRDMSL
Disordered region (IsUnstruct)
******IQMGLTRVQALETEVDNLGGYYFMNCKSSYEFGKKLAKKLQVLANL*******************************RRNGNNWPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVV*****
Disordered Region (DISOPRED)
*NRLHKIQMGLTRVQALETEVDNLGGYYFMNCKSSYEFGKKLAKKLQVLANLKEEENYEDVADRLSEDSVDDRPVETTKLGDVRRNGNNWPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVRDMSL
Disordered Region (DISEMBL)
MNRLHKIQMGLTRVQALETEVDNLGGYYFMNCKSSYEFGKKLAKKLQVLANLKEEENYEDVADRLSEDSVDDRPVETTKLGDVRRNGNNWPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVRDMSL
Disordered Region (DISPRO)
*NRLHKIQMGLTRVQALETEVDNLGGYYFMNCKSSYEFGKKLAKKLQVLANLKEEENYEDVADRLSEDSVDDRPVETTKLGDVRRNGNNWPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVRDMSL
Transmembrane Helix (TMHMM)
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Transmembrane Helix (HMMTOP)
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Transmembrane Helix (MEMSAT)
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
TM Helix, Signal Peptide (MEMSAT_SVM)
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
TM Helix, Signal Peptide (Phobius)
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
Signal Peptide (SignalP HMM Mode)
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Signal Peptide (SignalP NN Mode)
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Coiled Coils (COILS)
MNRLHKIQMGLTRVQALETEVDNLGGYYFMNCKSSYEFGKKLAKKLQVLANLKEEENYEDVADRLSEDSVDDRPVETTKLGDVRRNGNNWPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVRDMSL
Positional Conservation
no confident homologs detected

---

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query	130	2.2.26 [Sep-21-2011]
P60839	884	Probable disease resistan	yes	no	1.0	0.147	0.237	2e-05
O22727	967	Probable disease resistan	no	no	0.946	0.127	0.268	0.0001
O64789	925	Probable disease resistan	no	no	0.946	0.132	0.275	0.0002
Q9FG91	848	Probable disease resistan	no	no	0.946	0.145	0.273	0.0004
Q8L3R3	885	Disease resistance protei	no	no	0.946	0.138	0.243	0.0006

>sp|P60839|DRL2_ARATH Probable disease resistance protein At1g12290 OS=Arabidopsis thaliana GN=At1g12290 PE=2 SV=1

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 76/156 (48%), Gaps = 26/156 (16%)

Query: 1   MNRLHKIQMGLTRVQALETEVDNL-------------GGYYFMNCKSSYEFGKKLAKKLQ 47
           + RLH+I++ L RV+ +E++ ++L              G    N + SY++G+++   L 
Sbjct: 65  LQRLHQIKVWLKRVKTIESQFNDLDSSRTVELQRLCCCGVGSRNLRLSYDYGRRVFLMLN 124

Query: 48  VLANLKEEENYEDVADRLSEDSVDDRPVETTKLGDVRRNGNNWP------------FGVE 95
           ++ +LK +  +E+VA   +    ++RP++ T +G        W             +G+ 
Sbjct: 125 IVEDLKSKGIFEEVAHPATRAVGEERPLQPTIVGQETILEKAWDHLMDDGTKIMGLYGMG 184

Query: 96  GVGKITSLSKSYPEFLE-DEGIFLIKMHDVVRDMSL 130
           GVGK T L++    F + D+G+ ++    V  D+ +
Sbjct: 185 GVGKTTLLTQINNRFCDTDDGVEIVIWVVVSGDLQI 220

Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)

>sp|O22727|DRL16_ARATH Probable disease resistance protein At1g61190 OS=Arabidopsis thaliana GN=At1g61190 PE=3 SV=1

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 64/149 (42%), Gaps = 26/149 (17%)

Query: 2   NRLHKIQMGLTRVQALETEVDNL-------------GGYYFMNCKSSYEFGKKLAKKLQV 48
            RL  +Q+ L RV +++ E  +L              G       SSY++GK++   L+ 
Sbjct: 65  QRLEAVQVWLDRVNSIDIECKDLLSVSPVELQKLCLCGLCSKYVCSSYKYGKRVFLLLEE 124

Query: 49  LANLKEEENYEDVADRLSEDSVDDRPVETTKLGDVRRNGNNWP------------FGVEG 96
           +  LK E N+++V+       V++RP + T +G        W              G+ G
Sbjct: 125 VTKLKSEGNFDEVSQPPPRSEVEERPTQPT-IGQEEMLKKAWNRLMEDGVGIMGLHGMGG 183

Query: 97  VGKITSLSKSYPEFLEDEGIFLIKMHDVV 125
           VGK T   K + +F E  G F I +  VV
Sbjct: 184 VGKTTLFKKIHNKFAETGGTFDIVIWIVV 212

Probable disease resistance protein.

Arabidopsis thaliana (taxid: 3702)

>sp|O64789|DRL18_ARATH Probable disease resistance protein At1g61310 OS=Arabidopsis thaliana GN=At1g61310 PE=2 SV=1

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 64/149 (42%), Gaps = 26/149 (17%)

Query: 2   NRLHKIQMGLTRVQALETEVDNL-------------GGYYFMNCKSSYEFGKKLAKKLQV 48
            RL  +Q+ L RV +++ E  +L              G       SSY++GKK+   L+ 
Sbjct: 66  QRLEAVQVWLDRVNSIDIECKDLLSVSPVELQKLCLCGLCTKYVCSSYKYGKKVFLLLEE 125

Query: 49  LANLKEEENYEDVADRLSEDSVDDRPVETTKLGDVRRNGNNWP------------FGVEG 96
           +  LK E N+++V+       V++RP + T +G        W              G+ G
Sbjct: 126 VKILKSEGNFDEVSQPPPRSEVEERPTQPT-IGQEEMLEKAWNRLMEDGVGIMGLHGMGG 184

Query: 97  VGKITSLSKSYPEFLEDEGIFLIKMHDVV 125
           VGK T   K + +F E  G F I +  VV
Sbjct: 185 VGKTTLFKKIHNKFAEIGGTFDIVIWIVV 213

Probable disease resistance protein.

Arabidopsis thaliana (taxid: 3702)

>sp|Q9FG91|DRL32_ARATH Probable disease resistance protein At5g43730 OS=Arabidopsis thaliana GN=At5g43730 PE=2 SV=1

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 70/150 (46%), Gaps = 27/150 (18%)

Query: 1   MNRLHKIQMGLTRVQALETEVDNL-------------GGYYFMNCKSSYEFGKKLAKKLQ 47
           + RL  +   L+RVQ +E+E  +L              GY   +C SSY +G K+ K L+
Sbjct: 64  LQRLALVNGWLSRVQIVESEFKDLLEAMSIETGRLCLFGYCSEDCISSYNYGGKVMKNLE 123

Query: 48  VLANLKEEENYEDVADRLSEDSVDDRPVETTKLGDVRRNGNNWP------------FGVE 95
            +  L  ++N+E VA ++   + + + ++TT +G     G  W             +G+ 
Sbjct: 124 EVKELLSKKNFEVVAQKIIPKA-EKKHIQTT-VGLDTMVGIAWESLIDDEIRTLGLYGMG 181

Query: 96  GVGKITSLSKSYPEFLEDEGIFLIKMHDVV 125
           G+GK T L     +F+E E  F + +  VV
Sbjct: 182 GIGKTTLLESLNNKFVELESEFDVVIWVVV 211

Probable disease resistance protein.

Arabidopsis thaliana (taxid: 3702)

>sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 68/148 (45%), Gaps = 25/148 (16%)

Query: 3   RLHKIQMGLTRVQALETEVDNL-------------GGYYFMNCKSSYEFGKKLAKKLQVL 49
           RL ++Q+ LTR+Q +E + ++L              G+   N K SY +GK++   L+ +
Sbjct: 68  RLAQVQVWLTRIQTIENQFNDLLSTCNAEIQRLCLCGFCSKNVKMSYLYGKRVIVLLREV 127

Query: 50  ANLKEEENYEDVADRLSEDSVDDRPVETTKLGDVRRNGNNWP------------FGVEGV 97
             L  +  ++ V +      V++ P+++T +G        W             +G+ GV
Sbjct: 128 EGLSSQGVFDIVTEAAPIAEVEELPIQSTIVGQDSMLDKVWNCLMEDKVWIVGLYGMGGV 187

Query: 98  GKITSLSKSYPEFLEDEGIFLIKMHDVV 125
           GK T L++   +F +  G F + +  VV
Sbjct: 188 GKTTLLTQINNKFSKLGGGFDVVIWVVV 215

Disease resistance (R) protein.

Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Length	Definition	Q cover	H cover	Identity	E-value
Query	130
24461861	890	NBS-LRR type disease resistance protein	1.0	0.146	0.365	2e-13
408683737	580	NBS-LRR disease resistance protein NBS39	0.992	0.222	0.360	5e-12
24461866	890	NBS-LRR type disease resistance protein	0.9	0.131	0.345	3e-11
147782775	778	hypothetical protein VITISV_017286 [Viti	0.953	0.159	0.353	6e-09
225443158	903	PREDICTED: probable disease resistance p	0.953	0.137	0.326	7e-09
24461864	899	NBS-LRR type disease resistance protein	0.853	0.123	0.348	3e-08
24461865	892	NBS-LRR type disease resistance protein	0.876	0.127	0.351	5e-08
359482574	888	PREDICTED: probable disease resistance p	0.961	0.140	0.322	3e-07
255553135	894	Disease resistance protein RFL1, putativ	0.992	0.144	0.321	3e-07
359482577	895	PREDICTED: probable disease resistance p	0.730	0.106	0.367	3e-07

>gi|24461861|gb|AAN62348.1|AF506028_15 NBS-LRR type disease resistance protein [Citrus trifoliata]

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/156 (36%), Positives = 85/156 (54%), Gaps = 26/156 (16%)

Query: 1   MNRLHKIQMGLTRVQALETEVDN-------------LGGYYFMNCKSSYEFGKKLAKKLQ 47
           M RL ++Q+ ++RV+ +ETE D              LGGY   NCKSSY+FGK++A+KL+
Sbjct: 66  MRRLDQVQVWVSRVETVETEADAFIGDGTQEIEKLCLGGYCSKNCKSSYKFGKQVARKLR 125

Query: 48  VLANLKEEENYEDVADRLSEDSVDDRPVETTKLG------DVRRNGNNWP------FGVE 95
            +  L  E  +E VAD++ E +VD+RP E T +G      +V R     P      +G+ 
Sbjct: 126 DIKTLMGEGVFEVVADKVPEPAVDERPTEPTVVGLQSQLEEVWRCLVEEPVGIVGLYGMG 185

Query: 96  GVGKITSLSKSYPEFLEDEGIF-LIKMHDVVRDMSL 130
           GVGK T L+    +FL     F L+ +  V +D+ L
Sbjct: 186 GVGKTTLLTHINNKFLGSPTNFDLVILVVVSKDLRL 221

Source: Citrus trifoliata

Species: Citrus trifoliata

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|408683737|gb|AFM77964.2| NBS-LRR disease resistance protein NBS39 [Dimocarpus longan]

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 88/172 (51%), Gaps = 43/172 (25%)

Query: 1   MNRLHKIQMGLTRVQALETEVDNL-------------GGYYFMNCKSSYEFGKKLAKKLQ 47
           M RLH++Q  L+RV+A ETEVD L             GGY   N KSSY++GKK+A+KLQ
Sbjct: 1   MKRLHQVQGWLSRVEAEETEVDKLIKDSAQEIEKLCLGGYCSWNIKSSYKYGKKIAQKLQ 60

Query: 48  VLANLKEEENYEDVADRLSEDS----------------VDDRPVETT------------K 79
           V++ LKEE  +  VA+  S +                 VD+RP E T             
Sbjct: 61  VVSKLKEEGCFPTVAEIWSREDPMDEPITGERILPQIVVDERPCEPTVGLETTFDAVWRY 120

Query: 80  LGDVRRNGNNWPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVV-RDMSL 130
           LG+ ++ G    +G+ GVGK T L++   +F++    F I M  VV +D+ L
Sbjct: 121 LGE-KQVGVIGLYGMGGVGKTTLLTQINNKFVDVSNDFDIVMWVVVSKDLQL 171

Source: Dimocarpus longan

Species: Dimocarpus longan

Genus: Dimocarpus

Family: Sapindaceae

Order: Sapindales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|24461866|gb|AAN62353.1|AF506028_20 NBS-LRR type disease resistance protein [Citrus trifoliata]

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 74/142 (52%), Gaps = 25/142 (17%)

Query: 1   MNRLHKIQMGLTRVQALETEVDNL-------------GGYYFMNCKSSYEFGKKLAKKLQ 47
           M+RL+++Q  ++RV+A++ E D L              GY   NCKSSY+FGKK+ KKLQ
Sbjct: 65  MSRLNQVQGWVSRVEAVKAEADQLIRVGSQEIERLCLWGYCSKNCKSSYDFGKKVTKKLQ 124

Query: 48  VLANLKEEENYEDVADRLSEDSVDDRPVETTKLGDVRRNGNNW------P------FGVE 95
           ++  L  E  +E VA+++   +  +RP E T +G   +    W      P      +G+ 
Sbjct: 125 LVETLMGEGIFEVVAEKVPGAAATERPTEPTVIGLQSQLEQVWRCLVEEPAGIVGLYGMG 184

Query: 96  GVGKITSLSKSYPEFLEDEGIF 117
           GVGK T L+    +FLE    F
Sbjct: 185 GVGKTTLLTHINNKFLESTTNF 206

Source: Citrus trifoliata

Species: Citrus trifoliata

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147782775|emb|CAN76822.1| hypothetical protein VITISV_017286 [Vitis vinifera]

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 74/150 (49%), Gaps = 26/150 (17%)

Query: 1   MNRLHKIQMGLTRVQALETEVDNL-------------GGYYFMNCKSSYEFGKKLAKKLQ 47
           + +L +++   +RV+ +ETE   L             GGY   NC SSY  GKKLAKK++
Sbjct: 65  LEQLDQVRRWFSRVEDVETEASQLIKDGTTEIQKLCLGGYCSRNCISSYRLGKKLAKKVE 124

Query: 48  VLANLKEEENYEDVADRLSEDSVDDRPVETTKLGDVRRNGNNWP-FGVE----------- 95
            L NL+    ++ VADRL   SVD+RP E T +G +      W   G E           
Sbjct: 125 DLNNLRSTRLFDMVADRLPPASVDERPSEPT-VGMMSTFNKVWSCLGEEQVGIIGLYGLG 183

Query: 96  GVGKITSLSKSYPEFLEDEGIFLIKMHDVV 125
           GVGK T L++   EFL+    F + +  VV
Sbjct: 184 GVGKTTLLTQINNEFLKTTHDFDVVIWAVV 213

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225443158|ref|XP_002263674.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera]

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 49/150 (32%), Positives = 72/150 (48%), Gaps = 26/150 (17%)

Query: 1   MNRLHKIQMGLTRVQALETEVDNL-------------GGYYFMNCKSSYEFGKKLAKKLQ 47
           M +L ++Q   +R +A+E EVD L             GG    NC SSY+ G+KL KK  
Sbjct: 65  MEQLDQVQRWFSRAEAMELEVDQLIRDGTRETQKFCLGGCCSKNCLSSYKLGRKLVKKAD 124

Query: 48  VLANLKEEENYEDVADRLSEDSVDDRPVETTKLGDVRRNGNNWP------------FGVE 95
            +A L+    ++ +ADRL   +VD+RP E T +G        W             +G+ 
Sbjct: 125 DVATLRSTRLFDGLADRLPPPAVDERPSEPT-VGFESTIDEVWSCLREEQVQIIGLYGMG 183

Query: 96  GVGKITSLSKSYPEFLEDEGIFLIKMHDVV 125
           GVGK T +++   EFL+    F I +  VV
Sbjct: 184 GVGKTTLMTQVNNEFLKTIHQFDIVIWVVV 213

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|24461864|gb|AAN62351.1|AF506028_18 NBS-LRR type disease resistance protein [Citrus trifoliata]

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 67/135 (49%), Gaps = 24/135 (17%)

Query: 1   MNRLHKIQMGLTRVQALETEVDNL-------------GGYYFMNCKSSYEFGKKLAKKLQ 47
           M RL+++Q+ L+RV A+    D L             GGY   NCKSS +FGK++ KKL 
Sbjct: 67  MTRLNEVQLWLSRVDAVTAGADELIRIGSQEIEKLCLGGYCSKNCKSSKKFGKQVDKKLS 126

Query: 48  VLANLKEEENYEDVADRLSEDSVDDRPVET-----TKLGDVRRNGNNWP------FGVEG 96
            +  L  E ++  VA R  E   D+RP+E      ++L  V R     P      +G+ G
Sbjct: 127 DVKILLAEGSFAVVAQRAPESVADERPIEPAVGIQSQLEQVWRCLVEEPVGIVGLYGMGG 186

Query: 97  VGKITSLSKSYPEFL 111
           VGK T L+    +FL
Sbjct: 187 VGKTTLLTHLNNKFL 201

Source: Citrus trifoliata

Species: Citrus trifoliata

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|24461865|gb|AAN62352.1|AF506028_19 NBS-LRR type disease resistance protein [Citrus trifoliata]

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 76/145 (52%), Gaps = 31/145 (21%)

Query: 1   MNRLHKIQMGLTRVQALETEVDNL-------------GGYYFMNCKSSYEFGKKLAKKLQ 47
           M RL+K+Q  L+RV+A +++ D L             GGY   NCKSSYEFGK++A+KL 
Sbjct: 65  MKRLNKVQGWLSRVEAAKSDGDKLITCGSQEIKKLCLGGYCSKNCKSSYEFGKQVARKLG 124

Query: 48  VLANLKEEENYEDVADRLSEDSVDDRPVETTKLG---------------DVRRNGNNWPF 92
            +  L  EE +E VA+ + + +VD+RP E T +G                 R  G    +
Sbjct: 125 DVKTLMAEEAFEAVAEEVPQPAVDERPTEPTVVGLQSQFEQVCNCLEEESARIVG---LY 181

Query: 93  GVEGVGKITSLSKSYPEFLEDEGIF 117
           G+ GVGK T L+  + +F++    F
Sbjct: 182 GMGGVGKTTLLTHIHNKFIQSPTNF 206

Source: Citrus trifoliata

Species: Citrus trifoliata

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359482574|ref|XP_003632788.1| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera]

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 69/149 (46%), Gaps = 24/149 (16%)

Query: 1   MNRLHKIQMGLTRVQALETEV-------------DNLGGYYFMNCKSSYEFGKKLAKKLQ 47
           M R H++   L RVQ LE EV               LG     NC+SS + GK  +KKL 
Sbjct: 62  MRRTHEVDGWLHRVQVLEKEVREILQKGDQEIQQKCLGTCCPKNCRSSNKMGKITSKKLG 121

Query: 48  VLANLKEEENYEDVADRLSEDSVDDRPVETT-----KLGDVRRN------GNNWPFGVEG 96
            +  L+ +  + DVADRL   +VD+RP+E T        +V R       G    +G+ G
Sbjct: 122 AVTKLRSKGCFSDVADRLPRAAVDERPIEKTVGLDRMYAEVCRCIQDEQLGIIGLYGMGG 181

Query: 97  VGKITSLSKSYPEFLEDEGIFLIKMHDVV 125
            GK T ++K   E+ +    F + +  VV
Sbjct: 182 AGKTTLVTKVNNEYFKTCNDFEVAIWVVV 210

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255553135|ref|XP_002517610.1| Disease resistance protein RFL1, putative [Ricinus communis] gi|223543242|gb|EEF44774.1| Disease resistance protein RFL1, putative [Ricinus communis]

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 77/146 (52%), Gaps = 17/146 (11%)

Query: 1   MNRLHKIQMGLTRVQALETEVDNL---GGYYFMNCKSSYEFGKKLAKKLQVLANLKEEEN 57
           M RL ++Q  ++R +A  TEVD L   G    +NCKS Y FG+ +AKKL+ +  +K + +
Sbjct: 64  MKRLKQVQGWISRAEAKITEVDELIKEGLPKILNCKSRYIFGRSVAKKLEDVIAMKRKGD 123

Query: 58  YEDVADRLSEDSVDDRPVETTKLGDVRRNGNNWP------------FGVEGVGKITSLSK 105
           ++ VA+R + ++V +RP E T +G        W             +G+ GVGK T L++
Sbjct: 124 FKVVAERAAGEAVVERPSEPT-VGLESILNRVWKCLVEEEVGVVGIYGMGGVGKTTILTQ 182

Query: 106 SYPEFLEDEGIFLIKMHDVV-RDMSL 130
               F+     F+  +  VV +D+ L
Sbjct: 183 INNMFVTSPNDFVAVIWVVVSKDLRL 208

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359482577|ref|XP_002278676.2| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera]

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 58/106 (54%), Gaps = 11/106 (10%)

Query: 31  NCKSSYEFGKKLAKKLQVLANLKEEENYEDVADRLSEDSVDDRPVETTKLGDV------- 83
           NC+SSY+ GKK +KKL  +  L+ +  ++ VADRLS+  VD+RP+E T   D+       
Sbjct: 104 NCRSSYKLGKKASKKLGDVTELRSKGRFDVVADRLSQAPVDERPMEKTVGLDLMFTEVCR 163

Query: 84  ----RRNGNNWPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVV 125
                + G    +G+ G GK T ++K   EF+    IF I +  VV
Sbjct: 164 CIQHEKLGIIGLYGMGGAGKTTLMTKVNNEFIRASKIFEIAIWVVV 209

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Phylum: Streptophyta

Superkingdom: Eukaryota

---

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Length	Definition	Q cover	H cover	Identity	E-value
Query	130
TAIR|locus:2034765	884	AT1G12290 [Arabidopsis thalian	0.915	0.134	0.241	1.1e-07
TAIR|locus:2170902	862	AT5G43740 [Arabidopsis thalian	0.953	0.143	0.281	7e-07
TAIR|locus:2008510	967	AT1G61190 "AT1G61190" [Arabido	0.7	0.094	0.298	2.9e-06
TAIR|locus:2170892	848	AT5G43730 [Arabidopsis thalian	0.907	0.139	0.285	0.00031
TAIR|locus:2031366	898	AT1G63350 "AT1G63350" [Arabido	0.746	0.108	0.264	0.00046

TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)]

 Score = 106 (42.4 bits), Expect = 1.1e-07, Sum P(2) = 1.1e-07
 Identities = 35/145 (24%), Positives = 72/145 (49%)

Query:     1 MNRLHKIQMGLTRVQALETEVDNLG-------------GYYFMNCKSSYEFGKKLAKKLQ 47
             + RLH+I++ L RV+ +E++ ++L              G    N + SY++G+++   L 
Sbjct:    65 LQRLHQIKVWLKRVKTIESQFNDLDSSRTVELQRLCCCGVGSRNLRLSYDYGRRVFLMLN 124

Query:    48 VLANLKEEENYEDVADRLSEDSVDDRPVETTKLGDVRRNGNNWP------------FGVE 95
             ++ +LK +  +E+VA   +    ++RP++ T +G        W             +G+ 
Sbjct:   125 IVEDLKSKGIFEEVAHPATRAVGEERPLQPTIVGQETILEKAWDHLMDDGTKIMGLYGMG 184

Query:    96 GVGKITSLSKSYPEFLE-DEGIFLI 119
             GVGK T L++    F + D+G+ ++
Sbjct:   185 GVGKTTLLTQINNRFCDTDDGVEIV 209

GO:0005634 "nucleus" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0043531 "ADP binding" evidence=IEA

GO:0006499 "N-terminal protein myristoylation" evidence=RCA

TAIR|locus:2170902 AT5G43740 [Arabidopsis thaliana (taxid:3702)]

 Score = 99 (39.9 bits), Expect = 7.0e-07, Sum P(2) = 7.0e-07
 Identities = 42/149 (28%), Positives = 74/149 (49%)

Query:     1 MNRLHKIQMGLTRVQALETEVDNL--------G-----GYYFMNCKSSYEFGKKLAKKLQ 47
             + RL ++   L+RVQ +E+E  +L        G     GY   +C SSY +G+K++K L+
Sbjct:    63 LQRLAQVNGWLSRVQIVESEFKDLLEAMSIETGRLCLLGYCSEDCISSYNYGEKVSKMLE 122

Query:    48 VLANLKEEENYEDVADRLSEDSVDDRPVETT----KLGDVRRN-------GNNWPFGVEG 96
              +  L  ++++  VA  +    V+ + ++TT    KL ++  +       G    +G+ G
Sbjct:   123 EVKELLSKKDFRMVAQEIIH-KVEKKLIQTTVGLDKLVEMAWSSLMNDEIGTLGLYGMGG 181

Query:    97 VGKITSLSKSYPEFLEDEGIFLIKMHDVV 125
             VGK T L     +F+E E  F + +  VV
Sbjct:   182 VGKTTLLESLNNKFVELESEFDVVIWVVV 210

GO:0006952 "defense response" evidence=IEA;ISS

GO:0043531 "ADP binding" evidence=IEA

TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)]

 Score = 100 (40.3 bits), Expect = 2.9e-06, Sum P(2) = 2.9e-06
 Identities = 31/104 (29%), Positives = 49/104 (47%)

Query:    34 SSYEFGKKLAKKLQVLANLKEEENYEDVADRLSEDSVDDRPVETTKLGDVRRNGNNWP-- 91
             SSY++GK++   L+ +  LK E N+++V+       V++RP + T +G        W   
Sbjct:   110 SSYKYGKRVFLLLEEVTKLKSEGNFDEVSQPPPRSEVEERPTQPT-IGQEEMLKKAWNRL 168

Query:    92 ----------FGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVV 125
                        G+ GVGK T   K + +F E  G F I +  VV
Sbjct:   169 MEDGVGIMGLHGMGGVGKTTLFKKIHNKFAETGGTFDIVIWIVV 212

GO:0005575 "cellular_component" evidence=ND

GO:0006952 "defense response" evidence=IEA;ISS

GO:0043531 "ADP binding" evidence=IEA

TAIR|locus:2170892 AT5G43730 [Arabidopsis thaliana (taxid:3702)]

 Score = 101 (40.6 bits), Expect = 0.00031, P = 0.00031
 Identities = 38/133 (28%), Positives = 64/133 (48%)

Query:    11 LTRVQALETEVDNLGGYYFMNCKSSYEFGKKLAKKLQVLANLKEEENYEDVADRLSEDSV 70
             L    ++ET    L GY   +C SSY +G K+ K L+ +  L  ++N+E VA ++   + 
Sbjct:    87 LLEAMSIETGRLCLFGYCSEDCISSYNYGGKVMKNLEEVKELLSKKNFEVVAQKIIPKA- 145

Query:    71 DDRPVETTKLGDVRRNGNNWP------------FGVEGVGKITSLSKSYPEFLEDEGIFL 118
             + + ++TT +G     G  W             +G+ G+GK T L     +F+E E  F 
Sbjct:   146 EKKHIQTT-VGLDTMVGIAWESLIDDEIRTLGLYGMGGIGKTTLLESLNNKFVELESEFD 204

Query:   119 IKMHDVV-RDMSL 130
             + +  VV +D  L
Sbjct:   205 VVIWVVVSKDFQL 217

GO:0006952 "defense response" evidence=IEA;ISS

GO:0043531 "ADP binding" evidence=IEA

TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)]

 Score = 86 (35.3 bits), Expect = 0.00046, Sum P(2) = 0.00046
 Identities = 27/102 (26%), Positives = 51/102 (50%)

Query:     1 MNRLHKIQMGLTRV-QALETEVDNLG--GYYFMNCKSSYEFGKKLAKKLQVLANLKEEEN 57
             +NR+  I+  +  +  A   E+  L   G+   +  +SY +GK +  KL+ +  L E   
Sbjct:    73 LNRVETIESRVNDLLNARNAELQRLCLCGFCSKSLTTSYRYGKSVFLKLREVEKL-ERRV 131

Query:    58 YEDVADRLSEDSVDDRPVETTKLGDVRRNGNNWPFGVE-GVG 98
             +E ++D+ S   V+++ ++ T +G      N W   +E GVG
Sbjct:   132 FEVISDQASTSEVEEQQLQPTIVGQETMLDNAWNHLMEDGVG 173

GO:0005575 "cellular_component" evidence=ND

GO:0006952 "defense response" evidence=IEA;ISS

GO:0043531 "ADP binding" evidence=IEA

---

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

---

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

---

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Length	Definition	Probability
Query	130
KOG4658	889	consensus Apoptotic ATPase [Signal transduction me	99.86
PF00931	287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	99.14
PLN03210	1153	Resistant to P. syringae 6; Provisional	99.06
PRK09376	416	rho transcription termination factor Rho; Provisio	98.6
cd01128	249	rho_factor Transcription termination factor rho is	98.56
PRK08118	167	topology modulation protein; Reviewed	98.19
TIGR00767	415	rho transcription termination factor Rho. Members	97.9
PRK11331	459	5-methylcytosine-specific restriction enzyme subun	97.84
PRK07261	171	topology modulation protein; Provisional	97.65
PF13207	121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	97.5
COG2256	436	MGS1 ATPase related to the helicase subunit of the	97.47
PF13191	185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	97.41
PRK00411	394	cdc6 cell division control protein 6; Reviewed	97.4
TIGR02928	365	orc1/cdc6 family replication initiation protein. M	97.3
KOG2028	554	consensus ATPase related to the helicase subunit o	97.23
PF05496	233	RuvB_N: Holliday junction DNA helicase ruvB N-term	97.23
cd00009	151	AAA The AAA+ (ATPases Associated with a wide varie	97.19
TIGR03420	226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	97.18
TIGR03015	269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	97.1
PRK06893	229	DNA replication initiation factor; Validated	97.09
PRK03839	180	putative kinase; Provisional	97.07
PRK05541	176	adenylylsulfate kinase; Provisional	97.06
TIGR02903	615	spore_lon_C ATP-dependent protease, Lon family. Me	97.03
PF05729	166	NACHT: NACHT domain	97.02
PF01637	234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	97.01
COG1618	179	Predicted nucleotide kinase [Nucleotide transport	96.99
COG2255	332	RuvB Holliday junction resolvasome, helicase subun	96.95
PF01583	156	APS_kinase: Adenylylsulphate kinase; InterPro: IPR	96.94
TIGR00635	305	ruvB Holliday junction DNA helicase, RuvB subunit.	96.94
PF00910	107	RNA_helicase: RNA helicase; InterPro: IPR000605 He	96.94
smart00382	148	AAA ATPases associated with a variety of cellular	96.92
PRK06762	166	hypothetical protein; Provisional	96.91
PF10662	143	PduV-EutP: Ethanolamine utilisation - propanediol	96.91
PRK06217	183	hypothetical protein; Validated	96.9
PRK00625	173	shikimate kinase; Provisional	96.9
PF04665	241	Pox_A32: Poxvirus A32 protein; InterPro: IPR006758	96.9
PRK05480	209	uridine/cytidine kinase; Provisional	96.87
PRK13342	413	recombination factor protein RarA; Reviewed	96.87
TIGR00235	207	udk uridine kinase. Model contains a number of lon	96.86
PRK08233	182	hypothetical protein; Provisional	96.85
PRK00131	175	aroK shikimate kinase; Reviewed	96.85
PF13173	128	AAA_14: AAA domain	96.8
PTZ00301	210	uridine kinase; Provisional	96.79
PRK13947	171	shikimate kinase; Provisional	96.77
COG1100	219	GTPase SAR1 and related small G proteins [General	96.71
PF08477	119	Miro: Miro-like protein; InterPro: IPR013684 Mitoc	96.68
PRK13949	169	shikimate kinase; Provisional	96.65
PRK10078	186	ribose 1,5-bisphosphokinase; Provisional	96.65
PRK06620	214	hypothetical protein; Validated	96.63
TIGR02322	179	phosphon_PhnN phosphonate metabolism protein/1,5-b	96.62
PRK08084	235	DNA replication initiation factor; Provisional	96.6
TIGR02881	261	spore_V_K stage V sporulation protein K. Members o	96.56
PRK04040	188	adenylate kinase; Provisional	96.54
PRK06547	172	hypothetical protein; Provisional	96.5
PF13401	131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	96.49
PRK06851	367	hypothetical protein; Provisional	96.49
PHA00729	226	NTP-binding motif containing protein	96.48
PRK08727	233	hypothetical protein; Validated	96.48
PRK05642	234	DNA replication initiation factor; Validated	96.46
TIGR01360	188	aden_kin_iso1 adenylate kinase, isozyme 1 subfamil	96.45
cd00227	175	CPT Chloramphenicol (Cm) phosphotransferase (CPT).	96.43
cd02019	69	NK Nucleoside/nucleotide kinase (NK) is a protein	96.43
PRK12377	248	putative replication protein; Provisional	96.42
PF00308	219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	96.4
PRK05057	172	aroK shikimate kinase I; Reviewed	96.4
PRK00080	328	ruvB Holliday junction DNA helicase RuvB; Reviewed	96.38
COG0563	178	Adk Adenylate kinase and related kinases [Nucleoti	96.38
PRK08116	268	hypothetical protein; Validated	96.38
PRK03731	171	aroL shikimate kinase II; Reviewed	96.37
PRK13975	196	thymidylate kinase; Provisional	96.37
cd04139	164	RalA_RalB RalA/RalB subfamily. The Ral (Ras-like)	96.37
PRK03846	198	adenylylsulfate kinase; Provisional	96.36
TIGR03263	180	guanyl_kin guanylate kinase. Members of this famil	96.36
PRK09087	226	hypothetical protein; Validated	96.36
PRK08903	227	DnaA regulatory inactivator Hda; Validated	96.36
PRK13695	174	putative NTPase; Provisional	96.35
PRK13946	184	shikimate kinase; Provisional	96.34
TIGR01242	364	26Sp45 26S proteasome subunit P45 family. Many pro	96.31
PRK00889	175	adenylylsulfate kinase; Provisional	96.31
PRK06696	223	uridine kinase; Validated	96.3
COG1428	216	Deoxynucleoside kinases [Nucleotide transport and	96.28
TIGR02237	209	recomb_radB DNA repair and recombination protein R	96.25
PRK07952	244	DNA replication protein DnaC; Validated	96.25
PRK13341	725	recombination factor protein RarA/unknown domain f	96.24
PRK00300	205	gmk guanylate kinase; Provisional	96.22
cd04155	173	Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f	96.21
cd01983	99	Fer4_NifH The Fer4_NifH superfamily contains a var	96.2
TIGR00231	161	small_GTP small GTP-binding protein domain. This m	96.18
TIGR01287	275	nifH nitrogenase iron protein. This model describe	96.18
PRK14530	215	adenylate kinase; Provisional	96.17
PF00005	137	ABC_tran: ABC transporter This structure is on hol	96.16
cd01862	172	Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th	96.16
PF01926	116	MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I	96.15
cd04113	161	Rab4 Rab4 subfamily. Rab4 has been implicated in n	96.14
cd04119	168	RJL RJL (RabJ-Like) subfamily. RJLs are found in m	96.13
COG1125	309	OpuBA ABC-type proline/glycine betaine transport s	96.12
CHL00181	287	cbbX CbbX; Provisional	96.06
KOG1532	366	consensus GTPase XAB1, interacts with DNA repair p	96.06
cd00154	159	Rab Rab family. Rab GTPases form the largest famil	96.06
COG1116	248	TauB ABC-type nitrate/sulfonate/bicarbonate transp	96.05
cd00879	190	Sar1 Sar1 subfamily. Sar1 is an essential componen	96.04
PTZ00202	550	tuzin; Provisional	96.04
PRK14088	440	dnaA chromosomal replication initiation protein; P	96.03
PRK14531	183	adenylate kinase; Provisional	96.03
PRK13948	182	shikimate kinase; Provisional	96.02
cd00820	107	PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC	96.02
PRK14532	188	adenylate kinase; Provisional	96.02
cd04138	162	H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras,	96.01
TIGR00362	405	DnaA chromosomal replication initiator protein Dna	96.0
PRK13230	279	nitrogenase reductase-like protein; Reviewed	95.99
PRK13768	253	GTPase; Provisional	95.99
cd03255	218	ABC_MJ0796_Lo1CDE_FtsE This family is comprised of	95.99
PRK12422	445	chromosomal replication initiation protein; Provis	95.97
PRK07667	193	uridine kinase; Provisional	95.95
cd00157	171	Rho Rho (Ras homology) family. Members of the Rho	95.95
smart00175	164	RAB Rab subfamily of small GTPases. Rab GTPases ar	95.94
TIGR01618	220	phage_P_loop phage nucleotide-binding protein. Thi	95.92
COG1120	258	FepC ABC-type cobalamin/Fe3+-siderophores transpor	95.92
PRK12339	197	2-phosphoglycerate kinase; Provisional	95.91
PRK14961	363	DNA polymerase III subunits gamma and tau; Provisi	95.91
TIGR02880	284	cbbX_cfxQ probable Rubsico expression protein CbbX	95.89
TIGR00960	216	3a0501s02 Type II (General) Secretory Pathway (IIS	95.89
PRK10751	173	molybdopterin-guanine dinucleotide biosynthesis pr	95.88
COG3640	255	CooC CO dehydrogenase maturation factor [Cell divi	95.88
cd03225	211	ABC_cobalt_CbiO_domain1 Domain I of the ABC compon	95.87
PRK06835	329	DNA replication protein DnaC; Validated	95.86
PRK06526	254	transposase; Provisional	95.86
PRK04182	180	cytidylate kinase; Provisional	95.86
COG0003	322	ArsA Predicted ATPase involved in chromosome parti	95.86
COG0194	191	Gmk Guanylate kinase [Nucleotide transport and met	95.85
TIGR01166	190	cbiO cobalt transport protein ATP-binding subunit.	95.85
smart00173	164	RAS Ras subfamily of RAS small GTPases. Similar in	95.84
PRK13531	498	regulatory ATPase RavA; Provisional	95.84
COG0572	218	Udk Uridine kinase [Nucleotide transport and metab	95.83
PRK00149	450	dnaA chromosomal replication initiation protein; R	95.83
KOG3347	176	consensus Predicted nucleotide kinase/nuclear prot	95.83
PF03205	140	MobB: Molybdopterin guanine dinucleotide synthesis	95.83
TIGR02528	142	EutP ethanolamine utilization protein, EutP. This	95.83
COG1126	240	GlnQ ABC-type polar amino acid transport system, A	95.82
PRK09825	176	idnK D-gluconate kinase; Provisional	95.82
cd03269	210	ABC_putative_ATPase This subfamily is involved in	95.81
TIGR02902	531	spore_lonB ATP-dependent protease LonB. Members of	95.8
cd01133	274	F1-ATPase_beta F1 ATP synthase beta subunit, nucle	95.79
PRK09270	229	nucleoside triphosphate hydrolase domain-containin	95.79
cd03261	235	ABC_Org_Solvent_Resistant ABC (ATP-binding cassett	95.79
cd03293	220	ABC_NrtD_SsuB_transporters NrtD and SsuB are the A	95.77
cd03238	176	ABC_UvrA The excision repair protein UvrA; Nucleot	95.77
TIGR01281	268	DPOR_bchL light-independent protochlorophyllide re	95.77
cd01864	165	Rab19 Rab19 subfamily. Rab19 proteins are associat	95.77
PRK06921	266	hypothetical protein; Provisional	95.76
COG0467	260	RAD55 RecA-superfamily ATPases implicated in signa	95.75
cd03259	213	ABC_Carb_Solutes_like ABC Carbohydrate and Solute	95.75
cd01869	166	Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev	95.75
PRK08181	269	transposase; Validated	95.75
cd02034	116	CooC The accessory protein CooC, which contains a	95.74
cd02040	270	NifH NifH gene encodes component II (iron protein)	95.74
cd03263	220	ABC_subfamily_A The ABCA subfamily mediates the tr	95.74
PRK03992	389	proteasome-activating nucleotidase; Provisional	95.74
cd01860	163	Rab5_related Rab5-related subfamily. This subfamil	95.73
cd03264	211	ABC_drug_resistance_like ABC-type multidrug transp	95.73
cd03260	227	ABC_PstB_phosphate_transporter Phosphate uptake is	95.73
PF02374	305	ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_	95.72
cd01672	200	TMPK Thymidine monophosphate kinase (TMPK), also k	95.72
cd03226	205	ABC_cobalt_CbiO_domain2 Domain II of the ABC compo	95.72
COG3842	352	PotA ABC-type spermidine/putrescine transport syst	95.71
TIGR02673	214	FtsE cell division ATP-binding protein FtsE. This	95.71
cd03229	178	ABC_Class3 This class is comprised of all BPD (Bin	95.7
cd04124	161	RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily	95.7
cd03256	241	ABC_PhnC_transporter ABC-type phosphate/phosphonat	95.69
COG1124	252	DppF ABC-type dipeptide/oligopeptide/nickel transp	95.69
cd04140	165	ARHI_like ARHI subfamily. ARHI (A Ras homolog memb	95.69
cd04177	168	RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the	95.69
cd03265	220	ABC_DrrA DrrA is the ATP-binding protein component	95.68
PRK09361	225	radB DNA repair and recombination protein RadB; Pr	95.68
cd03292	214	ABC_FtsE_transporter FtsE is a hydrophilic nucleot	95.67
PTZ00088	229	adenylate kinase 1; Provisional	95.67
TIGR02315	243	ABC_phnC phosphonate ABC transporter, ATP-binding	95.66
PRK06761	282	hypothetical protein; Provisional	95.65
CHL00072	290	chlL photochlorophyllide reductase subunit L	95.65
PHA02530	300	pseT polynucleotide kinase; Provisional	95.64
cd03235	213	ABC_Metallic_Cations ABC component of the metal-ty	95.64
cd04150	159	Arf1_5_like Arf1-Arf5-like subfamily. This subfami	95.64
cd03297	214	ABC_ModC_molybdenum_transporter ModC is an ABC-typ	95.63
PF05673	249	DUF815: Protein of unknown function (DUF815); Inte	95.62
PRK14493	274	putative bifunctional molybdopterin-guanine dinucl	95.62
cd02117	212	NifH_like This family contains the NifH (iron prot	95.61
cd03258	233	ABC_MetN_methionine_transporter MetN (also known a	95.61
COG1484	254	DnaC DNA replication protein [DNA replication, rec	95.6
cd03257	228	ABC_NikE_OppD_transporters The ABC transporter sub	95.6
COG3839	338	MalK ABC-type sugar transport systems, ATPase comp	95.6
COG1136	226	SalX ABC-type antimicrobial peptide transport syst	95.59
TIGR02211	221	LolD_lipo_ex lipoprotein releasing system, ATP-bin	95.58
cd04123	162	Rab21 Rab21 subfamily. The localization and functi	95.58
cd03301	213	ABC_MalK_N The N-terminal ATPase domain of the mal	95.58
PRK14738	206	gmk guanylate kinase; Provisional	95.58
PRK13232	273	nifH nitrogenase reductase; Reviewed	95.57
TIGR02770	230	nickel_nikD nickel import ATP-binding protein NikD	95.57
cd04101	164	RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove	95.57
PRK13541	195	cytochrome c biogenesis protein CcmA; Provisional	95.57
cd01898	170	Obg Obg subfamily. The Obg nucleotide binding prot	95.56
PRK11629	233	lolD lipoprotein transporter ATP-binding subunit;	95.56
cd03296	239	ABC_CysA_sulfate_importer Part of the ABC transpor	95.56
cd03278	197	ABC_SMC_barmotin Barmotin is a tight junction-asso	95.56
PRK10584	228	putative ABC transporter ATP-binding protein YbbA;	95.55
PRK14527	191	adenylate kinase; Provisional	95.55
cd01861	161	Rab6 Rab6 subfamily. Rab6 is involved in microtubu	95.54
TIGR03499	282	FlhF flagellar biosynthetic protein FlhF.	95.54
cd03266	218	ABC_NatA_sodium_exporter NatA is the ATPase compon	95.54
TIGR01184	230	ntrCD nitrate transport ATP-binding subunits C and	95.53
TIGR01978	243	sufC FeS assembly ATPase SufC. SufC is part of the	95.53
TIGR03608	206	L_ocin_972_ABC putative bacteriocin export ABC tra	95.53
TIGR02173	171	cyt_kin_arch cytidylate kinase, putative. Proteins	95.52
COG0593	408	DnaA ATPase involved in DNA replication initiation	95.51
cd03115	173	SRP The signal recognition particle (SRP) mediates	95.51
cd03222	177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	95.51
cd01878	204	HflX HflX subfamily. A distinct conserved domain w	95.51
TIGR03864	236	PQQ_ABC_ATP ABC transporter, ATP-binding subunit,	95.5
PRK02496	184	adk adenylate kinase; Provisional	95.5
CHL00095	821	clpC Clp protease ATP binding subunit	95.5
PRK14963	504	DNA polymerase III subunits gamma and tau; Provisi	95.5
cd03219	236	ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans	95.5
PRK14490	369	putative bifunctional molybdopterin-guanine dinucl	95.49
cd04114	169	Rab30 Rab30 subfamily. Rab30 appears to be associa	95.49
TIGR02640	262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	95.49
cd03224	222	ABC_TM1139_LivF_branched LivF (TM1139) is part of	95.47
PRK00454	196	engB GTP-binding protein YsxC; Reviewed	95.47
PRK13538	204	cytochrome c biogenesis protein CcmA; Provisional	95.45
cd04137	180	RheB Rheb (Ras Homolog Enriched in Brain) subfamil	95.45
PRK14722	374	flhF flagellar biosynthesis regulator FlhF; Provis	95.45
cd03252	237	ABCC_Hemolysin The ABC-transporter hemolysin B is	95.45
cd03268	208	ABC_BcrA_bacitracin_resist The BcrA subfamily repr	95.44
cd03218	232	ABC_YhbG The ABC transporters belonging to the Yhb	95.44
cd03262	213	ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-	95.43
PRK15177	213	Vi polysaccharide export ATP-binding protein VexC;	95.43
PRK04195	482	replication factor C large subunit; Provisional	95.43
PRK09183	259	transposase/IS protein; Provisional	95.43
PRK11124	242	artP arginine transporter ATP-binding subunit; Pro	95.42
TIGR00150	133	HI0065_YjeE ATPase, YjeE family. Members of this f	95.42
PRK08939	306	primosomal protein DnaI; Reviewed	95.42
cd04122	166	Rab14 Rab14 subfamily. Rab14 GTPases are localized	95.41
cd04136	163	Rap_like Rap-like subfamily. The Rap subfamily con	95.4
PTZ00361	438	26 proteosome regulatory subunit 4-like protein; P	95.39
COG1936	180	Predicted nucleotide kinase (related to CMP and AM	95.39
PLN02200	234	adenylate kinase family protein	95.39
PRK11248	255	tauB taurine transporter ATP-binding subunit; Prov	95.38
TIGR00455	184	apsK adenylylsulfate kinase (apsK). Important resi	95.38
cd02032	267	Bchl_like This family of proteins contains bchL an	95.37
cd04154	173	Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are	95.36
cd03295	242	ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin	95.36
PRK10619	257	histidine/lysine/arginine/ornithine transporter su	95.35
PRK14737	186	gmk guanylate kinase; Provisional	95.35
COG3638	258	ABC-type phosphate/phosphonate transport system, A	95.35
cd03247	178	ABCC_cytochrome_bd The CYD subfamily implicated in	95.35
PRK09493	240	glnQ glutamine ABC transporter ATP-binding protein	95.35
PRK10895	241	lipopolysaccharide ABC transporter ATP-binding pro	95.35
cd01394	218	radB RadB. The archaeal protein radB shares simila	95.35
cd01866	168	Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg	95.34
TIGR00972	247	3a0107s01c2 phosphate ABC transporter, ATP-binding	95.34
cd04110	199	Rab35 Rab35 subfamily. Rab35 is one of several Rab	95.34
PRK08099	399	bifunctional DNA-binding transcriptional repressor	95.33
PRK10247	225	putative ABC transporter ATP-binding protein YbbL;	95.33
PF13479	213	AAA_24: AAA domain	95.32
cd03267	236	ABC_NatA_like Similar in sequence to NatA, this is	95.31
TIGR00101	199	ureG urease accessory protein UreG. This model rep	95.3
cd03215	182	ABC_Carb_Monos_II This family represents domain II	95.3
PRK14242	253	phosphate transporter ATP-binding protein; Provisi	95.29
COG2884	223	FtsE Predicted ATPase involved in cell division [C	95.29
TIGR03689	512	pup_AAA proteasome ATPase. In the Actinobacteria,	95.29
TIGR02639	731	ClpA ATP-dependent Clp protease ATP-binding subuni	95.29
TIGR03598	179	GTPase_YsxC ribosome biogenesis GTP-binding protei	95.28
cd03237	246	ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o	95.28
PRK11264	250	putative amino-acid ABC transporter ATP-binding pr	95.27
PRK14245	250	phosphate ABC transporter ATP-binding protein; Pro	95.27
cd01868	165	Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a	95.27
PRK00698	205	tmk thymidylate kinase; Validated	95.27
PRK00279	215	adk adenylate kinase; Reviewed	95.26
PRK14247	250	phosphate ABC transporter ATP-binding protein; Pro	95.26
cd04118	193	Rab24 Rab24 subfamily. Rab24 is distinct from othe	95.26
PRK11247	257	ssuB aliphatic sulfonates transport ATP-binding su	95.25
cd04107	201	Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38	95.25
cd03216	163	ABC_Carb_Monos_I This family represents the domain	95.25
COG2019	189	AdkA Archaeal adenylate kinase [Nucleotide transpo	95.24
PRK10908	222	cell division protein FtsE; Provisional	95.24
TIGR03410	230	urea_trans_UrtE urea ABC transporter, ATP-binding	95.24
PRK11300	255	livG leucine/isoleucine/valine transporter ATP-bin	95.24
PRK13540	200	cytochrome c biogenesis protein CcmA; Provisional	95.24
cd04163	168	Era Era subfamily. Era (E. coli Ras-like protein)	95.23
PRK05416	288	glmZ(sRNA)-inactivating NTPase; Provisional	95.22
cd04103	158	Centaurin_gamma Centaurin gamma. The centaurins (a	95.22
PRK13231	264	nitrogenase reductase-like protein; Reviewed	95.21
cd03246	173	ABCC_Protease_Secretion This family represents the	95.21
PF00025	175	Arf: ADP-ribosylation factor family The prints ent	95.21
cd04115	170	Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u	95.21
PRK14241	258	phosphate transporter ATP-binding protein; Provisi	95.2
cd03230	173	ABC_DR_subfamily_A This family of ATP-binding prot	95.2
PTZ00132	215	GTP-binding nuclear protein Ran; Provisional	95.2
PRK13233	275	nifH nitrogenase reductase; Reviewed	95.2
smart00178	184	SAR Sar1p-like members of the Ras-family of small	95.2
cd00877	166	Ran Ran (Ras-related nuclear proteins) /TC4 subfam	95.19
cd04149	168	Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor	95.19
cd01897	168	NOG NOG1 is a nucleolar GTP-binding protein presen	95.19
TIGR02324	224	CP_lyasePhnL phosphonate C-P lyase system protein	95.18
cd03232	192	ABC_PDR_domain2 The pleiotropic drug resistance-li	95.18
PRK04213	201	GTP-binding protein; Provisional	95.18
PTZ00133	182	ADP-ribosylation factor; Provisional	95.18
PF00448	196	SRP54: SRP54-type protein, GTPase domain; InterPro	95.18
cd04135	174	Tc10 TC10 subfamily. TC10 is a Rho family protein	95.17
PRK14248	268	phosphate ABC transporter ATP-binding protein; Pro	95.17
PRK11701	258	phnK phosphonate C-P lyase system protein PhnK; Pr	95.17
PRK11831	269	putative ABC transporter ATP-binding protein YrbF;	95.17
cd01123	235	Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r	95.17
PRK13235	274	nifH nitrogenase reductase; Reviewed	95.17
KOG0927	614	consensus Predicted transporter (ABC superfamily)	95.17
cd03253	236	ABCC_ATM1_transporter ATM1 is an ABC transporter t	95.16
TIGR00554	290	panK_bact pantothenate kinase, bacterial type. Sho	95.16
PRK13638	271	cbiO cobalt transporter ATP-binding subunit; Provi	95.16
PRK10744	260	pstB phosphate transporter ATP-binding protein; Pr	95.15
cd03240	204	ABC_Rad50 The catalytic domains of Rad50 are simil	95.15
PRK06851	367	hypothetical protein; Provisional	95.15
cd03223	166	ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass	95.15
TIGR01189	198	ccmA heme ABC exporter, ATP-binding protein CcmA.	95.15
cd04125	188	RabA_like RabA-like subfamily. RabA was first iden	95.15
cd04141	172	Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p	95.14
PHA02544	316	44 clamp loader, small subunit; Provisional	95.14
cd02036	179	MinD Bacterial cell division requires the formatio	95.14
cd01130	186	VirB11-like_ATPase Type IV secretory pathway compo	95.14
cd04106	162	Rab23_lke Rab23-like subfamily. Rab23 is a member	95.14
PRK14239	252	phosphate transporter ATP-binding protein; Provisi	95.13
TIGR02314	343	ABC_MetN D-methionine ABC transporter, ATP-binding	95.13
TIGR01277	213	thiQ thiamine ABC transporter, ATP-binding protein	95.13
PRK09544	251	znuC high-affinity zinc transporter ATPase; Review	95.12
PRK08356	195	hypothetical protein; Provisional	95.12
CHL00131	252	ycf16 sulfate ABC transporter protein; Validated	95.12
PF01078	206	Mg_chelatase: Magnesium chelatase, subunit ChlI; I	95.12
PRK14256	252	phosphate ABC transporter ATP-binding protein; Pro	95.12
TIGR03005	252	ectoine_ehuA ectoine/hydroxyectoine ABC transporte	95.12
PLN02796	347	D-glycerate 3-kinase	95.11
PRK13649	280	cbiO cobalt transporter ATP-binding subunit; Provi	95.11
PRK14260	259	phosphate ABC transporter ATP-binding protein; Pro	95.11
PRK14238	271	phosphate transporter ATP-binding protein; Provisi	95.11
PRK13539	207	cytochrome c biogenesis protein CcmA; Provisional	95.11
PRK13645	289	cbiO cobalt transporter ATP-binding subunit; Provi	95.11
PRK14964	491	DNA polymerase III subunits gamma and tau; Provisi	95.11
cd03234	226	ABCG_White The White subfamily represents ABC tran	95.1
cd03298	211	ABC_ThiQ_thiamine_transporter ABC-type thiamine tr	95.1
PRK14087	450	dnaA chromosomal replication initiation protein; P	95.1
TIGR03873	256	F420-0_ABC_ATP proposed F420-0 ABC transporter, AT	95.1
PRK14957	546	DNA polymerase III subunits gamma and tau; Provisi	95.09
PRK14243	264	phosphate transporter ATP-binding protein; Provisi	95.09
PRK14250	241	phosphate ABC transporter ATP-binding protein; Pro	95.09
PRK15056	272	manganese/iron transporter ATP-binding protein; Pr	95.09
PRK09580	248	sufC cysteine desulfurase ATPase component; Review	95.09
PRK14274	259	phosphate ABC transporter ATP-binding protein; Pro	95.09
PRK14259	269	phosphate ABC transporter ATP-binding protein; Pro	95.08
cd03294	269	ABC_Pro_Gly_Bertaine This family comprises the gly	95.08
PRK10575	265	iron-hydroxamate transporter ATP-binding subunit;	95.08
cd03214	180	ABC_Iron-Siderophores_B12_Hemin ABC transporters,	95.07
cd03228	171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	95.07
cd04117	161	Rab15 Rab15 subfamily. Rab15 colocalizes with the	95.07
TIGR02782	299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	95.07
PRK14955	397	DNA polymerase III subunits gamma and tau; Provisi	95.06
cd03221	144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	95.06
cd03249	238	ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6)	95.06
cd03279	213	ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex	95.06
TIGR03345	852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	95.06
cd04120	202	Rab12 Rab12 subfamily. Rab12 was first identified	95.06
TIGR00064	272	ftsY signal recognition particle-docking protein F	95.06
COG1763	161	MobB Molybdopterin-guanine dinucleotide biosynthes	95.05
COG0703	172	AroK Shikimate kinase [Amino acid transport and me	95.05
cd03233	202	ABC_PDR_domain1 The pleiotropic drug resistance (P	95.05
PRK14721	420	flhF flagellar biosynthesis regulator FlhF; Provis	95.05
cd04127	180	Rab27A Rab27a subfamily. The Rab27a subfamily cons	95.04
TIGR01188	302	drrA daunorubicin resistance ABC transporter ATP-b	95.04
PRK14255	252	phosphate ABC transporter ATP-binding protein; Pro	95.04
PRK11231	255	fecE iron-dicitrate transporter ATP-binding subuni	95.04
PF00158	168	Sigma54_activat: Sigma-54 interaction domain; Inte	95.04
cd03290	218	ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec	95.03
PRK14262	250	phosphate ABC transporter ATP-binding protein; Pro	95.03
cd03251	234	ABCC_MsbA MsbA is an essential ABC transporter, cl	95.03
cd03220	224	ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo	95.03
cd03116	159	MobB Molybdenum is an essential trace element in t	95.02
PRK15093	330	antimicrobial peptide ABC transporter ATP-binding	95.02
cd03245	220	ABCC_bacteriocin_exporters ABC-type bacteriocin ex	95.02
cd01892	169	Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr	95.02
PTZ00454	398	26S protease regulatory subunit 6B-like protein; P	95.01
cd01393	226	recA_like RecA is a bacterial enzyme which has rol	95.01
PRK14267	253	phosphate ABC transporter ATP-binding protein; Pro	95.0
PLN03025	319	replication factor C subunit; Provisional	95.0
COG0529	197	CysC Adenylylsulfate kinase and related kinases [I	95.0
PRK10771	232	thiQ thiamine transporter ATP-binding subunit; Pro	95.0
PF13555	62	AAA_29: P-loop containing region of AAA domain	95.0
PRK14273	254	phosphate ABC transporter ATP-binding protein; Pro	95.0
cd01865	165	Rab3 Rab3 subfamily. The Rab3 subfamily contains R	94.99
PHA02518	211	ParA-like protein; Provisional	94.99
PTZ00369	189	Ras-like protein; Provisional	94.99
cd04129	187	Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that	94.99
PRK14261	253	phosphate ABC transporter ATP-binding protein; Pro	94.99
PRK10418	254	nikD nickel transporter ATP-binding protein NikD;	94.98
cd04145	164	M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf	94.98
PRK14240	250	phosphate transporter ATP-binding protein; Provisi	94.98
PRK05896	605	DNA polymerase III subunits gamma and tau; Validat	94.97
cd01888	203	eIF2_gamma eIF2-gamma (gamma subunit of initiation	94.97
cd03231	201	ABC_CcmA_heme_exporter CcmA, the ATP-binding compo	94.97
TIGR02030	337	BchI-ChlI magnesium chelatase ATPase subunit I. Th	94.96
cd04153	174	Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a	94.96
PF03193	161	DUF258: Protein of unknown function, DUF258; Inter	94.95
cd03272	243	ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein	94.95
cd04132	187	Rho4_like Rho4-like subfamily. Rho4 is a GTPase th	94.94
cd03254	229	ABCC_Glucan_exporter_like Glucan exporter ATP-bind	94.92
cd04175	164	Rap1 Rap1 subgroup. The Rap1 subgroup is part of t	94.92
cd01867	167	Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp	94.92
cd03244	221	ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.	94.91
PRK11889	436	flhF flagellar biosynthesis regulator FlhF; Provis	94.91
cd03273	251	ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein	94.9
PRK12402	337	replication factor C small subunit 2; Reviewed	94.9
smart00763	361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	94.9
PRK15467	158	ethanolamine utilization protein EutP; Provisional	94.89
TIGR00073	207	hypB hydrogenase accessory protein HypB. HypB is i	94.89
COG1119	257	ModF ABC-type molybdenum transport system, ATPase	94.88
PRK14235	267	phosphate transporter ATP-binding protein; Provisi	94.88
KOG0062	582	consensus ATPase component of ABC transporters wit	94.87
PRK11153	343	metN DL-methionine transporter ATP-binding subunit	94.87
PRK13548	258	hmuV hemin importer ATP-binding subunit; Provision	94.87
PRK14270	251	phosphate ABC transporter ATP-binding protein; Pro	94.87
cd01895	174	EngA2 EngA2 subfamily. This CD represents the seco	94.87
PRK13547	272	hmuV hemin importer ATP-binding subunit; Provision	94.86
PF13086	236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	94.86
PRK13543	214	cytochrome c biogenesis protein CcmA; Provisional	94.85
PF13604	196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	94.84
TIGR02769	265	nickel_nikE nickel import ATP-binding protein NikE	94.84
PRK14265	274	phosphate ABC transporter ATP-binding protein; Pro	94.84
PRK14528	186	adenylate kinase; Provisional	94.84
cd04108	170	Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr	94.83
CHL00081	350	chlI Mg-protoporyphyrin IX chelatase	94.83
PRK14237	267	phosphate transporter ATP-binding protein; Provisi	94.83
PRK14266	250	phosphate ABC transporter ATP-binding protein; Pro	94.83
cd01131	198	PilT Pilus retraction ATPase PilT. PilT is a nucle	94.82
TIGR00041	195	DTMP_kinase thymidylate kinase. Function: phosphor	94.82
COG1121	254	ZnuC ABC-type Mn/Zn transport systems, ATPase comp	94.81
cd01858	157	NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei	94.81
PRK13546	264	teichoic acids export protein ATP-binding subunit;	94.81
cd03369	207	ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty	94.81
cd03248	226	ABCC_TAP TAP, the Transporter Associated with Anti	94.8
PF01695	178	IstB_IS21: IstB-like ATP binding protein; InterPro	94.8
cd01870	175	RhoA_like RhoA-like subfamily. The RhoA subfamily	94.8
PRK13632	271	cbiO cobalt transporter ATP-binding subunit; Provi	94.8
TIGR02323	253	CP_lyasePhnK phosphonate C-P lyase system protein	94.79
TIGR03411	242	urea_trans_UrtD urea ABC transporter, ATP-binding	94.79
PRK13650	279	cbiO cobalt transporter ATP-binding subunit; Provi	94.79
PRK09984	262	phosphonate/organophosphate ester transporter subu	94.79
PRK10253	265	iron-enterobactin transporter ATP-binding protein;	94.79
PRK14244	251	phosphate ABC transporter ATP-binding protein; Pro	94.77
PRK14251	251	phosphate ABC transporter ATP-binding protein; Pro	94.77
PRK13185	270	chlL protochlorophyllide reductase iron-sulfur ATP	94.77
TIGR01241	495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	94.76
PRK08154	309	anaerobic benzoate catabolism transcriptional regu	94.76
PRK11614	237	livF leucine/isoleucine/valine transporter ATP-bin	94.75
PRK14974	336	cell division protein FtsY; Provisional	94.75
PRK14271	276	phosphate ABC transporter ATP-binding protein; Pro	94.74
PRK11000	369	maltose/maltodextrin transporter ATP-binding prote	94.74
PRK12727	559	flagellar biosynthesis regulator FlhF; Provisional	94.74
COG4608	268	AppF ABC-type oligopeptide transport system, ATPas	94.73
TIGR01420	343	pilT_fam pilus retraction protein PilT. This model	94.73
TIGR02868	529	CydC thiol reductant ABC exporter, CydC subunit. T	94.73
cd04134	189	Rho3 Rho3 subfamily. Rho3 is a member of the Rho f	94.72
PRK13648	269	cbiO cobalt transporter ATP-binding subunit; Provi	94.72
cd03236	255	ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o	94.72
PRK05703	424	flhF flagellar biosynthesis regulator FlhF; Valida	94.72
PRK11034	758	clpA ATP-dependent Clp protease ATP-binding subuni	94.71
TIGR03771	223	anch_rpt_ABC anchored repeat-type ABC transporter,	94.71
cd00267	157	ABC_ATPase ABC (ATP-binding cassette) transporter	94.71
PRK11144	352	modC molybdate transporter ATP-binding protein; Pr	94.71
PRK13236	296	nitrogenase reductase; Reviewed	94.7
PRK11022	326	dppD dipeptide transporter ATP-binding subunit; Pr	94.7
PRK10865	857	protein disaggregation chaperone; Provisional	94.7
TIGR03740	223	galliderm_ABC gallidermin-class lantibiotic protec	94.7
PF08433	270	KTI12: Chromatin associated protein KTI12 ; InterP	94.69
PRK14269	246	phosphate ABC transporter ATP-binding protein; Pro	94.69
COG0410	237	LivF ABC-type branched-chain amino acid transport	94.68
PRK10416	318	signal recognition particle-docking protein FtsY;	94.68
PRK14021	542	bifunctional shikimate kinase/3-dehydroquinate syn	94.68
COG1123	539	ATPase components of various ABC-type transport sy	94.67
cd03110	179	Fer4_NifH_child This protein family's function is	94.67
cd03274	212	ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein	94.67
PRK03695	248	vitamin B12-transporter ATPase; Provisional	94.66
TIGR02142	354	modC_ABC molybdenum ABC transporter, ATP-binding p	94.66
cd03213	194	ABCG_EPDR ABCG transporters are involved in eye pi	94.64
PRK14275	286	phosphate ABC transporter ATP-binding protein; Pro	94.63
PRK04220	301	2-phosphoglycerate kinase; Provisional	94.63
TIGR01288	303	nodI ATP-binding ABC transporter family nodulation	94.63
smart00072	184	GuKc Guanylate kinase homologues. Active enzymes c	94.63
cd04116	170	Rab9 Rab9 subfamily. Rab9 is found in late endosom	94.63
PRK05564	313	DNA polymerase III subunit delta'; Validated	94.62
cd03112	158	CobW_like The function of this protein family is u	94.62
PRK14526	211	adenylate kinase; Provisional	94.62
COG2274	709	SunT ABC-type bacteriocin/lantibiotic exporters, c	94.61
PF13476	202	AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V	94.61
PRK14272	252	phosphate ABC transporter ATP-binding protein; Pro	94.6
PRK13639	275	cbiO cobalt transporter ATP-binding subunit; Provi	94.6
PRK15112	267	antimicrobial peptide ABC system ATP-binding prote	94.6

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]

Probab=99.86  E-value=3.6e-22  Score=169.88  Aligned_cols=105  Identities=26%  Similarity=0.434  Sum_probs=84.6

Q ss_pred             cCccCCchhhhHHHHHHHHHHHHHHHHHhccCcccccc-cCCcccccccCCCCce-eecccCCCCcc------------c
Q 042811           26 GYYFMNCKSSYEFGKKLAKKLQVLANLKEEENYEDVAD-RLSEDSVDDRPVETTK-LGDVRRNGNNW------------P   91 (130)
Q Consensus        26 ~~~~~~~~~~~~i~k~i~~~~~~i~~l~~~~~~~~~~~-~~~~~~~~~~~~~~~i-vG~~~~~~~l~------------I   91 (130)
                      ++|..+....|.+++++.+.+++++.+..++.|+.+.. ..|.+..+++|..+.. ||.+.++++++            |
T Consensus       105 ~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~~~~~~~~~e~~~~~~~~~VG~e~~~~kl~~~L~~d~~~iv~i  184 (889)
T KOG4658|consen  105 GFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEVVGESLDPREKVETRPIQSESDVGLETMLEKLWNRLMEDDVGIVGI  184 (889)
T ss_pred             hhHhHhhhhhHhHHHHHHHHHHHHHHhccccceecccccccchhhcccCCCCccccccHHHHHHHHHHHhccCCCCEEEE
Confidence            34445667778899999999999999988887876654 3344445566655544 99998887776            9


Q ss_pred             cCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC-CCCC
Q 042811           92 FGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR-DMSL  130 (130)
Q Consensus        92 ~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS-~~~~  130 (130)
                      +||||+||||||+.|||++.++.++||.+|||+|| +|+.
T Consensus       185 ~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~  224 (889)
T KOG4658|consen  185 YGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTT  224 (889)
T ss_pred             ECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccH
Confidence            99999999999999999994489999999999999 9973

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []

Probab=99.14  E-value=3.3e-11  Score=90.48  Aligned_cols=38  Identities=18%  Similarity=0.168  Sum_probs=34.2

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC-CCC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR-DMS  129 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS-~~~  129 (130)
                      |+||||+||||||+.++++. ....+|+.++|+.++ .++
T Consensus        24 I~G~~G~GKT~LA~~~~~~~-~~~~~f~~v~wv~~~~~~~   62 (287)
T PF00931_consen   24 IVGMGGIGKTTLARQVARDL-RIKNRFDGVIWVSLSKNPS   62 (287)
T ss_dssp             EEESTTSSHHHHHHHHHCHH-HHCCCCTEEEEEEEES-SC
T ss_pred             EEcCCcCCcceeeeeccccc-ccccccccccccccccccc
Confidence            99999999999999999986 578999999999999 665

This domain has been structurally characterised in the human protein apoptotic protease-activating factor 1 (Apaf-1) []. It contains the three-layered alpha-beta fold and subsequent short alpha-helical region characteristic of the AAA+ ATPase domain superfamily. While this domain is thought to bind and hyrolyse ATP, only ADP binding has been experimentally verified. It is proposed that binding and hydrolysis of ATP by this domain induces conformational changes the the overall protein, leading to formation of the apoptosome.; GO: 0043531 ADP binding; PDB: 3IZA_E 1Z6T_D 3SFZ_A 3SHF_A 1VT4_M 3IZ8_G 3LQR_A 2A5Y_C 3LQQ_A.

>PLN03210 Resistant to P

Probab=99.06  E-value=2.5e-10  Score=100.46  Aligned_cols=95  Identities=16%  Similarity=0.091  Sum_probs=59.1

Q ss_pred             hHHHHHHHHHHHHHHHHHhhhccCccCCchhhhHHHHHHHHHHHHHHHHHhccCcccccccCCcccccccCCCCceeecc
Q 042811            4 LHKIQMGLTRVQALETEVDNLGGYYFMNCKSSYEFGKKLAKKLQVLANLKEEENYEDVADRLSEDSVDDRPVETTKLGDV   83 (130)
Q Consensus         4 ~~~v~~Wl~~v~~~~~e~edi~~~~~~~~~~~~~i~k~i~~~~~~i~~l~~~~~~~~~~~~~~~~~~~~~~~~~~ivG~~   83 (130)
                      .+.++.|-+    |..+|.++.|+...+..  ++ ++-|+++.++|-+...   .      .++..      .+.+||++
T Consensus       133 ~~~~~~w~~----al~~~~~~~g~~~~~~~--~E-~~~i~~Iv~~v~~~l~---~------~~~~~------~~~~vG~~  190 (1153)
T PLN03210        133 EDEKIQWKQ----ALTDVANILGYHSQNWP--NE-AKMIEEIANDVLGKLN---L------TPSND------FEDFVGIE  190 (1153)
T ss_pred             hhHHHHHHH----HHHHHhCcCceecCCCC--CH-HHHHHHHHHHHHHhhc---c------ccCcc------cccccchH
Confidence            356788877    77788889887764422  22 3334444444433211   1      11110      12247776


Q ss_pred             cCCCCcc--------------ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEE
Q 042811           84 RRNGNNW--------------PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHD  123 (130)
Q Consensus        84 ~~~~~l~--------------I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv  123 (130)
                      ..++++.              ||||||+||||||+.+|+..   ..+|+..+|+
T Consensus       191 ~~l~~l~~lL~l~~~~~~vvgI~G~gGiGKTTLA~~l~~~l---~~~F~g~vfv  241 (1153)
T PLN03210        191 DHIAKMSSLLHLESEEVRMVGIWGSSGIGKTTIARALFSRL---SRQFQSSVFI  241 (1153)
T ss_pred             HHHHHHHHHHccccCceEEEEEEcCCCCchHHHHHHHHHHH---hhcCCeEEEe
Confidence            5433321              99999999999999999976   5789988776

syringae 6; Provisional

>PRK09376 rho transcription termination factor Rho; Provisional

Probab=98.60  E-value=3.6e-08  Score=78.01  Aligned_cols=36  Identities=8%  Similarity=-0.014  Sum_probs=32.8

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC-CC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR-DM  128 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS-~~  128 (130)
                      |+|.+|+||||||+.|||.. .. ++||+++||+++ ++
T Consensus       174 IvgppGvGKTTLaK~Ian~I-~~-nhFDv~~~VvLIgER  210 (416)
T PRK09376        174 IVAPPKAGKTVLLQNIANSI-TT-NHPEVHLIVLLIDER  210 (416)
T ss_pred             EeCCCCCChhHHHHHHHHHH-Hh-hcCCeEEEEEEeCCc
Confidence            99999999999999999988 43 499999999998 75

>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase

Probab=98.56  E-value=5.5e-08  Score=72.85  Aligned_cols=36  Identities=11%  Similarity=-0.010  Sum_probs=32.3

Q ss_pred             cccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC-C
Q 042811           90 WPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR-D  127 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS-~  127 (130)
                      .|.|.+|+|||||++.++|.. .. ++|+.++|++++ +
T Consensus        20 ~I~G~~G~GKTTLlr~I~n~l-~~-~~fdv~~~v~vI~e   56 (249)
T cd01128          20 LIVAPPKAGKTTLLQSIANAI-TK-NHPEVYLIVLLIDE   56 (249)
T ss_pred             EEECCCCCCHHHHHHHHHhcc-cc-ccCCeEEEEEEccC
Confidence            399999999999999999987 43 499999999988 6

It is a homohexamer. Each monomer consists of an N-terminal domain of the OB fold, which is responsible for binding to cysteine rich nucleotides. This alignment is of the C-terminal ATP binding domain.

>PRK08118 topology modulation protein; Reviewed

Probab=98.19  E-value=6e-07  Score=63.29  Aligned_cols=38  Identities=16%  Similarity=0.013  Sum_probs=30.1

Q ss_pred             CccccCcCCCchhHHHHhhhhhhhhcc-CCCCeEE----EEEeC
Q 042811           88 NNWPFGVEGVGKITSLSKSYPEFLEDE-GIFLIKM----HDVVR  126 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~~~~~~~-~~Fd~~~----wv~VS  126 (130)
                      ++.|+|.+|+||||||+.+++.. ... -+||..+    |..++
T Consensus         3 rI~I~G~~GsGKSTlak~L~~~l-~~~~~~lD~l~~~~~w~~~~   45 (167)
T PRK08118          3 KIILIGSGGSGKSTLARQLGEKL-NIPVHHLDALFWKPNWEGVP   45 (167)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHh-CCCceecchhhcccCCcCCC
Confidence            45689999999999999999987 433 5688777    55555

>TIGR00767 rho transcription termination factor Rho

Probab=97.90  E-value=1.2e-05  Score=64.06  Aligned_cols=35  Identities=11%  Similarity=0.039  Sum_probs=31.9

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC-C
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR-D  127 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS-~  127 (130)
                      |+|.+|+|||||++.+++.. . .++|+.++||+++ +
T Consensus       173 IvG~~g~GKTtL~~~i~~~I-~-~nhfdv~v~VlLIgE  208 (415)
T TIGR00767       173 IVAPPKAGKTVLLQKIAQAI-T-RNHPEVELIVLLIDE  208 (415)
T ss_pred             EECCCCCChhHHHHHHHHhh-c-ccCCceEEEEEEcCC
Confidence            99999999999999999987 4 3589999999998 6

Members of this family differ in the specificity of RNA binding.

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional

Probab=97.84  E-value=1.6e-05  Score=64.13  Aligned_cols=38  Identities=18%  Similarity=-0.032  Sum_probs=33.4

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC-CCC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR-DMS  129 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS-~~~  129 (130)
                      ++|++|+||||||+.+.+.. .....|+.+.||+++ +++
T Consensus       199 l~GppGtGKT~lA~~la~~l-~~~~~~~~v~~VtFHpsyS  237 (459)
T PRK11331        199 LQGPPGVGKTFVARRLAYLL-TGEKAPQRVNMVQFHQSYS  237 (459)
T ss_pred             EECCCCCCHHHHHHHHHHHh-cCCcccceeeEEeeccccc
Confidence            99999999999999999987 445688999999998 764

>PRK07261 topology modulation protein; Provisional

Probab=97.65  E-value=3.1e-05  Score=54.69  Aligned_cols=34  Identities=18%  Similarity=-0.061  Sum_probs=23.3

Q ss_pred             ccccCcCCCchhHHHHhhhhhhhhccCCCCeEEE
Q 042811           89 NWPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMH  122 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~w  122 (130)
                      +.|+|++|+||||||+.+.....-..-+.|...|
T Consensus         3 i~i~G~~GsGKSTla~~l~~~~~~~~i~~D~~~~   36 (171)
T PRK07261          3 IAIIGYSGSGKSTLARKLSQHYNCPVLHLDTLHF   36 (171)
T ss_pred             EEEEcCCCCCHHHHHHHHHHHhCCCeEecCCEEe
Confidence            4489999999999999987654101124555555

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A

Probab=97.50  E-value=5.1e-05  Score=49.85  Aligned_cols=20  Identities=25%  Similarity=0.179  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|+.|+||||+|+.+-+..
T Consensus         4 I~G~~gsGKST~a~~La~~~   23 (121)
T PF13207_consen    4 ISGPPGSGKSTLAKELAERL   23 (121)
T ss_dssp             EEESTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            78999999999999998763

...

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]

Probab=97.47  E-value=2.7e-05  Score=61.77  Aligned_cols=25  Identities=24%  Similarity=0.205  Sum_probs=21.2

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFL  118 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd  118 (130)
                      .||..|+||||||+.|-...   ...|.
T Consensus        53 l~GPPG~GKTTlA~liA~~~---~~~f~   77 (436)
T COG2256          53 LWGPPGTGKTTLARLIAGTT---NAAFE   77 (436)
T ss_pred             EECCCCCCHHHHHHHHHHhh---CCceE
Confidence            99999999999999998865   34554

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A

Probab=97.41  E-value=3.1e-05  Score=54.09  Aligned_cols=21  Identities=24%  Similarity=0.270  Sum_probs=17.6

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+|||||++.+....
T Consensus        28 ll~G~~G~GKT~ll~~~~~~~   48 (185)
T PF13191_consen   28 LLTGESGSGKTSLLRALLDRL   48 (185)
T ss_dssp             EE-B-TTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHH
Confidence            399999999999999999987

>PRK00411 cdc6 cell division control protein 6; Reviewed

Probab=97.40  E-value=5.2e-05  Score=59.56  Aligned_cols=20  Identities=35%  Similarity=0.682  Sum_probs=19.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+||||+++.+.++.
T Consensus        60 I~G~~GtGKT~l~~~v~~~l   79 (394)
T PRK00411         60 IYGPPGTGKTTTVKKVFEEL   79 (394)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            99999999999999999987

>TIGR02928 orc1/cdc6 family replication initiation protein

Probab=97.30  E-value=8.7e-05  Score=57.67  Aligned_cols=20  Identities=25%  Similarity=0.388  Sum_probs=19.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+||||+++.+++..
T Consensus        45 I~G~~GtGKT~l~~~~~~~l   64 (365)
T TIGR02928        45 IYGKTGTGKTAVTKYVMKEL   64 (365)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            99999999999999999876

Members of this protein family are found exclusively in the archaea. This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. Several members may be found in genome and interact with each other.

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]

Probab=97.23  E-value=0.00011  Score=58.14  Aligned_cols=20  Identities=25%  Similarity=0.199  Sum_probs=19.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      +||..|+||||||+.|-+..
T Consensus       167 lWGppG~GKTtlArlia~ts  186 (554)
T KOG2028|consen  167 LWGPPGTGKTTLARLIASTS  186 (554)
T ss_pred             EecCCCCchHHHHHHHHhhc
Confidence            99999999999999999876

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair

Probab=97.23  E-value=0.00014  Score=53.94  Aligned_cols=21  Identities=29%  Similarity=0.320  Sum_probs=19.5

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ..||..|+||||||..|-+..
T Consensus        54 lf~GPPG~GKTTLA~IIA~e~   74 (233)
T PF05496_consen   54 LFYGPPGLGKTTLARIIANEL   74 (233)
T ss_dssp             EEESSTTSSHHHHHHHHHHHC
T ss_pred             EEECCCccchhHHHHHHHhcc
Confidence            399999999999999999976

Branch migration is catalysed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein []. This group of sequences contain this signature which is located in the N-terminal region of the proteins.; GO: 0009378 four-way junction helicase activity, 0006281 DNA repair, 0006310 DNA recombination; PDB: 1IQP_B 3PFI_B 1IXR_C 1HQC_B 1IXS_B.

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold

Probab=97.19  E-value=0.00038  Score=45.78  Aligned_cols=21  Identities=29%  Similarity=0.343  Sum_probs=19.5

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+|||||++.+.+..
T Consensus        23 ~i~G~~G~GKT~l~~~i~~~~   43 (151)
T cd00009          23 LLYGPPGTGKTTLARAIANEL   43 (151)
T ss_pred             EEECCCCCCHHHHHHHHHHHh
Confidence            399999999999999999976

The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda

Probab=97.18  E-value=0.00025  Score=51.41  Aligned_cols=34  Identities=18%  Similarity=0.105  Sum_probs=24.9

Q ss_pred             cccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC
Q 042811           90 WPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR  126 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS  126 (130)
                      .|+|..|+||||||+.+.+.. .  ......+++..+
T Consensus        42 ll~G~~G~GKT~la~~~~~~~-~--~~~~~~~~i~~~   75 (226)
T TIGR03420        42 YLWGESGSGKSHLLQAACAAA-E--ERGKSAIYLPLA   75 (226)
T ss_pred             EEECCCCCCHHHHHHHHHHHH-H--hcCCcEEEEeHH
Confidence            399999999999999999976 2  233344555443

Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily

Probab=97.10  E-value=0.00026  Score=52.67  Aligned_cols=22  Identities=23%  Similarity=0.212  Sum_probs=20.0

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+|||||++.+++..
T Consensus        46 ~~l~G~~G~GKTtl~~~l~~~l   67 (269)
T TIGR03015        46 ILITGEVGAGKTTLIRNLLKRL   67 (269)
T ss_pred             EEEEcCCCCCHHHHHHHHHHhc
Confidence            3499999999999999999976

Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.

>PRK06893 DNA replication initiation factor; Validated

Probab=97.09  E-value=0.00032  Score=51.66  Aligned_cols=33  Identities=15%  Similarity=0.051  Sum_probs=24.9

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR  126 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS  126 (130)
                      |||..|+|||+|++.+.+...+   ....+.+++++
T Consensus        44 l~G~~G~GKThL~~ai~~~~~~---~~~~~~y~~~~   76 (229)
T PRK06893         44 IWGGKSSGKSHLLKAVSNHYLL---NQRTAIYIPLS   76 (229)
T ss_pred             EECCCCCCHHHHHHHHHHHHHH---cCCCeEEeeHH
Confidence            9999999999999999998732   22345666553

>PRK03839 putative kinase; Provisional

Probab=97.07  E-value=0.00031  Score=49.55  Aligned_cols=21  Identities=29%  Similarity=0.128  Sum_probs=18.0

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|.||.|+||||+++.+.+.
T Consensus         3 I~l~G~pGsGKsT~~~~La~~   23 (180)
T PRK03839          3 IAITGTPGVGKTTVSKLLAEK   23 (180)
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            347899999999999998664

>PRK05541 adenylylsulfate kinase; Provisional

Probab=97.06  E-value=0.00049  Score=48.35  Aligned_cols=21  Identities=33%  Similarity=0.626  Sum_probs=19.4

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++.|+.|+||||+++.+++..
T Consensus        11 ~i~G~~GsGKst~a~~l~~~l   31 (176)
T PRK05541         11 WITGLAGSGKTTIAKALYERL   31 (176)
T ss_pred             EEEcCCCCCHHHHHHHHHHHH
Confidence            389999999999999999977

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family

Probab=97.03  E-value=0.00037  Score=58.44  Aligned_cols=35  Identities=23%  Similarity=0.107  Sum_probs=25.1

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCC---eEEEEEeC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFL---IKMHDVVR  126 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd---~~~wv~VS  126 (130)
                      |+|..|+||||||+.+++.. .....+.   ..-|+.+.
T Consensus       180 L~Gp~GtGKTTLAr~i~~~~-~~~~~~~~~~~~~fv~i~  217 (615)
T TIGR02903       180 LYGPPGVGKTTAARLALEEA-KKLKHTPFAEDAPFVEVD  217 (615)
T ss_pred             EECCCCCCHHHHHHHHHHhh-hhccCCcccCCCCeEEEe
Confidence            99999999999999999876 3333332   23455554

Members of this protein family resemble the widely distributed ATP-dependent protease La, also called Lon and LonA. It resembles even more closely LonB, which is a LonA paralog found in genomes if and only if the species is capable of endospore formation (as in Bacillus subtilis, Clostridium tetani, and select other members of the Firmicutes) and expressed specifically in the forespore compartment. Members of this family are restricted to a subset of spore-forming species, and are very likely to participate in the program of endospore formation. We propose the designation LonC.

>PF05729 NACHT: NACHT domain

Probab=97.02  E-value=0.00076  Score=45.98  Aligned_cols=37  Identities=32%  Similarity=0.416  Sum_probs=26.4

Q ss_pred             cccCcCCCchhHHHHhhhhhhhhcc---CCCCeEEEEEeC
Q 042811           90 WPFGVEGVGKITSLSKSYPEFLEDE---GIFLIKMHDVVR  126 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~~~~~---~~Fd~~~wv~VS  126 (130)
                      +|.|.+|+|||||++.+........   ..|...+|.+.+
T Consensus         4 ~I~G~~G~GKStll~~~~~~~~~~~~~~~~~~~~~~~~~~   43 (166)
T PF05729_consen    4 WISGEPGSGKSTLLRKLAQQLAEEEPPPSKFPYPFFFSLR   43 (166)
T ss_pred             EEECCCCCChHHHHHHHHHHHHhcCcccccceEEEEEeeh
Confidence            4899999999999999988773211   014566666655

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP

Probab=97.01  E-value=9.8e-05  Score=53.04  Aligned_cols=20  Identities=30%  Similarity=0.479  Sum_probs=18.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||+|++.+.+..
T Consensus        25 l~G~rg~GKTsLl~~~~~~~   44 (234)
T PF01637_consen   25 LYGPRGSGKTSLLKEFINEL   44 (234)
T ss_dssp             EEESTTSSHHHHHHHHHHHC
T ss_pred             EEcCCcCCHHHHHHHHHHHh
Confidence            99999999999999998865

; GO: 0005524 ATP binding; PDB: 2FNA_A 2QEN_A.

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]

Probab=96.99  E-value=0.00072  Score=47.79  Aligned_cols=29  Identities=24%  Similarity=0.226  Sum_probs=23.0

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEE
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKM  121 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~  121 (130)
                      |-||.|+|||||++++-+.. +. +.|..-=
T Consensus        10 ITG~PGvGKtTl~~ki~e~L-~~-~g~kvgG   38 (179)
T COG1618          10 ITGRPGVGKTTLVLKIAEKL-RE-KGYKVGG   38 (179)
T ss_pred             EeCCCCccHHHHHHHHHHHH-Hh-cCceeee
Confidence            89999999999999999887 42 3465433

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]

Probab=96.95  E-value=0.00046  Score=52.84  Aligned_cols=27  Identities=26%  Similarity=0.241  Sum_probs=22.1

Q ss_pred             cCCCCccccCcCCCchhHHHHhhhhhh
Q 042811           84 RRNGNNWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        84 ~~~~~l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.++.+.++|..|+||||||..|-|..
T Consensus        50 e~lDHvLl~GPPGlGKTTLA~IIA~Em   76 (332)
T COG2255          50 EALDHVLLFGPPGLGKTTLAHIIANEL   76 (332)
T ss_pred             CCcCeEEeeCCCCCcHHHHHHHHHHHh
Confidence            344444599999999999999999865

>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases

Probab=96.94  E-value=0.00044  Score=48.43  Aligned_cols=22  Identities=27%  Similarity=0.389  Sum_probs=19.8

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +||.|..|+||||||+.+....
T Consensus         5 IwltGlsGsGKtTlA~~L~~~L   26 (156)
T PF01583_consen    5 IWLTGLSGSGKTTLARALERRL   26 (156)
T ss_dssp             EEEESSTTSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
Confidence            4589999999999999999876

Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []: Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins) Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This domain contains an ATP binding P-loop motif [].; GO: 0005524 ATP binding, 0016301 kinase activity, 0016772 transferase activity, transferring phosphorus-containing groups, 0000103 sulfate assimilation; PDB: 1M7H_B 1M7G_B 3CR7_B 1D6J_A 2OFW_G 1X6V_B 1XNJ_A 1XJQ_B 2PEY_A 2PEZ_B ....

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit

Probab=96.94  E-value=0.00015  Score=55.08  Aligned_cols=22  Identities=27%  Similarity=0.277  Sum_probs=19.7

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.++|..|+||||||+.+.+..
T Consensus        33 ~ll~Gp~G~GKT~la~~ia~~~   54 (305)
T TIGR00635        33 LLLYGPPGLGKTTLAHIIANEM   54 (305)
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            3499999999999999998865

RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions.

>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5)

Probab=96.94  E-value=0.00051  Score=44.77  Aligned_cols=22  Identities=32%  Similarity=0.652  Sum_probs=19.2

Q ss_pred             cccCcCCCchhHHHHhhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEFL  111 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~~  111 (130)
                      +|+|..|+|||+||+.+-.+..
T Consensus         2 ~i~G~~G~GKS~l~~~l~~~l~   23 (107)
T PF00910_consen    2 WIYGPPGIGKSTLAKELAKDLL   23 (107)
T ss_pred             EEECCCCCCHHHHHHHHHHHHH
Confidence            3899999999999999887763

All of the proteins bind ATP and, consequently, all of them carry the classical Walker A (phosphate-binding loop or P-loop) and Walker B (Mg2+-binding aspartic acid) motifs. Superfamily 3 consists of helicases encoded mainly by small DNA viruses and some large nucleocytoplasmic DNA viruses [, ]. Small viruses are very dependent on the host-cell machinery to replicate. SF3 helicase in small viruses is associated with an origin-binding domain. By pairing a domain that recognises the ori with a helicase, the virus can bypass the host-cell-based regulation pathway and initiate its own replication. The protein binds to the viral ori leading to origin unwinding. Cellular replication proteins are then recruited to the ori and the viral DNA is replicated. In SF3 helicases the Walker A and Walker B motifs are separated by spacers of rather uniform, and relatively short, length. In addition to the A and B motifs this family is characterised by a third motif (C) which resides between the B motif and the C terminus of the conserved region. This motif consists of an Asn residue preceded by a run of hydrophobic residues []. Several structures of SF3 helicases have been solved []. They all possess the same core alpha/beta fold, consisting of a five-stranded parallel beta sheet flanked on both sides by several alpha helices. In contrast to SF1 and SF2 helicases, which have RecA-like core folds, the strand connectivity within the alpha/beta core domain is that of AAA+ proteins []. The SF3 helicase proteins assemble into a hexameric ring. Some proteins known to contain an SF3 helicase domain are listed below: Polyomavirus large T antigen. It initiates DNA unwinding and replication via interactions with the viral origin of replication. Papillomavirus E1 protein. An ATP-dependent DNA helicase required for initiation of viral DNA replication. Parvovirus Rep/NS1 protein, which is also required for the initiation of viral replication. Poxviridae and other large DNA viruses D5 protein. Bacteriophage DNA primase/helicase protein. Bacterial prophage DNA primase/helicase protein. The entry represents the core alpha/beta fold of the SF3 helicase domain found predominantly in DNA viruses.; GO: 0003723 RNA binding, 0003724 RNA helicase activity

>smart00382 AAA ATPases associated with a variety of cellular activities

Probab=96.92  E-value=0.00049  Score=44.72  Aligned_cols=21  Identities=29%  Similarity=0.238  Sum_probs=19.0

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+|||||++.+.+..
T Consensus         6 ~l~G~~G~GKTtl~~~l~~~~   26 (148)
T smart00382        6 LIVGPPGSGKTTLARALAREL   26 (148)
T ss_pred             EEECCCCCcHHHHHHHHHhcc
Confidence            489999999999999998876

AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.

>PRK06762 hypothetical protein; Provisional

Probab=96.91  E-value=0.00053  Score=47.60  Aligned_cols=21  Identities=24%  Similarity=0.177  Sum_probs=18.0

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +|.|+.|+||||+|+.+.+..
T Consensus         6 ~i~G~~GsGKST~A~~L~~~l   26 (166)
T PRK06762          6 IIRGNSGSGKTTIAKQLQERL   26 (166)
T ss_pred             EEECCCCCCHHHHHHHHHHHh
Confidence            389999999999999887653

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways

Probab=96.91  E-value=0.00046  Score=47.68  Aligned_cols=26  Identities=23%  Similarity=0.139  Sum_probs=21.8

Q ss_pred             CCccccCcCCCchhHHHHhhhhhhhh
Q 042811           87 GNNWPFGVEGVGKITSLSKSYPEFLE  112 (130)
Q Consensus        87 ~~l~I~GmGGvGKTTLak~v~~~~~~  112 (130)
                      .+++++|-.|+|||||++.+......
T Consensus         2 krimliG~~g~GKTTL~q~L~~~~~~   27 (143)
T PF10662_consen    2 KRIMLIGPSGSGKTTLAQALNGEEIR   27 (143)
T ss_pred             ceEEEECCCCCCHHHHHHHHcCCCCC
Confidence            45668999999999999999877643

Both pathways require coenzyme B12 (adenosylcobalamin, AdoCbl). Bacteria that harbour these pathways can use ethanolamine as a source of carbon and nitrogen, or propanediol as a sole carbon and energy source, respectively. The exact roles of the EutP and PduV proteins in these respective pathways are not yet determined. Members of this family contain P-loop consensus motifs in the N-terminal part, and are distantly related to various GTPases and ATPases, including ATPase components of transport systems. Propanediol degradation is thought to be important for the natural Salmonella populations, since propanediol is produced by the fermentation of the common plant sugars rhamnose and fucose [, ]. More than 1% of the Salmonella enterica genome is devoted to the utilisation of propanediol and cobalamin biosynthesis. In vivo expression technology has indicated that propanediol utilisation (pdu) genes may be important for growth in host tissues, and competitive index studies with mice have shown that pdu mutations confer a virulence defect [, ]. The pdu operon is contiguous and co-regulated with the cobalamin (B12) biosynthesis cob operon, indicating that propanediol catabolism may be the primary reason for de novo B12 synthesis in Salmonella [, , ]. Please see IPR003207 from INTERPRO, IPR003208 from INTERPRO, IPR009204 from INTERPRO, IPR009191 from INTERPRO, IPR009192 from INTERPRO for more details on the propanediol utilisation pathway and the pdu operon.; GO: 0005524 ATP binding, 0006576 cellular biogenic amine metabolic process

>PRK06217 hypothetical protein; Validated

Probab=96.90  E-value=0.00052  Score=48.69  Aligned_cols=23  Identities=17%  Similarity=0.072  Sum_probs=19.6

Q ss_pred             CccccCcCCCchhHHHHhhhhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +|.|.|+.|+|||||++.+....
T Consensus         3 ~I~i~G~~GsGKSTla~~L~~~l   25 (183)
T PRK06217          3 RIHITGASGSGTTTLGAALAERL   25 (183)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHc
Confidence            35689999999999999987764

>PRK00625 shikimate kinase; Provisional

Probab=96.90  E-value=0.00055  Score=48.61  Aligned_cols=21  Identities=19%  Similarity=0.039  Sum_probs=17.6

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+||.|+||||+++.+-+.
T Consensus         3 I~LiG~pGsGKTT~~k~La~~   23 (173)
T PRK00625          3 IFLCGLPTVGKTSFGKALAKF   23 (173)
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            447999999999999988553

>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein

Probab=96.90  E-value=0.001  Score=49.66  Aligned_cols=32  Identities=19%  Similarity=0.060  Sum_probs=26.9

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEe
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVV  125 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~V  125 (130)
                      |+|..|+|||||++.+....   .+.|+.+.+++-
T Consensus        18 iIG~sGSGKT~li~~lL~~~---~~~f~~I~l~t~   49 (241)
T PF04665_consen   18 IIGKSGSGKTTLIKSLLYYL---RHKFDHIFLITP   49 (241)
T ss_pred             EECCCCCCHHHHHHHHHHhh---cccCCEEEEEec
Confidence            99999999999999998866   578987766643

This is thought to be an ATPase involved in viral DNA packaging [].

>PRK05480 uridine/cytidine kinase; Provisional

Probab=96.87  E-value=0.00058  Score=49.29  Aligned_cols=20  Identities=40%  Similarity=0.453  Sum_probs=18.6

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+....
T Consensus        11 I~G~sGsGKTTl~~~l~~~l   30 (209)
T PRK05480         11 IAGGSGSGKTTVASTIYEEL   30 (209)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            89999999999999998865

>PRK13342 recombination factor protein RarA; Reviewed

Probab=96.87  E-value=0.00022  Score=56.90  Aligned_cols=20  Identities=25%  Similarity=0.177  Sum_probs=18.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+||||||+.+.+..
T Consensus        41 L~GppGtGKTtLA~~ia~~~   60 (413)
T PRK13342         41 LWGPPGTGKTTLARIIAGAT   60 (413)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            99999999999999998865

>TIGR00235 udk uridine kinase

Probab=96.86  E-value=0.00057  Score=49.42  Aligned_cols=20  Identities=35%  Similarity=0.385  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+....
T Consensus        11 I~G~sGsGKSTl~~~l~~~l   30 (207)
T TIGR00235        11 IGGGSGSGKTTVARKIYEQL   30 (207)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            89999999999999998765

Model contains a number of longer eukaryotic proteins and starts bringing in phosphoribulokinase hits at scores of 160 and below

>PRK08233 hypothetical protein; Provisional

Probab=96.85  E-value=0.00061  Score=47.63  Aligned_cols=20  Identities=25%  Similarity=0.199  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |-|..|+||||||+.+....
T Consensus         8 I~G~~GsGKtTla~~L~~~l   27 (182)
T PRK08233          8 IAAVSGGGKTTLTERLTHKL   27 (182)
T ss_pred             EECCCCCCHHHHHHHHHhhC
Confidence            78999999999999998765

>PRK00131 aroK shikimate kinase; Reviewed

Probab=96.85  E-value=0.00063  Score=47.06  Aligned_cols=22  Identities=23%  Similarity=0.066  Sum_probs=19.1

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|+|+.|+||||+|+.+....
T Consensus         7 i~l~G~~GsGKstla~~La~~l   28 (175)
T PRK00131          7 IVLIGFMGAGKSTIGRLLAKRL   28 (175)
T ss_pred             EEEEcCCCCCHHHHHHHHHHHh
Confidence            3489999999999999987764

>PF13173 AAA_14: AAA domain

Probab=96.80  E-value=0.00075  Score=45.13  Aligned_cols=20  Identities=35%  Similarity=0.429  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|.-|+|||||++.+..+.
T Consensus         7 l~G~R~vGKTtll~~~~~~~   26 (128)
T PF13173_consen    7 LTGPRGVGKTTLLKQLAKDL   26 (128)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            89999999999999998765

>PTZ00301 uridine kinase; Provisional

Probab=96.79  E-value=0.0012  Score=48.36  Aligned_cols=20  Identities=25%  Similarity=0.298  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |-|-+|+||||||+.|.+..
T Consensus         8 IaG~SgSGKTTla~~l~~~l   27 (210)
T PTZ00301          8 ISGASGSGKSSLSTNIVSEL   27 (210)
T ss_pred             EECCCcCCHHHHHHHHHHHH
Confidence            88999999999999988765

>PRK13947 shikimate kinase; Provisional

Probab=96.77  E-value=0.00078  Score=46.88  Aligned_cols=21  Identities=24%  Similarity=0.169  Sum_probs=18.4

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+||.|+||||+++.+-+.
T Consensus         4 I~l~G~~GsGKst~a~~La~~   24 (171)
T PRK13947          4 IVLIGFMGTGKTTVGKRVATT   24 (171)
T ss_pred             EEEEcCCCCCHHHHHHHHHHH
Confidence            458999999999999998665

>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]

Probab=96.71  E-value=0.00079  Score=48.38  Aligned_cols=22  Identities=32%  Similarity=0.288  Sum_probs=19.1

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|.+|+|||||+..+..+.
T Consensus         8 ivv~G~~g~GKTtl~~~l~~~~   29 (219)
T COG1100           8 IVVLGDGGVGKTTLLNRLVGDE   29 (219)
T ss_pred             EEEEcCCCccHHHHHHHHhcCc
Confidence            3499999999999999987765

>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases

Probab=96.68  E-value=0.001  Score=43.23  Aligned_cols=21  Identities=24%  Similarity=0.264  Sum_probs=18.3

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|-.|+|||||++.+.+..
T Consensus         3 ~V~G~~g~GKTsLi~~l~~~~   23 (119)
T PF08477_consen    3 VVLGDSGVGKTSLIRRLCGGE   23 (119)
T ss_dssp             EEECSTTSSHHHHHHHHHHSS
T ss_pred             EEECcCCCCHHHHHHHHhcCC
Confidence            378999999999999987655

They have a unique domain organisation, with tandem GTP-binding domains and two EF hand domains (IPR002048 from INTERPRO), that may bind calcium. They are also larger than classical small GTPases. It has been proposed that they are involved in mitochondrial homeostasis and apoptosis []. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction, 0005622 intracellular; PDB: 2IWR_A 2BMJ_A 3IHW_A 2ZEJ_A 3D6T_B 3DPU_A.

>PRK13949 shikimate kinase; Provisional

Probab=96.65  E-value=0.0011  Score=46.81  Aligned_cols=22  Identities=27%  Similarity=0.190  Sum_probs=18.5

Q ss_pred             CccccCcCCCchhHHHHhhhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~~  109 (130)
                      .+.|+||.|+|||||++.+.+.
T Consensus         3 ~I~liG~~GsGKstl~~~La~~   24 (169)
T PRK13949          3 RIFLVGYMGAGKTTLGKALARE   24 (169)
T ss_pred             EEEEECCCCCCHHHHHHHHHHH
Confidence            4558999999999999987654

>PRK10078 ribose 1,5-bisphosphokinase; Provisional

Probab=96.65  E-value=0.001  Score=47.32  Aligned_cols=21  Identities=29%  Similarity=0.423  Sum_probs=18.3

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|+.|+|||||++.+....
T Consensus         6 ~l~G~sGsGKsTl~~~l~~~~   26 (186)
T PRK10078          6 WLMGPSGSGKDSLLAALRQRE   26 (186)
T ss_pred             EEECCCCCCHHHHHHHHhccC
Confidence            389999999999999997653

>PRK06620 hypothetical protein; Validated

Probab=96.63  E-value=0.0011  Score=48.57  Aligned_cols=22  Identities=14%  Similarity=-0.221  Sum_probs=18.7

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|||..|+|||||++.+.+..
T Consensus        47 l~l~Gp~G~GKThLl~a~~~~~   68 (214)
T PRK06620         47 LLIKGPSSSGKTYLTKIWQNLS   68 (214)
T ss_pred             EEEECCCCCCHHHHHHHHHhcc
Confidence            3499999999999999876654

>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN

Probab=96.62  E-value=0.0011  Score=46.49  Aligned_cols=19  Identities=32%  Similarity=0.331  Sum_probs=16.9

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|+.|+|||||++.+...
T Consensus         6 i~G~sGsGKttl~~~l~~~   24 (179)
T TIGR02322         6 VVGPSGAGKDTLLDYARAR   24 (179)
T ss_pred             EECCCCCCHHHHHHHHHHH
Confidence            8999999999999997554

Members of this family resemble PhnN of phosphonate utilization operons, where different such operons confer the ability to use somewhat different profiles of C-P bond-containing compounds (see PubMed:15231805), including phosphites as well as phosphonates. PhnN in E. coli shows considerable homology to guanylate kinases (EC 2.7.4.8), and has actually been shown to act as a ribose 1,5-bisphosphokinase (PRPP forming). This suggests an analogous kinase reaction for phosphonate metabolism, converting 5-phosphoalpha-1-(methylphosphono)ribose to methylphosphono-PRPP.

>PRK08084 DNA replication initiation factor; Provisional

Probab=96.60  E-value=0.0016  Score=48.17  Aligned_cols=20  Identities=25%  Similarity=0.418  Sum_probs=19.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |||..|+|||+|++.+.+..
T Consensus        50 l~Gp~G~GKThLl~a~~~~~   69 (235)
T PRK08084         50 LWSREGAGRSHLLHAACAEL   69 (235)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            99999999999999999876

>TIGR02881 spore_V_K stage V sporulation protein K

Probab=96.56  E-value=0.0019  Score=48.33  Aligned_cols=21  Identities=29%  Similarity=0.102  Sum_probs=18.7

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++|..|+||||||+.+.+..
T Consensus        46 ll~GppGtGKTtlA~~ia~~l   66 (261)
T TIGR02881        46 IFKGNPGTGKTTVARILGKLF   66 (261)
T ss_pred             EEEcCCCCCHHHHHHHHHHHH
Confidence            489999999999999998764

Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group.

>PRK04040 adenylate kinase; Provisional

Probab=96.54  E-value=0.0013  Score=47.19  Aligned_cols=20  Identities=45%  Similarity=0.635  Sum_probs=17.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|+.|+||||+++.+....
T Consensus         7 v~G~pG~GKtt~~~~l~~~l   26 (188)
T PRK04040          7 VTGVPGVGKTTVLNKALEKL   26 (188)
T ss_pred             EEeCCCCCHHHHHHHHHHHh
Confidence            89999999999999986654

>PRK06547 hypothetical protein; Provisional

Probab=96.50  E-value=0.0015  Score=46.29  Aligned_cols=20  Identities=25%  Similarity=0.101  Sum_probs=17.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+.+..
T Consensus        20 i~G~~GsGKTt~a~~l~~~~   39 (172)
T PRK06547         20 IDGRSGSGKTTLAGALAART   39 (172)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            88999999999999997753

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B

Probab=96.49  E-value=0.0014  Score=43.29  Aligned_cols=36  Identities=14%  Similarity=-0.019  Sum_probs=24.0

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhc--cCCCCeEEEEEeC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLED--EGIFLIKMHDVVR  126 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~--~~~Fd~~~wv~VS  126 (130)
                      |+|-.|+||||+++.+.++....  ...-..++|+..+
T Consensus         9 i~G~~G~GKT~~~~~~~~~~~~~~~~~~~~~~~~~~~~   46 (131)
T PF13401_consen    9 ISGPPGSGKTTLIKRLARQLNAEAEIKNHPDVIYVNCP   46 (131)
T ss_dssp             EEE-TTSSHHHHHHHHHHHHHHHHHHCCCEEEEEEEHH
T ss_pred             EEcCCCCCHHHHHHHHHHHhHHhhhccCCCcEEEEEeC
Confidence            89999999999999999876210  0012345577654

>PRK06851 hypothetical protein; Provisional

Probab=96.49  E-value=0.0085  Score=47.44  Aligned_cols=35  Identities=31%  Similarity=0.208  Sum_probs=29.4

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeCC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVRD  127 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS~  127 (130)
                      |-|..|+|||||++++.... . +..+++-++-|-+|
T Consensus       219 i~G~pG~GKstl~~~i~~~a-~-~~G~~v~~~hC~~d  253 (367)
T PRK06851        219 LKGRPGTGKSTMLKKIAKAA-E-ERGFDVEVYHCGFD  253 (367)
T ss_pred             EeCCCCCcHHHHHHHHHHHH-H-hCCCeEEEEeCCCC
Confidence            99999999999999999988 3 46788777776663

>PHA00729 NTP-binding motif containing protein

Probab=96.48  E-value=0.0016  Score=48.23  Aligned_cols=23  Identities=30%  Similarity=0.335  Sum_probs=19.8

Q ss_pred             CccccCcCCCchhHHHHhhhhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .+.|.|..|+||||||..|.+..
T Consensus        19 nIlItG~pGvGKT~LA~aLa~~l   41 (226)
T PHA00729         19 SAVIFGKQGSGKTTYALKVARDV   41 (226)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHH
Confidence            34599999999999999998864

>PRK08727 hypothetical protein; Validated

Probab=96.48  E-value=0.0023  Score=47.28  Aligned_cols=34  Identities=12%  Similarity=-0.102  Sum_probs=25.1

Q ss_pred             ccccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEe
Q 042811           89 NWPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVV  125 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~V  125 (130)
                      +.|+|..|+|||+|++.+.+..++  . ...++++++
T Consensus        44 l~l~G~~G~GKThL~~a~~~~~~~--~-~~~~~y~~~   77 (233)
T PRK08727         44 LYLSGPAGTGKTHLALALCAAAEQ--A-GRSSAYLPL   77 (233)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHH--c-CCcEEEEeH
Confidence            349999999999999999987732  2 234556554

>PRK05642 DNA replication initiation factor; Validated

Probab=96.46  E-value=0.0027  Score=46.95  Aligned_cols=21  Identities=29%  Similarity=0.597  Sum_probs=19.3

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|||-.|+|||+|++.+.+..
T Consensus        49 ~l~G~~G~GKTHLl~a~~~~~   69 (234)
T PRK05642         49 YLWGKDGVGRSHLLQAACLRF   69 (234)
T ss_pred             EEECCCCCCHHHHHHHHHHHH
Confidence            499999999999999998876

>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily

Probab=96.45  E-value=0.0017  Score=45.54  Aligned_cols=21  Identities=29%  Similarity=0.230  Sum_probs=17.7

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|.|..|+|||||++.+...
T Consensus         6 i~i~G~~GsGKsTl~~~l~~~   26 (188)
T TIGR01360         6 IFIVGGPGSGKGTQCEKIVEK   26 (188)
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            348999999999999988643

Members of this family are adenylate kinase, EC 2.7.4.3. This clade is found only in eukaryotes and includes human adenylate kinase isozyme 1 (myokinase). Within the adenylate kinase superfamily, this set appears specifically closely related to a subfamily of eukaryotic UMP-CMP kinases (TIGR01359), rather than to the large clade of bacterial, archaeal, and eukaryotic adenylate kinase family members in TIGR01351.

>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT)

Probab=96.43  E-value=0.0018  Score=45.53  Aligned_cols=21  Identities=14%  Similarity=-0.007  Sum_probs=18.4

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++.|+.|+||||+|+.+-...
T Consensus         6 ~l~G~~gsGKst~a~~l~~~~   26 (175)
T cd00227           6 ILNGGSSAGKSSIARALQSVL   26 (175)
T ss_pred             EEECCCCCCHHHHHHHHHHhh
Confidence            389999999999999987764

Cm-inactivating enzyme; modifies the primary (C-3) hydroxyl of the antibiotic. Related structurally to shikimate kinase II.

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars

Probab=96.43  E-value=0.0021  Score=38.59  Aligned_cols=19  Identities=32%  Similarity=0.226  Sum_probs=17.4

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|..|+||||+++.+-+.
T Consensus         4 i~G~~gsGKst~~~~l~~~   22 (69)
T cd02019           4 ITGGSGSGKSTVAKKLAEQ   22 (69)
T ss_pred             EECCCCCCHHHHHHHHHHH
Confidence            6899999999999998876

Members of this family play a wide variety of essential roles in nucleotide metabolism, the biosynthesis of coenzymes and aromatic compounds, as well as the metabolism of sugar and sulfate.

>PRK12377 putative replication protein; Provisional

Probab=96.42  E-value=0.0022  Score=48.07  Aligned_cols=35  Identities=17%  Similarity=-0.091  Sum_probs=26.8

Q ss_pred             ccccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC
Q 042811           89 NWPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR  126 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS  126 (130)
                      +.++|-.|+|||+||..|.+...   ...-.+++++++
T Consensus       104 l~l~G~~GtGKThLa~AIa~~l~---~~g~~v~~i~~~  138 (248)
T PRK12377        104 FVFSGKPGTGKNHLAAAIGNRLL---AKGRSVIVVTVP  138 (248)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHH---HcCCCeEEEEHH
Confidence            44999999999999999999883   233345776654

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication

Probab=96.40  E-value=0.0032  Score=46.17  Aligned_cols=23  Identities=26%  Similarity=0.323  Sum_probs=20.6

Q ss_pred             ccccCcCCCchhHHHHhhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEFL  111 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~~  111 (130)
                      +.|||-.|+|||+|++.++|...
T Consensus        37 l~l~G~~G~GKTHLL~Ai~~~~~   59 (219)
T PF00308_consen   37 LFLYGPSGLGKTHLLQAIANEAQ   59 (219)
T ss_dssp             EEEEESTTSSHHHHHHHHHHHHH
T ss_pred             eEEECCCCCCHHHHHHHHHHHHH
Confidence            34999999999999999999873

DnaA is an ATP- and DNA-binding protein. It binds specifically to 9 bp nucleotide repeats known as dnaA boxes which are found in the chromosome origin of replication (oriC). DnaA is a protein of about 50 kDa that contains two conserved regions: the first is located in the N-terminal half and corresponds to the ATP-binding domain, the second is located in the C-terminal half and could be involved in DNA-binding. The protein may also bind the RNA polymerase beta subunit, the dnaB and dnaZ proteins, and the groE gene products (chaperonins) [].; PDB: 2KJQ_A 2Z4S_A 2Z4R_C 2HCB_B 3R8F_C 1L8Q_A 3SC3_B 3BOS_A.

>PRK05057 aroK shikimate kinase I; Reviewed

Probab=96.40  E-value=0.0019  Score=45.58  Aligned_cols=22  Identities=23%  Similarity=0.197  Sum_probs=19.0

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|+.|+|||||++.+-+..
T Consensus         7 I~liG~~GaGKStl~~~La~~l   28 (172)
T PRK05057          7 IFLVGPMGAGKSTIGRQLAQQL   28 (172)
T ss_pred             EEEECCCCcCHHHHHHHHHHHc
Confidence            4489999999999999997654

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed

Probab=96.38  E-value=0.0018  Score=50.00  Aligned_cols=21  Identities=29%  Similarity=0.355  Sum_probs=19.3

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+||||||+.+.+..
T Consensus        55 ll~GppG~GKT~la~~ia~~l   75 (328)
T PRK00080         55 LLYGPPGLGKTTLANIIANEM   75 (328)
T ss_pred             EEECCCCccHHHHHHHHHHHh
Confidence            499999999999999998875

>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]

Probab=96.38  E-value=0.002  Score=46.01  Aligned_cols=21  Identities=29%  Similarity=0.219  Sum_probs=18.1

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|.|.+|+||||+|+.+-+.
T Consensus         3 iiilG~pGaGK~T~A~~La~~   23 (178)
T COG0563           3 ILILGPPGAGKSTLAKKLAKK   23 (178)
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            458899999999999998664

>PRK08116 hypothetical protein; Validated

Probab=96.38  E-value=0.0025  Score=48.24  Aligned_cols=34  Identities=18%  Similarity=0.050  Sum_probs=25.7

Q ss_pred             ccccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEe
Q 042811           89 NWPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVV  125 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~V  125 (130)
                      +.+||-.|+|||+||..|.+...+   .--.++++++
T Consensus       117 l~l~G~~GtGKThLa~aia~~l~~---~~~~v~~~~~  150 (268)
T PRK08116        117 LLLWGSVGTGKTYLAACIANELIE---KGVPVIFVNF  150 (268)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHH---cCCeEEEEEH
Confidence            349999999999999999998732   2334566654

>PRK03731 aroL shikimate kinase II; Reviewed

Probab=96.37  E-value=0.0021  Score=44.81  Aligned_cols=22  Identities=23%  Similarity=0.216  Sum_probs=18.9

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|+.|+||||+++.+-+..
T Consensus         5 i~~~G~~GsGKst~~~~la~~l   26 (171)
T PRK03731          5 LFLVGARGCGKTTVGMALAQAL   26 (171)
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            4489999999999999987654

>PRK13975 thymidylate kinase; Provisional

Probab=96.37  E-value=0.0021  Score=45.69  Aligned_cols=20  Identities=25%  Similarity=0.292  Sum_probs=18.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|+-|+||||+++.+.+..
T Consensus         7 ieG~~GsGKtT~~~~L~~~l   26 (196)
T PRK13975          7 FEGIDGSGKTTQAKLLAEKL   26 (196)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            88999999999999998876

>cd04139 RalA_RalB RalA/RalB subfamily

Probab=96.37  E-value=0.002  Score=43.70  Aligned_cols=20  Identities=25%  Similarity=0.147  Sum_probs=16.9

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.++|.+|+|||||++.+.+
T Consensus         3 i~~~G~~~~GKTsl~~~l~~   22 (164)
T cd04139           3 VIVVGAGGVGKSALTLQFMY   22 (164)
T ss_pred             EEEECCCCCCHHHHHHHHHh
Confidence            34799999999999998754

The Ral (Ras-like) subfamily consists of the highly homologous RalA and RalB. Ral proteins are believed to play a crucial role in tumorigenesis, metastasis, endocytosis, and actin cytoskeleton dynamics. Despite their high sequence similarity (80% sequence identity), nonoverlapping and opposing functions have been assigned to RalA and RalBs in tumor migration. In human bladder and prostate cancer cells, RalB promotes migration while RalA inhibits it. A Ral-specific set of GEFs has been identified that are activated by Ras binding. This RalGEF activity is enhanced by Ras binding to another of its target proteins, phosphatidylinositol 3-kinase (PI3K). Ral effectors include RLIP76/RalBP1, a Rac/cdc42 GAP, and the exocyst (Sec6/8) complex, a heterooctomeric protein complex that is involved in tethering vesicles to specific sites on the plasma membrane prior to exocytosis. In rat kidney cells, RalB is required for functional assembly of the exo

>PRK03846 adenylylsulfate kinase; Provisional

Probab=96.36  E-value=0.002  Score=46.28  Aligned_cols=21  Identities=29%  Similarity=0.436  Sum_probs=18.8

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +|.|+.|+||||||+.+....
T Consensus        28 ~i~G~~GsGKSTla~~l~~~l   48 (198)
T PRK03846         28 WFTGLSGSGKSTVAGALEEAL   48 (198)
T ss_pred             EEECCCCCCHHHHHHHHHHHH
Confidence            399999999999999998865

>TIGR03263 guanyl_kin guanylate kinase

Probab=96.36  E-value=0.002  Score=45.18  Aligned_cols=19  Identities=37%  Similarity=0.361  Sum_probs=17.5

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|+|||||++.+.+.
T Consensus         6 l~G~~GsGKsTl~~~L~~~   24 (180)
T TIGR03263         6 ISGPSGVGKSTLVKALLEE   24 (180)
T ss_pred             EECCCCCCHHHHHHHHHcc
Confidence            8999999999999999774

Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP.

>PRK09087 hypothetical protein; Validated

Probab=96.36  E-value=0.002  Score=47.53  Aligned_cols=20  Identities=25%  Similarity=0.046  Sum_probs=17.7

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|||..|+|||||++.+.+.
T Consensus        48 ~l~G~~GsGKThLl~~~~~~   67 (226)
T PRK09087         48 VLAGPVGSGKTHLASIWREK   67 (226)
T ss_pred             EEECCCCCCHHHHHHHHHHh
Confidence            39999999999999987754

>PRK08903 DnaA regulatory inactivator Hda; Validated

Probab=96.36  E-value=0.002  Score=47.00  Aligned_cols=21  Identities=19%  Similarity=0.352  Sum_probs=19.4

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|-.|+|||+||+.+.+..
T Consensus        46 ~l~G~~G~GKT~La~ai~~~~   66 (227)
T PRK08903         46 YLWGEAGSGRSHLLQALVADA   66 (227)
T ss_pred             EEECCCCCCHHHHHHHHHHHH
Confidence            499999999999999999975

>PRK13695 putative NTPase; Provisional

Probab=96.35  E-value=0.0022  Score=45.04  Aligned_cols=20  Identities=35%  Similarity=0.180  Sum_probs=17.3

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|.|..|+|||||++.+++.
T Consensus         4 ~ltG~~G~GKTTll~~i~~~   23 (174)
T PRK13695          4 GITGPPGVGKTTLVLKIAEL   23 (174)
T ss_pred             EEECCCCCCHHHHHHHHHHH
Confidence            37899999999999997655

>PRK13946 shikimate kinase; Provisional

Probab=96.34  E-value=0.0022  Score=45.63  Aligned_cols=22  Identities=23%  Similarity=0.146  Sum_probs=19.2

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.+.||.|+||||+++.+-+..
T Consensus        13 I~l~G~~GsGKsti~~~LA~~L   34 (184)
T PRK13946         13 VVLVGLMGAGKSTVGRRLATML   34 (184)
T ss_pred             EEEECCCCCCHHHHHHHHHHHc
Confidence            3489999999999999998765

>TIGR01242 26Sp45 26S proteasome subunit P45 family

Probab=96.31  E-value=0.0023  Score=50.21  Aligned_cols=20  Identities=25%  Similarity=0.253  Sum_probs=18.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+||||||+.+.+..
T Consensus       161 L~GppGtGKT~lakaia~~l  180 (364)
T TIGR01242       161 LYGPPGTGKTLLAKAVAHET  180 (364)
T ss_pred             EECCCCCCHHHHHHHHHHhC
Confidence            89999999999999999865

Many proteins may score above the trusted cutoff because an internal

>PRK00889 adenylylsulfate kinase; Provisional

Probab=96.31  E-value=0.0024  Score=44.77  Aligned_cols=22  Identities=27%  Similarity=0.422  Sum_probs=19.3

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|.|..|+||||+++.+....
T Consensus         7 i~~~G~~GsGKST~a~~la~~l   28 (175)
T PRK00889          7 VWFTGLSGAGKTTIARALAEKL   28 (175)
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
Confidence            3489999999999999998876

>PRK06696 uridine kinase; Validated

Probab=96.30  E-value=0.0023  Score=46.81  Aligned_cols=20  Identities=25%  Similarity=0.189  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|.+|+||||||+.+....
T Consensus        27 I~G~sgsGKSTlA~~L~~~l   46 (223)
T PRK06696         27 IDGITASGKTTFADELAEEI   46 (223)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            78999999999999998866

>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism]

Probab=96.28  E-value=0.0022  Score=46.96  Aligned_cols=20  Identities=25%  Similarity=0.174  Sum_probs=18.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |=||=|+||||||+.+.+..
T Consensus         9 I~G~IG~GKSTLa~~La~~l   28 (216)
T COG1428           9 IEGMIGAGKSTLAQALAEHL   28 (216)
T ss_pred             EecccccCHHHHHHHHHHHh
Confidence            78999999999999999876

>TIGR02237 recomb_radB DNA repair and recombination protein RadB

Probab=96.25  E-value=0.0046  Score=44.43  Aligned_cols=32  Identities=13%  Similarity=-0.150  Sum_probs=25.0

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEe
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVV  125 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~V  125 (130)
                      |+|.+|+|||||+..+.....   ..-..++|+..
T Consensus        17 i~G~~GsGKT~l~~~~~~~~~---~~g~~v~yi~~   48 (209)
T TIGR02237        17 IYGPPGSGKTNICMILAVNAA---RQGKKVVYIDT   48 (209)
T ss_pred             EECCCCCCHHHHHHHHHHHHH---hCCCeEEEEEC
Confidence            999999999999998776552   33467787765

This family consists exclusively of archaeal RadB protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239) and DMC1 (TIGR02238), and archaeal RadA (TIGR02236).

>PRK07952 DNA replication protein DnaC; Validated

Probab=96.25  E-value=0.0035  Score=46.94  Aligned_cols=35  Identities=20%  Similarity=-0.058  Sum_probs=26.0

Q ss_pred             ccccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC
Q 042811           89 NWPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR  126 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS  126 (130)
                      +.++|-+|+|||+|+..+.+...+   .-..+++++++
T Consensus       102 ~~l~G~~GtGKThLa~aia~~l~~---~g~~v~~it~~  136 (244)
T PRK07952        102 FIFSGKPGTGKNHLAAAICNELLL---RGKSVLIITVA  136 (244)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHh---cCCeEEEEEHH
Confidence            349999999999999999998732   22355666553

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed

Probab=96.24  E-value=0.0027  Score=54.32  Aligned_cols=20  Identities=30%  Similarity=0.277  Sum_probs=18.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      +||..|+||||||+.+.+..
T Consensus        57 L~GPpGtGKTTLA~aIA~~~   76 (725)
T PRK13341         57 LYGPPGVGKTTLARIIANHT   76 (725)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            99999999999999999865

>PRK00300 gmk guanylate kinase; Provisional

Probab=96.22  E-value=0.0027  Score=45.48  Aligned_cols=20  Identities=25%  Similarity=0.165  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+....
T Consensus        10 i~G~sGsGKstl~~~l~~~~   29 (205)
T PRK00300         10 LSGPSGAGKSTLVKALLERD   29 (205)
T ss_pred             EECCCCCCHHHHHHHHHhhC
Confidence            99999999999999998765

>cd04155 Arl3 Arl3 subfamily

Probab=96.21  E-value=0.0026  Score=43.84  Aligned_cols=20  Identities=30%  Similarity=0.426  Sum_probs=18.3

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||++.+.+.
T Consensus        18 ~i~G~~g~GKStLl~~l~~~   37 (173)
T cd04155          18 LILGLDNAGKTTILKQLASE   37 (173)
T ss_pred             EEEccCCCCHHHHHHHHhcC
Confidence            39999999999999999885

Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension. In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form. The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector. Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2). It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery. In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.

>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain

Probab=96.20  E-value=0.0029  Score=39.00  Aligned_cols=20  Identities=30%  Similarity=0.308  Sum_probs=17.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|.+|+||||++..+-...
T Consensus         4 ~~g~~G~Gktt~~~~l~~~l   23 (99)
T cd01983           4 VTGKGGVGKTTLAANLAAAL   23 (99)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            67899999999999988876

Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion.

>TIGR00231 small_GTP small GTP-binding protein domain

Probab=96.18  E-value=0.0029  Score=41.89  Aligned_cols=21  Identities=29%  Similarity=0.189  Sum_probs=18.3

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++|..|+|||||+..+....
T Consensus         5 ~~~G~~~~GKstl~~~l~~~~   25 (161)
T TIGR00231         5 VIVGDPNVGKSTLLNRLLGNK   25 (161)
T ss_pred             EEECCCCCCHHHHHHHHhCCC
Confidence            378999999999999987665

This model recognizes a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model.

>TIGR01287 nifH nitrogenase iron protein

Probab=96.18  E-value=0.0026  Score=47.81  Aligned_cols=17  Identities=29%  Similarity=0.472  Sum_probs=14.3

Q ss_pred             ccCcCCCchhHHHHhhh
Q 042811           91 PFGVEGVGKITSLSKSY  107 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~  107 (130)
                      |+|-|||||||++-.+-
T Consensus         5 ~~gKGGVGKTT~a~nLA   21 (275)
T TIGR01287         5 IYGKGGIGKSTTTQNIA   21 (275)
T ss_pred             EeCCCcCcHHHHHHHHH
Confidence            68999999999877653

This model describes nitrogenase (EC 1.18.6.1) iron protein, also called nitrogenase reductase or nitrogenase component II. This model includes molybdenum-iron nitrogenase reductase (nifH), vanadium-iron nitrogenase reductase (vnfH), and iron-iron nitrogenase reductase (anfH). The model excludes the homologous protein from the light-independent protochlorophyllide reductase.

>PRK14530 adenylate kinase; Provisional

Probab=96.17  E-value=0.003  Score=45.89  Aligned_cols=22  Identities=36%  Similarity=0.362  Sum_probs=18.6

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|+.|+||||+++.+....
T Consensus         6 I~i~G~pGsGKsT~~~~La~~~   27 (215)
T PRK14530          6 ILLLGAPGAGKGTQSSNLAEEF   27 (215)
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            4589999999999999986544

>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems

Probab=96.16  E-value=0.0027  Score=42.38  Aligned_cols=20  Identities=30%  Similarity=0.238  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+....
T Consensus        16 i~G~nGsGKStLl~~l~g~~   35 (137)
T PF00005_consen   16 IVGPNGSGKSTLLKALAGLL   35 (137)
T ss_dssp             EEESTTSSHHHHHHHHTTSS
T ss_pred             EEccCCCccccceeeecccc
Confidence            99999999999999998765

ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain []. The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). On the basis of sequence similarities a family of related ATP-binding proteins has been characterised [, , , , ]. The proteins belonging to this family also contain one or two copies of the 'A' consensus sequence [] or the 'P-loop' [] (see IPR001687 from INTERPRO).; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NHB_A 3NH9_A 3NHA_A 3NH6_A 1VCI_A 1V43_A 2YZ2_B 2PMK_A 2FFA_A 1XEF_D ....

>cd01862 Rab7 Rab7 subfamily

Probab=96.16  E-value=0.003  Score=43.32  Aligned_cols=21  Identities=24%  Similarity=0.325  Sum_probs=17.5

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|.+|+|||||+..+.+.
T Consensus         3 i~viG~~~~GKSsl~~~l~~~   23 (172)
T cd01862           3 VIILGDSGVGKTSLMNQYVNK   23 (172)
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            347899999999999887655

Rab7 is a small Rab GTPase that regulates vesicular traffic from early to late endosomal stages of the endocytic pathway. The yeast Ypt7 and mammalian Rab7 are both involved in transport to the vacuole/lysosome, whereas Ypt7 is also required for homotypic vacuole fusion. Mammalian Rab7 is an essential participant in the autophagic pathway for sequestration and targeting of cytoplasmic components to the lytic compartment. Mammalian Rab7 is also proposed to function as a tumor suppressor. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-

>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse

Probab=96.15  E-value=0.0029  Score=41.23  Aligned_cols=19  Identities=26%  Similarity=0.240  Sum_probs=17.7

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|+.|+|||||...+.+.
T Consensus         4 iiG~~~~GKSTlin~l~~~   22 (116)
T PF01926_consen    4 IIGRPNVGKSTLINALTGK   22 (116)
T ss_dssp             EEESTTSSHHHHHHHHHTS
T ss_pred             EECCCCCCHHHHHHHHhcc
Confidence            7899999999999999974

These proteins represent a new subfamily of GTP-binding proteins that has both prokaryote and eukaryote members [].; GO: 0005525 GTP binding, 0005622 intracellular; PDB: 2DWQ_B 2DBY_A 3CNN_A 3CNO_A 3CNL_A 3IBY_A 1PUI_B 1WXQ_A 1LNZ_A 3GEE_A ....

>cd04113 Rab4 Rab4 subfamily

Probab=96.14  E-value=0.0031  Score=42.97  Aligned_cols=20  Identities=25%  Similarity=0.225  Sum_probs=16.8

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|.+|+|||||++.+.+
T Consensus         3 i~v~G~~~vGKTsli~~l~~   22 (161)
T cd04113           3 FIIIGSSGTGKSCLLHRFVE   22 (161)
T ss_pred             EEEECCCCCCHHHHHHHHHh
Confidence            34789999999999999743

Rab4 has been implicated in numerous functions within the cell. It helps regulate endocytosis through the sorting, recycling, and degradation of early endosomes. Mammalian Rab4 is involved in the regulation of many surface proteins including G-protein-coupled receptors, transferrin receptor, integrins, and surfactant protein A. Experimental data implicate Rab4 in regulation of the recycling of internalized receptors back to the plasma membrane. It is also believed to influence receptor-mediated antigen processing in B-lymphocytes, in calcium-dependent exocytosis in platelets, in alpha-amylase secretion in pancreatic cells, and in insulin-induced translocation of Glut4 from internal vesicles to the cell surface. Rab4 is known to share effector proteins with Rab5 and Rab11. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to p

>cd04119 RJL RJL (RabJ-Like) subfamily

Probab=96.13  E-value=0.0032  Score=42.80  Aligned_cols=20  Identities=25%  Similarity=0.375  Sum_probs=16.8

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .++|.+|+|||||+..+.+.
T Consensus         4 ~~vG~~~vGKTsli~~l~~~   23 (168)
T cd04119           4 ISMGNSGVGKSCIIKRYCEG   23 (168)
T ss_pred             EEECCCCCCHHHHHHHHHhC
Confidence            47899999999999987543

RJLs are found in many protists and as chimeras with C-terminal DNAJ domains in deuterostome metazoa. They are not found in plants, fungi, and protostome metazoa, suggesting a horizontal gene transfer between protists and deuterostome metazoa. RJLs lack any known membrane targeting signal and contain a degenerate phosphate/magnesium-binding 3 (PM3) motif, suggesting an impaired ability to hydrolyze GTP. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.

>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]

Probab=96.12  E-value=0.003  Score=47.92  Aligned_cols=20  Identities=30%  Similarity=0.323  Sum_probs=18.6

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|.+|+||||++|+|+.-.
T Consensus        32 liGpSGsGKTTtLkMINrLi   51 (309)
T COG1125          32 LIGPSGSGKTTTLKMINRLI   51 (309)
T ss_pred             EECCCCCcHHHHHHHHhccc
Confidence            99999999999999998755

>CHL00181 cbbX CbbX; Provisional

Probab=96.06  E-value=0.0056  Score=46.76  Aligned_cols=21  Identities=29%  Similarity=0.129  Sum_probs=18.7

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +++|..|+||||+|+.+.+..
T Consensus        63 ll~G~pGtGKT~lAr~la~~~   83 (287)
T CHL00181         63 SFTGSPGTGKTTVALKMADIL   83 (287)
T ss_pred             EEECCCCCCHHHHHHHHHHHH
Confidence            489999999999999997765

>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair]

Probab=96.06  E-value=0.0027  Score=48.60  Aligned_cols=21  Identities=24%  Similarity=0.403  Sum_probs=19.3

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +++||.|.||||..|.++...
T Consensus        23 lVvGMAGSGKTTF~QrL~~hl   43 (366)
T KOG1532|consen   23 LVVGMAGSGKTTFMQRLNSHL   43 (366)
T ss_pred             EEEecCCCCchhHHHHHHHHH
Confidence            489999999999999999876

>cd00154 Rab Rab family

Probab=96.06  E-value=0.0037  Score=41.69  Aligned_cols=22  Identities=27%  Similarity=0.179  Sum_probs=17.9

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.++|..|+|||||+..+.+..
T Consensus         3 i~~~G~~~~GKStl~~~l~~~~   24 (159)
T cd00154           3 IVLIGDSGVGKTSLLLRFVDGK   24 (159)
T ss_pred             EEEECCCCCCHHHHHHHHHhCc
Confidence            3478999999999999875543

Rab GTPases form the largest family within the Ras superfamily. There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways. The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide di

>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]

Probab=96.05  E-value=0.0034  Score=47.06  Aligned_cols=20  Identities=30%  Similarity=0.149  Sum_probs=17.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|.+|+|||||++.|-.-.
T Consensus        34 ilGpSGcGKSTLLriiAGL~   53 (248)
T COG1116          34 ILGPSGCGKSTLLRLIAGLE   53 (248)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999986643

>cd00879 Sar1 Sar1 subfamily

Probab=96.04  E-value=0.0036  Score=43.99  Aligned_cols=22  Identities=23%  Similarity=0.258  Sum_probs=18.7

Q ss_pred             CccccCcCCCchhHHHHhhhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~~  109 (130)
                      ++.|+|.+|+|||||++.+.+.
T Consensus        21 ki~ilG~~~~GKStLi~~l~~~   42 (190)
T cd00879          21 KILFLGLDNAGKTTLLHMLKDD   42 (190)
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            3459999999999999998764

Sar1 is an essential component of COPII vesicle coats involved in export of cargo from the ER. The GTPase activity of Sar1 functions as a molecular switch to control protein-protein and protein-lipid interactions that direct vesicle budding from the ER. Activation of the GDP to the GTP-bound form of Sar1 involves the membrane-associated guanine nucleotide exchange factor (GEF) Sec12. Sar1 is unlike all Ras superfamily GTPases that use either myristoyl or prenyl groups to direct membrane association and function, in that Sar1 lacks such modification. Instead, Sar1 contains a unique nine-amino-acid N-terminal extension. This extension contains an evolutionarily conserved cluster of bulky hydrophobic amino acids, referred to as the Sar1-N-terminal activation recruitment (STAR) motif. The STAR motif mediates the recruitment of Sar1 to ER membranes and facilitates its interaction with mammalian Sec12 GEF leading to activation.

>PTZ00202 tuzin; Provisional

Probab=96.04  E-value=0.0018  Score=52.72  Aligned_cols=20  Identities=20%  Similarity=0.167  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|+.|+|||||++.+....
T Consensus       291 LtG~~G~GKTTLlR~~~~~l  310 (550)
T PTZ00202        291 FTGFRGCGKSSLCRSAVRKE  310 (550)
T ss_pred             EECCCCCCHHHHHHHHHhcC
Confidence            99999999999999988754

>PRK14088 dnaA chromosomal replication initiation protein; Provisional

Probab=96.03  E-value=0.0054  Score=49.55  Aligned_cols=34  Identities=18%  Similarity=0.045  Sum_probs=25.0

Q ss_pred             cccCcCCCchhHHHHhhhhhhhhccCCCC-eEEEEEe
Q 042811           90 WPFGVEGVGKITSLSKSYPEFLEDEGIFL-IKMHDVV  125 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~~~~~~~Fd-~~~wv~V  125 (130)
                      .|||-.|+|||+|++.+.|...  +...+ .+++++.
T Consensus       134 ~lyG~~G~GKTHLl~ai~~~l~--~~~~~~~v~yi~~  168 (440)
T PRK14088        134 FIYGGVGLGKTHLLQSIGNYVV--QNEPDLRVMYITS  168 (440)
T ss_pred             EEEcCCCCcHHHHHHHHHHHHH--HhCCCCeEEEEEH
Confidence            3999999999999999999872  22333 3555543

>PRK14531 adenylate kinase; Provisional

Probab=96.03  E-value=0.0038  Score=44.27  Aligned_cols=23  Identities=22%  Similarity=0.205  Sum_probs=19.4

Q ss_pred             CccccCcCCCchhHHHHhhhhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .+.|.|..|+||||+++.+-+..
T Consensus         4 ~i~i~G~pGsGKsT~~~~la~~~   26 (183)
T PRK14531          4 RLLFLGPPGAGKGTQAARLCAAH   26 (183)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHh
Confidence            45589999999999999986654

>PRK13948 shikimate kinase; Provisional

Probab=96.02  E-value=0.004  Score=44.58  Aligned_cols=21  Identities=19%  Similarity=-0.002  Sum_probs=18.6

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++||.|+||||+++.+-+..
T Consensus        14 ~LiG~~GsGKSTvg~~La~~l   34 (182)
T PRK13948         14 ALAGFMGTGKSRIGWELSRAL   34 (182)
T ss_pred             EEECCCCCCHHHHHHHHHHHc
Confidence            389999999999999998754

>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis

Probab=96.02  E-value=0.0037  Score=41.13  Aligned_cols=17  Identities=24%  Similarity=0.216  Sum_probs=15.8

Q ss_pred             ccCcCCCchhHHHHhhh
Q 042811           91 PFGVEGVGKITSLSKSY  107 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~  107 (130)
                      |.|..|+|||||++.+.
T Consensus        20 I~GpSGsGKSTLl~~l~   36 (107)
T cd00820          20 ITGDSGIGKTELALELI   36 (107)
T ss_pred             EEcCCCCCHHHHHHHhh
Confidence            99999999999999964

It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity. PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of HPr and its dephosphorylation by phosphorolysis. PEPCK and the C-terminal catalytic domain of HprK/P are structural

>PRK14532 adenylate kinase; Provisional

Probab=96.02  E-value=0.0039  Score=44.14  Aligned_cols=20  Identities=25%  Similarity=0.180  Sum_probs=16.9

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|.|+.|+||||+++.+-+
T Consensus         3 i~~~G~pGsGKsT~a~~la~   22 (188)
T PRK14532          3 LILFGPPAAGKGTQAKRLVE   22 (188)
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            34789999999999998753

>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily

Probab=96.01  E-value=0.0039  Score=42.07  Aligned_cols=21  Identities=24%  Similarity=0.183  Sum_probs=17.2

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||++.+.+.
T Consensus         4 i~iiG~~~vGKTsl~~~~~~~   24 (162)
T cd04138           4 LVVVGAGGVGKSALTIQLIQN   24 (162)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            347899999999999887543

H-Ras, N-Ras, and K-Ras4A/4B are the prototypical members of the Ras family. These isoforms generate distinct signal outputs despite interacting with a common set of activators and effectors, and are strongly associated with oncogenic progression in tumor initiation. Mutated versions of Ras that are insensitive to GAP stimulation (and are therefore constitutively active) are found in a significant fraction of human cancers. Many Ras guanine nucleotide exchange factors (GEFs) have been identified. They are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras. Active (GTP-bound) Ras interacts with several effector proteins that stimulate a variety of diverse cytoplasmic signaling activities. Some are known to positively mediate the oncogenic properties of Ras, including Raf, phosphatidylinositol 3-kinase (PI3K), RalGEFs, and Tiam1.

>TIGR00362 DnaA chromosomal replication initiator protein DnaA

Probab=96.00  E-value=0.0071  Score=48.06  Aligned_cols=20  Identities=30%  Similarity=0.341  Sum_probs=19.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||+|++.+.+..
T Consensus       141 l~G~~G~GKThL~~ai~~~l  160 (405)
T TIGR00362       141 IYGGVGLGKTHLLHAIGNEI  160 (405)
T ss_pred             EECCCCCcHHHHHHHHHHHH
Confidence            99999999999999999987

DnaA is involved in DNA biosynthesis; initiation of chromosome replication and can also be transcription regulator. The C-terminal of the family hits the pfam bacterial DnaA (bac_dnaA) domain family. For a review, see Kaguni (2006).

>PRK13230 nitrogenase reductase-like protein; Reviewed

Probab=95.99  E-value=0.0036  Score=47.21  Aligned_cols=19  Identities=26%  Similarity=0.459  Sum_probs=15.4

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|-|||||||++-++---
T Consensus         6 ~~gKGGVGKTT~a~nLA~~   24 (279)
T PRK13230          6 FYGKGGIGKSTTVCNIAAA   24 (279)
T ss_pred             EECCCCCcHHHHHHHHHHH
Confidence            6799999999988776443

>PRK13768 GTPase; Provisional

Probab=95.99  E-value=0.0035  Score=46.94  Aligned_cols=21  Identities=24%  Similarity=0.240  Sum_probs=17.6

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|.||+||||++..+..-.
T Consensus         6 ~v~G~~G~GKTt~~~~~~~~l   26 (253)
T PRK13768          6 FFLGTAGSGKTTLTKALSDWL   26 (253)
T ss_pred             EEECCCCccHHHHHHHHHHHH
Confidence            388999999999998876555

>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE)

Probab=95.99  E-value=0.0039  Score=45.13  Aligned_cols=20  Identities=30%  Similarity=0.074  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+....
T Consensus        35 l~G~nGsGKSTLl~~i~Gl~   54 (218)
T cd03255          35 IVGPSGSGKSTLLNILGGLD   54 (218)
T ss_pred             EEcCCCCCHHHHHHHHhCCc
Confidence            99999999999999997754

They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.

>PRK12422 chromosomal replication initiation protein; Provisional

Probab=95.97  E-value=0.0057  Score=49.53  Aligned_cols=20  Identities=30%  Similarity=0.484  Sum_probs=19.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |||..|+|||+|++.+.+..
T Consensus       146 L~G~~G~GKTHLl~Ai~~~l  165 (445)
T PRK12422        146 LFGPEGSGKTHLMQAAVHAL  165 (445)
T ss_pred             EEcCCCCCHHHHHHHHHHHH
Confidence            99999999999999999987

>PRK07667 uridine kinase; Provisional

Probab=95.95  E-value=0.0043  Score=44.47  Aligned_cols=20  Identities=20%  Similarity=0.167  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |-|..|+|||||++.+....
T Consensus        22 I~G~~gsGKStla~~L~~~l   41 (193)
T PRK07667         22 IDGLSRSGKTTFVANLKENM   41 (193)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            88999999999999998866

>cd00157 Rho Rho (Ras homology) family

Probab=95.95  E-value=0.0043  Score=42.46  Aligned_cols=20  Identities=25%  Similarity=0.117  Sum_probs=17.2

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||++.+.+.
T Consensus         4 ~i~G~~~~GKSsli~~l~~~   23 (171)
T cd00157           4 VVVGDGAVGKTCLLISYTTG   23 (171)
T ss_pred             EEECCCCCCHHHHHHHHHhC
Confidence            47899999999999987654

Members of the Rho family include RhoA, Cdc42, Rac, Rnd, Wrch1, RhoBTB, and Rop. There are 22 human Rho family members identified currently. These proteins are all involved in the reorganization of the actin cytoskeleton in response to external stimuli. They also have roles in cell transformation by Ras in cytokinesis, in focal adhesion formation and in the stimulation of stress-activated kinase. These various functions are controlled through distinct effector proteins and mediated through a GTP-binding/GTPase cycle involving three classes of regulating proteins: GAPs (GTPase-activating proteins), GEFs (guanine nucleotide exchange factors), and GDIs (guanine nucleotide dissociation inhibitors). Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho protein

>smart00175 RAB Rab subfamily of small GTPases

Probab=95.94  E-value=0.0043  Score=42.10  Aligned_cols=21  Identities=33%  Similarity=0.289  Sum_probs=17.5

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.++|..|+|||||++.+.+.
T Consensus         3 v~v~G~~~~GKTtli~~l~~~   23 (164)
T smart00175        3 IILIGDSGVGKSSLLSRFTDG   23 (164)
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            347899999999999998643

Rab GTPases are implicated in vesicle trafficking.

>TIGR01618 phage_P_loop phage nucleotide-binding protein

Probab=95.92  E-value=0.0038  Score=46.09  Aligned_cols=20  Identities=20%  Similarity=0.295  Sum_probs=17.3

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      ++|||..|+||||||+.+-+
T Consensus        15 ~liyG~~G~GKtt~a~~~~~   34 (220)
T TIGR01618        15 YLIYGKPGTGKTSTIKYLPG   34 (220)
T ss_pred             EEEECCCCCCHHHHHHhcCC
Confidence            34999999999999998754

This model represents an uncharacterized family of proteins from a number of phage of Gram-positive bacteria. This protein contains a P-loop motif, G/A-X-X-G-X-G-K-T near its amino end. The function of this protein is unknown.

>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]

Probab=95.92  E-value=0.0042  Score=46.87  Aligned_cols=24  Identities=29%  Similarity=0.209  Sum_probs=20.1

Q ss_pred             CCcc-ccCcCCCchhHHHHhhhhhh
Q 042811           87 GNNW-PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        87 ~~l~-I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++. |.|..|+|||||+|.+..-.
T Consensus        28 G~i~~iiGpNG~GKSTLLk~l~g~l   52 (258)
T COG1120          28 GEITGILGPNGSGKSTLLKCLAGLL   52 (258)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhccC
Confidence            3344 99999999999999998854

>PRK12339 2-phosphoglycerate kinase; Provisional

Probab=95.91  E-value=0.0047  Score=44.75  Aligned_cols=20  Identities=25%  Similarity=0.149  Sum_probs=17.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|.+|+||||+++.+....
T Consensus         8 i~G~~G~GKst~a~~l~~~~   27 (197)
T PRK12339          8 IGGIPGVGKTSISGYIARHR   27 (197)
T ss_pred             EECCCCCCHHHHHHHHHHhc
Confidence            89999999999999887754

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional

Probab=95.91  E-value=0.002  Score=50.64  Aligned_cols=20  Identities=30%  Similarity=0.262  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+||||||+.+.+..
T Consensus        43 ~~Gp~G~GKTtla~~la~~l   62 (363)
T PRK14961         43 LSGTRGVGKTTIARLLAKSL   62 (363)
T ss_pred             EecCCCCCHHHHHHHHHHHh
Confidence            99999999999999987765

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX

Probab=95.89  E-value=0.0082  Score=45.74  Aligned_cols=22  Identities=23%  Similarity=0.072  Sum_probs=18.8

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++++|..|+||||+|+.+....
T Consensus        61 vll~G~pGTGKT~lA~~ia~~l   82 (284)
T TIGR02880        61 MSFTGNPGTGKTTVALRMAQIL   82 (284)
T ss_pred             EEEEcCCCCCHHHHHHHHHHHH
Confidence            3489999999999998887765

Proteins in this family are now designated CbbX. Some previously were CfxQ (carbon fixation Q). Its gene is often found immmediately downstream of the Rubisco large and small chain genes, and it is suggested to be necessary for Rubisco expression. CbbX has been shown to be necessary for photoautotrophic growth. This protein belongs to the larger family of pfam00004, ATPase family Associated with various cellular Activities. Within that larger family, members of this family are most closely related to the stage V sporulation protein K, or SpoVK, in endospore-forming bacteria such as Bacillus subtilis.

>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein

Probab=95.89  E-value=0.0045  Score=44.76  Aligned_cols=20  Identities=30%  Similarity=0.152  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        34 i~G~nGsGKSTLl~~l~Gl~   53 (216)
T TIGR00960        34 LVGHSGAGKSTFLKLILGIE   53 (216)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional

Probab=95.88  E-value=0.0047  Score=43.95  Aligned_cols=20  Identities=35%  Similarity=0.393  Sum_probs=18.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+...+
T Consensus        11 ivG~sgsGKTTLi~~li~~l   30 (173)
T PRK10751         11 IAAWSGTGKTTLLKKLIPAL   30 (173)
T ss_pred             EECCCCChHHHHHHHHHHHH
Confidence            89999999999999999876

>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning]

Probab=95.88  E-value=0.0044  Score=46.27  Aligned_cols=16  Identities=38%  Similarity=0.312  Sum_probs=14.4

Q ss_pred             ccCcCCCchhHHHHhh
Q 042811           91 PFGVEGVGKITSLSKS  106 (130)
Q Consensus        91 I~GmGGvGKTTLak~v  106 (130)
                      |+|-||+||||++..+
T Consensus         5 I~GKGG~GKTtiaall   20 (255)
T COG3640           5 ITGKGGVGKTTIAALL   20 (255)
T ss_pred             EecCCCccHHHHHHHH
Confidence            7899999999998874

>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota

Probab=95.87  E-value=0.0047  Score=44.46  Aligned_cols=20  Identities=30%  Similarity=0.219  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        32 l~G~nGsGKSTLl~~l~G~~   51 (211)
T cd03225          32 IVGPNGSGKSTLLRLLNGLL   51 (211)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999998754

The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.

>PRK06835 DNA replication protein DnaC; Validated

Probab=95.86  E-value=0.0063  Score=47.44  Aligned_cols=37  Identities=19%  Similarity=0.071  Sum_probs=27.6

Q ss_pred             CCccccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC
Q 042811           87 GNNWPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR  126 (130)
Q Consensus        87 ~~l~I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS  126 (130)
                      ..+.++|-.|+|||+||..|.+...+  ..+ .|++++++
T Consensus       184 ~~Lll~G~~GtGKThLa~aIa~~l~~--~g~-~V~y~t~~  220 (329)
T PRK06835        184 ENLLFYGNTGTGKTFLSNCIAKELLD--RGK-SVIYRTAD  220 (329)
T ss_pred             CcEEEECCCCCcHHHHHHHHHHHHHH--CCC-eEEEEEHH
Confidence            44459999999999999999998742  333 46666654

>PRK06526 transposase; Provisional

Probab=95.86  E-value=0.0046  Score=46.49  Aligned_cols=24  Identities=21%  Similarity=-0.015  Sum_probs=20.8

Q ss_pred             CccccCcCCCchhHHHHhhhhhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSYPEFL  111 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~~~~  111 (130)
                      .+.|+|.+|+|||+||..+.+..+
T Consensus       100 nlll~Gp~GtGKThLa~al~~~a~  123 (254)
T PRK06526        100 NVVFLGPPGTGKTHLAIGLGIRAC  123 (254)
T ss_pred             eEEEEeCCCCchHHHHHHHHHHHH
Confidence            445999999999999999988763

>PRK04182 cytidylate kinase; Provisional

Probab=95.86  E-value=0.0051  Score=42.78  Aligned_cols=19  Identities=26%  Similarity=0.062  Sum_probs=16.7

Q ss_pred             cccCcCCCchhHHHHhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~  108 (130)
                      .|.|+.|+||||+++.+.+
T Consensus         4 ~i~G~~GsGKstia~~la~   22 (180)
T PRK04182          4 TISGPPGSGKTTVARLLAE   22 (180)
T ss_pred             EEECCCCCCHHHHHHHHHH
Confidence            4789999999999999864

>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning]

Probab=95.86  E-value=0.0037  Score=48.66  Aligned_cols=15  Identities=40%  Similarity=0.390  Sum_probs=13.8

Q ss_pred             ccCcCCCchhHHHHh
Q 042811           91 PFGVEGVGKITSLSK  105 (130)
Q Consensus        91 I~GmGGvGKTTLak~  105 (130)
                      ..|.|||||||+|-.
T Consensus         7 f~GKGGVGKTT~aaA   21 (322)
T COG0003           7 FTGKGGVGKTTIAAA   21 (322)
T ss_pred             EecCCcccHHHHHHH
Confidence            679999999999987

>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism]

Probab=95.85  E-value=0.0051  Score=44.33  Aligned_cols=20  Identities=30%  Similarity=0.258  Sum_probs=18.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|.+|+|||||++.++++.
T Consensus         9 lsgPSG~GKsTl~k~L~~~~   28 (191)
T COG0194           9 LSGPSGVGKSTLVKALLEDD   28 (191)
T ss_pred             EECCCCCCHHHHHHHHHhhc
Confidence            88999999999999999976

>TIGR01166 cbiO cobalt transport protein ATP-binding subunit

Probab=95.85  E-value=0.0049  Score=43.74  Aligned_cols=20  Identities=30%  Similarity=0.318  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        23 i~G~nGsGKSTLl~~i~G~~   42 (190)
T TIGR01166        23 LLGANGAGKSTLLLHLNGLL   42 (190)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

This model describes the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. The model is restricted to ATP subunit that is a part of the cobalt transporter, which belongs to the ABC transporter superfamily (ATP Binding Cassette). The model excludes ATP binding subunit that are associated with other transporters belonging to ABC transporter superfamily. This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux.

>smart00173 RAS Ras subfamily of RAS small GTPases

Probab=95.84  E-value=0.0052  Score=41.90  Aligned_cols=20  Identities=25%  Similarity=0.172  Sum_probs=16.6

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|-+|+|||||++.+.+
T Consensus         3 i~v~G~~~~GKTsli~~~~~   22 (164)
T smart00173        3 LVVLGSGGVGKSALTIQFVQ   22 (164)
T ss_pred             EEEECCCCCCHHHHHHHHHh
Confidence            34789999999999988753

Similar in fold and function to the bacterial EF-Tu GTPase. p21Ras couples receptor Tyr kinases and G protein receptors to protein kinase cascades

>PRK13531 regulatory ATPase RavA; Provisional

Probab=95.84  E-value=0.0024  Score=52.20  Aligned_cols=20  Identities=20%  Similarity=0.215  Sum_probs=18.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+||||||+.+....
T Consensus        44 L~GpPGTGKT~LAraLa~~~   63 (498)
T PRK13531         44 LLGPPGIAKSLIARRLKFAF   63 (498)
T ss_pred             EECCCChhHHHHHHHHHHHh
Confidence            99999999999999999865

>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]

Probab=95.83  E-value=0.0052  Score=45.28  Aligned_cols=20  Identities=25%  Similarity=0.238  Sum_probs=19.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |-|-+|+||||+|+.+...+
T Consensus        13 IaG~SgSGKTTva~~l~~~~   32 (218)
T COG0572          13 IAGGSGSGKTTVAKELSEQL   32 (218)
T ss_pred             EeCCCCCCHHHHHHHHHHHh
Confidence            88999999999999999988

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed

Probab=95.83  E-value=0.0097  Score=48.02  Aligned_cols=20  Identities=25%  Similarity=0.237  Sum_probs=19.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||+|++.+.+..
T Consensus       153 l~G~~G~GKThL~~ai~~~~  172 (450)
T PRK00149        153 IYGGVGLGKTHLLHAIGNYI  172 (450)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            99999999999999999987

>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism]

Probab=95.83  E-value=0.005  Score=43.13  Aligned_cols=25  Identities=24%  Similarity=0.197  Sum_probs=20.5

Q ss_pred             CCCCccccCcCCCchhHHHHhhhhh
Q 042811           85 RNGNNWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        85 ~~~~l~I~GmGGvGKTTLak~v~~~  109 (130)
                      .+.+|+|.|..|+|||||+..|...
T Consensus         6 ~~PNILvtGTPG~GKstl~~~lae~   30 (176)
T KOG3347|consen    6 ERPNILVTGTPGTGKSTLAERLAEK   30 (176)
T ss_pred             cCCCEEEeCCCCCCchhHHHHHHHH
Confidence            3455669999999999999998754

>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A

Probab=95.83  E-value=0.005  Score=42.18  Aligned_cols=23  Identities=26%  Similarity=0.242  Sum_probs=19.6

Q ss_pred             cccCcCCCchhHHHHhhhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEFLE  112 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~~~  112 (130)
                      .|+|..|+|||||++.+-|...+
T Consensus         4 ~VvG~~~sGKTTl~~~Li~~l~~   26 (140)
T PF03205_consen    4 QVVGPKNSGKTTLIRKLINELKR   26 (140)
T ss_dssp             EEEESTTSSHHHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHHhH
Confidence            37999999999999999776653

>TIGR02528 EutP ethanolamine utilization protein, EutP

Probab=95.83  E-value=0.005  Score=41.15  Aligned_cols=21  Identities=29%  Similarity=0.161  Sum_probs=17.5

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|.+|+|||||+..+.+.
T Consensus         3 v~liG~~~vGKSsL~~~l~~~   23 (142)
T TIGR02528         3 IMFIGSVGCGKTTLTQALQGE   23 (142)
T ss_pred             EEEECCCCCCHHHHHHHHcCC
Confidence            447999999999999987544

This protein is found within operons which code for polyhedral organelles containing the enzyme ethanolamine ammonia lyase. The function of this gene is unknown, although the presence of an N-terminal GxxGxGK motif implies a GTP-binding site.

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]

Probab=95.82  E-value=0.0051  Score=45.50  Aligned_cols=20  Identities=30%  Similarity=0.112  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|.+|+|||||++-++.-.
T Consensus        33 iiGpSGSGKSTlLRclN~LE   52 (240)
T COG1126          33 IIGPSGSGKSTLLRCLNGLE   52 (240)
T ss_pred             EECCCCCCHHHHHHHHHCCc
Confidence            99999999999999998754

>PRK09825 idnK D-gluconate kinase; Provisional

Probab=95.82  E-value=0.0054  Score=43.52  Aligned_cols=21  Identities=38%  Similarity=0.314  Sum_probs=18.3

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|..|.|||||++.+....
T Consensus         7 ~l~G~sGsGKSTl~~~la~~l   27 (176)
T PRK09825          7 ILMGVSGSGKSLIGSKIAALF   27 (176)
T ss_pred             EEECCCCCCHHHHHHHHHHhc
Confidence            389999999999999988754

>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity

Probab=95.81  E-value=0.0051  Score=44.28  Aligned_cols=20  Identities=25%  Similarity=0.358  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+....
T Consensus        31 i~G~nGsGKSTLl~~l~G~~   50 (210)
T cd03269          31 LLGPNGAGKTTTIRMILGII   50 (210)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs. Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>TIGR02902 spore_lonB ATP-dependent protease LonB

Probab=95.80  E-value=0.004  Score=51.45  Aligned_cols=20  Identities=30%  Similarity=0.401  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|+||||+|+.+++..
T Consensus        91 i~Ge~GtGKt~lAr~i~~~~  110 (531)
T TIGR02902        91 IYGPPGVGKTAAARLVLEEA  110 (531)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            99999999999999998753

Members of this protein are LonB, a paralog of the ATP-dependent protease La (LonA, TIGR00763). LonB proteins are found strictly, and almost universally, in endospore-forming bacteria. This protease was shown, in Bacillus subtilis, to be expressed specifically in the forespore, during sporulation, under control of sigma(F). The lonB gene, despite location immediately upstream of lonA, was shown to be monocistronic. LonB appears able to act on sigma(H) for post-translation control, but lonB mutation did not produce an obvious sporulation defect under the conditions tested. Note that additional paralogs of LonA and LonB occur in the Clostridium lineage and this model selects only one per species as the protein that corresponds to LonB in B. subtilis.

>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain

Probab=95.79  E-value=0.0085  Score=45.63  Aligned_cols=32  Identities=22%  Similarity=0.212  Sum_probs=24.7

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCC-eEEEEEe
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFL-IKMHDVV  125 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd-~~~wv~V  125 (130)
                      |.|-.|+|||||++.+++..   +++|+ .++++-+
T Consensus        74 If~~~G~GKTtLa~~i~~~i---~~~~~~~~V~~~i  106 (274)
T cd01133          74 LFGGAGVGKTVLIMELINNI---AKAHGGYSVFAGV  106 (274)
T ss_pred             EecCCCCChhHHHHHHHHHH---HhcCCCEEEEEEe
Confidence            99999999999999999977   33454 4455544

The F-ATPase is found in bacterial plasma membranes, mitochondrial inner membranes and in chloroplast thylakoid membranes. It has also been found in the archaea Methanosarcina barkeri. It uses a proton gradient to drive ATP synthesis and hydrolyzes ATP to build the proton gradient. The extrinisic membrane domain, F1, is composed of alpha, beta, gamma, delta and epsilon subunits with a stoichiometry of 3:3:1:1:1. The beta subunit of ATP synthase is catalytic.

>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed

Probab=95.79  E-value=0.0054  Score=45.03  Aligned_cols=20  Identities=25%  Similarity=0.084  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+.+..
T Consensus        38 i~G~~GsGKTTl~~~L~~~l   57 (229)
T PRK09270         38 IAGPPGAGKSTLAEFLEALL   57 (229)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            68999999999999988866

>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules

Probab=95.79  E-value=0.0053  Score=45.02  Aligned_cols=20  Identities=30%  Similarity=0.232  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+....
T Consensus        31 l~G~nGsGKSTLl~~l~G~~   50 (235)
T cd03261          31 IIGPSGSGKSTLLRLIVGLL   50 (235)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively

Probab=95.77  E-value=0.0054  Score=44.52  Aligned_cols=20  Identities=30%  Similarity=0.122  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        35 i~G~nGsGKSTLl~~l~Gl~   54 (220)
T cd03293          35 LVGPSGCGKSTLLRIIAGLE   54 (220)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion

Probab=95.77  E-value=0.0054  Score=43.63  Aligned_cols=18  Identities=33%  Similarity=0.398  Sum_probs=16.8

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |.|..|+|||||++.+..
T Consensus        26 l~G~nG~GKSTLl~~il~   43 (176)
T cd03238          26 VTGVSGSGKSTLVNEGLY   43 (176)
T ss_pred             EECCCCCCHHHHHHHHhh
Confidence            999999999999999864

Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.

>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein

Probab=95.77  E-value=0.005  Score=46.02  Aligned_cols=16  Identities=38%  Similarity=0.582  Sum_probs=13.1

Q ss_pred             ccCcCCCchhHHHHhh
Q 042811           91 PFGVEGVGKITSLSKS  106 (130)
Q Consensus        91 I~GmGGvGKTTLak~v  106 (130)
                      +.|-|||||||++-++
T Consensus         5 ~~gKGGVGKTT~~~nL   20 (268)
T TIGR01281         5 VYGKGGIGKSTTSSNL   20 (268)
T ss_pred             EEcCCcCcHHHHHHHH
Confidence            4589999999977664

The BchL peptide (ChlL in chloroplast and cyanobacteria) is an ATP-binding iron-sulfur protein of the dark form protochlorophyllide reductase, an enzyme similar to nitrogenase. This subunit resembles the nitrogenase NifH subunit.

>cd01864 Rab19 Rab19 subfamily

Probab=95.77  E-value=0.0057  Score=41.92  Aligned_cols=20  Identities=20%  Similarity=0.164  Sum_probs=16.9

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|..|+|||||+..+..
T Consensus         6 v~vvG~~~~GKTsli~~l~~   25 (165)
T cd01864           6 IILIGDSNVGKTCVVQRFKS   25 (165)
T ss_pred             EEEECCCCCCHHHHHHHHhh
Confidence            34899999999999988754

Rab19 proteins are associated with Golgi stacks. Similarity analysis indicated that Rab41 is closely related to Rab19. However, the function of these Rabs is not yet chracterized. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.

>PRK06921 hypothetical protein; Provisional

Probab=95.76  E-value=0.0079  Score=45.47  Aligned_cols=36  Identities=17%  Similarity=0.100  Sum_probs=26.1

Q ss_pred             CccccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEe
Q 042811           88 NNWPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVV  125 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~V  125 (130)
                      .+.++|-.|+|||+||..|.+...+ ++. ..+++++.
T Consensus       119 ~l~l~G~~G~GKThLa~aia~~l~~-~~g-~~v~y~~~  154 (266)
T PRK06921        119 SIALLGQPGSGKTHLLTAAANELMR-KKG-VPVLYFPF  154 (266)
T ss_pred             eEEEECCCCCcHHHHHHHHHHHHhh-hcC-ceEEEEEH
Confidence            3459999999999999999997732 113 34566654

>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]

Probab=95.75  E-value=0.011  Score=44.17  Aligned_cols=33  Identities=15%  Similarity=-0.162  Sum_probs=28.4

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR  126 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS  126 (130)
                      |+|-.|+|||+++.+.-...   ....+.++||+.+
T Consensus        28 I~G~pGsGKT~f~~qfl~~~---~~~ge~vlyvs~~   60 (260)
T COG0467          28 ITGPPGTGKTIFALQFLYEG---AREGEPVLYVSTE   60 (260)
T ss_pred             EEcCCCCcHHHHHHHHHHHH---HhcCCcEEEEEec
Confidence            99999999999999976655   2458899999987

>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup

Probab=95.75  E-value=0.0056  Score=44.17  Aligned_cols=20  Identities=30%  Similarity=0.174  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        31 i~G~nGsGKSTLl~~l~G~~   50 (213)
T cd03259          31 LLGPSGCGKTTLLRLIAGLE   50 (213)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999997753

This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily

Probab=95.75  E-value=0.0058  Score=41.87  Aligned_cols=21  Identities=29%  Similarity=0.254  Sum_probs=17.8

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|.+|+|||||+..+.+.
T Consensus         5 i~i~G~~~vGKSsli~~~~~~   25 (166)
T cd01869           5 LLLIGDSGVGKSCLLLRFADD   25 (166)
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            448999999999999998653

Rab1 is found in every eukaryote and is a key regulatory component for the transport of vesicles from the ER to the Golgi apparatus. Studies on mutations of Ypt1, the yeast homolog of Rab1, showed that this protein is necessary for the budding of vesicles of the ER as well as for their transport to, and fusion with, the Golgi apparatus. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to t

>PRK08181 transposase; Validated

Probab=95.75  E-value=0.0057  Score=46.41  Aligned_cols=35  Identities=20%  Similarity=0.057  Sum_probs=26.0

Q ss_pred             CccccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEe
Q 042811           88 NNWPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVV  125 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~V  125 (130)
                      .+.++|..|+|||.||..+.+..++   ..-.++++++
T Consensus       108 nlll~Gp~GtGKTHLa~Aia~~a~~---~g~~v~f~~~  142 (269)
T PRK08181        108 NLLLFGPPGGGKSHLAAAIGLALIE---NGWRVLFTRT  142 (269)
T ss_pred             eEEEEecCCCcHHHHHHHHHHHHHH---cCCceeeeeH
Confidence            3559999999999999999987742   2234566554

>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH)

Probab=95.74  E-value=0.0065  Score=40.33  Aligned_cols=20  Identities=30%  Similarity=0.187  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|.||+||||++..+...+
T Consensus         4 ~~GkgG~GKTt~a~~la~~l   23 (116)
T cd02034           4 ITGKGGVGKTTIAALLARYL   23 (116)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            68999999999999998876

CODH from Rhodospirillum rubrum catalyzes the reversible oxidation of CO to CO2. CODH contains a nickel-iron-sulfur cluster (C-center) and an iron-sulfur cluster (B-center). CO oxidation occurs at the C-center. Three accessory proteins encoded by cooCTJ genes are involved in nickel incorporation into a nickel site. CooC functions as a nickel insertase that mobilizes nickel to apoCODH using energy released from ATP hydrolysis. CooC is a homodimer and has NTPase activities. Mutation at the P-loop abolishs its function.

>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase

Probab=95.74  E-value=0.005  Score=45.79  Aligned_cols=19  Identities=26%  Similarity=0.427  Sum_probs=15.0

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|-|||||||++-++-.-
T Consensus         6 v~~KGGvGKTT~~~nLA~~   24 (270)
T cd02040           6 IYGKGGIGKSTTTQNLSAA   24 (270)
T ss_pred             EEeCCcCCHHHHHHHHHHH
Confidence            5689999999988776443

Nitrogenase is responsible for the biological nitrogen fixation, i.e. reduction of molecular nitrogen to ammonia. NifH consists of two oxygen-sensitive metallosulfur proteins: the mollybdenum-iron (alternatively, vanadium-iron or iron-iron) protein (commonly referred to as component 1), and the iron protein (commonly referred to as component 2). The iron protein is a homodimer, with an Fe4S4 cluster bound between the subunits and two ATP-binding domains. It supplies energy by ATP hydrolysis, and transfers electrons from reduced ferredoxin or flavodoxin to component 1 for the reduction of molecular nitrogen to ammonia.

>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds

Probab=95.74  E-value=0.0057  Score=44.30  Aligned_cols=20  Identities=35%  Similarity=0.464  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+..-.
T Consensus        33 i~G~nGsGKSTLl~~l~Gl~   52 (220)
T cd03263          33 LLGHNGAGKTTTLKMLTGEL   52 (220)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders. The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis. The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle. The ABCA genes are not present in yeast. However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.

>PRK03992 proteasome-activating nucleotidase; Provisional

Probab=95.74  E-value=0.0061  Score=48.42  Aligned_cols=20  Identities=25%  Similarity=0.253  Sum_probs=18.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+|||+||+.+.+..
T Consensus       170 L~GppGtGKT~lAkaia~~~  189 (389)
T PRK03992        170 LYGPPGTGKTLLAKAVAHET  189 (389)
T ss_pred             EECCCCCChHHHHHHHHHHh
Confidence            89999999999999999865

>cd01860 Rab5_related Rab5-related subfamily

Probab=95.73  E-value=0.006  Score=41.48  Aligned_cols=21  Identities=19%  Similarity=0.129  Sum_probs=17.6

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|.+|+|||||++.+.+.
T Consensus         4 i~v~G~~~~GKSsli~~l~~~   24 (163)
T cd01860           4 LVLLGDSSVGKSSLVLRFVKN   24 (163)
T ss_pred             EEEECCCCCCHHHHHHHHHcC
Confidence            347999999999999887664

This subfamily includes Rab5 and Rab22 of mammals, Ypt51/Ypt52/Ypt53 of yeast, and RabF of plants. The members of this subfamily are involved in endocytosis and endocytic-sorting pathways. In mammals, Rab5 GTPases localize to early endosomes and regulate fusion of clathrin-coated vesicles to early endosomes and fusion between early endosomes. In yeast, Ypt51p family members similarly regulate membrane trafficking through prevacuolar compartments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence mo

>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component

Probab=95.73  E-value=0.0057  Score=44.05  Aligned_cols=20  Identities=25%  Similarity=0.218  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+..-.
T Consensus        30 i~G~nGsGKSTLl~~l~Gl~   49 (211)
T cd03264          30 LLGPNGAGKTTLMRILATLT   49 (211)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient

Probab=95.73  E-value=0.0059  Score=44.47  Aligned_cols=20  Identities=30%  Similarity=0.170  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        31 i~G~nGsGKSTLl~~i~G~~   50 (227)
T cd03260          31 LIGPSGCGKSTLLRLLNRLN   50 (227)
T ss_pred             EECCCCCCHHHHHHHHHhhc
Confidence            99999999999999997743

The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes. The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system. PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein. PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).

>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B

Probab=95.72  E-value=0.005  Score=47.47  Aligned_cols=16  Identities=38%  Similarity=0.277  Sum_probs=13.9

Q ss_pred             ccCcCCCchhHHHHhh
Q 042811           91 PFGVEGVGKITSLSKS  106 (130)
Q Consensus        91 I~GmGGvGKTTLak~v  106 (130)
                      +.|-|||||||+|-..
T Consensus         6 ~~GKGGVGKTT~aaA~   21 (305)
T PF02374_consen    6 FGGKGGVGKTTVAAAL   21 (305)
T ss_dssp             EEESTTSSHHHHHHHH
T ss_pred             EecCCCCCcHHHHHHH
Confidence            6799999999999664

...

>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor

Probab=95.72  E-value=0.0063  Score=42.76  Aligned_cols=20  Identities=25%  Similarity=0.326  Sum_probs=17.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |-|.-|+||||+++.+.+..
T Consensus         5 ieG~~GsGKtT~~~~L~~~l   24 (200)
T cd01672           5 FEGIDGAGKTTLIELLAERL   24 (200)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            67999999999999987543

TMPK represents the rate-limiting step in either de novo or salvage biosynthesis of thymidine triphosphate (TTP).

>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota

Probab=95.72  E-value=0.0059  Score=43.86  Aligned_cols=20  Identities=25%  Similarity=0.114  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        31 i~G~nGsGKSTLl~~l~Gl~   50 (205)
T cd03226          31 LTGKNGAGKTTLAKILAGLI   50 (205)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999998754

The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.

>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]

Probab=95.71  E-value=0.0055  Score=48.21  Aligned_cols=18  Identities=33%  Similarity=0.329  Sum_probs=16.8

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      +.|.+|+|||||++.|-.
T Consensus        36 lLGPSGcGKTTlLR~IAG   53 (352)
T COG3842          36 LLGPSGCGKTTLLRMIAG   53 (352)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            999999999999999865

>TIGR02673 FtsE cell division ATP-binding protein FtsE

Probab=95.71  E-value=0.0059  Score=44.01  Aligned_cols=20  Identities=35%  Similarity=0.416  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        33 l~G~nGsGKSTLl~~i~Gl~   52 (214)
T TIGR02673        33 LTGPSGAGKTTLLKLLYGAL   52 (214)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999997754

This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein.

>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment

Probab=95.70  E-value=0.0062  Score=42.90  Aligned_cols=20  Identities=30%  Similarity=0.125  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        31 i~G~nGsGKSTLl~~l~G~~   50 (178)
T cd03229          31 LLGPSGSGKSTLLRCIAGLE   50 (178)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999997643

ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd04124 RabL2 RabL2 subfamily

Probab=95.70  E-value=0.0064  Score=41.75  Aligned_cols=18  Identities=22%  Similarity=0.254  Sum_probs=15.2

Q ss_pred             cccCcCCCchhHHHHhhh
Q 042811           90 WPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~  107 (130)
                      .|+|-.|+|||||+..+.
T Consensus         4 ~vvG~~~vGKTsli~~~~   21 (161)
T cd04124           4 ILLGDSAVGKSKLVERFL   21 (161)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            478999999999997653

RabL2 (Rab-like2) subfamily. RabL2s are novel Rab proteins identified recently which display features that are distinct from other Rabs, and have been termed Rab-like. RabL2 contains RabL2a and RabL2b, two very similar Rab proteins that share 98% sequence identity in humans. RabL2b maps to the subtelomeric region of chromosome 22q13.3 and RabL2a maps to 2q13, a region that suggests it is also a subtelomeric gene. Both genes are believed to be expressed ubiquitously, suggesting that RabL2s are the first example of duplicated genes in human proximal subtelomeric regions that are both expressed actively. Like other Rab-like proteins, RabL2s lack a prenylation site at the C-terminus. The specific functions of RabL2a and RabL2b remain unknown. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-b

>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system

Probab=95.69  E-value=0.006  Score=44.74  Aligned_cols=20  Identities=30%  Similarity=0.202  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        32 i~G~nGsGKSTLl~~l~Gl~   51 (241)
T cd03256          32 LIGPSGAGKSTLLRCLNGLV   51 (241)
T ss_pred             EECCCCCCHHHHHHHHhCCc
Confidence            99999999999999997653

Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond. Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond. Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]

Probab=95.69  E-value=0.0058  Score=45.74  Aligned_cols=20  Identities=25%  Similarity=0.008  Sum_probs=17.6

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|+|||||++.+-.-.
T Consensus        38 ivGeSGsGKSTL~r~l~Gl~   57 (252)
T COG1124          38 IVGESGSGKSTLARLLAGLE   57 (252)
T ss_pred             EEcCCCCCHHHHHHHHhccc
Confidence            99999999999999986543

>cd04140 ARHI_like ARHI subfamily

Probab=95.69  E-value=0.0064  Score=41.80  Aligned_cols=20  Identities=30%  Similarity=0.385  Sum_probs=16.7

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|.+|+|||||++.+-+.
T Consensus         5 ~~vG~~~vGKTsli~~~~~~   24 (165)
T cd04140           5 VVFGAGGVGKSSLVLRFVKG   24 (165)
T ss_pred             EEECCCCCCHHHHHHHHHhC
Confidence            47999999999999887543

ARHI (A Ras homolog member I) is a member of the Ras family with several unique structural and functional properties. ARHI is expressed in normal human ovarian and breast tissue, but its expression is decreased or eliminated in breast and ovarian cancer. ARHI contains an N-terminal extension of 34 residues (human) that is required to retain its tumor suppressive activity. Unlike most other Ras family members, ARHI is maintained in the constitutively active (GTP-bound) state in resting cells and has modest GTPase activity. ARHI inhibits STAT3 (signal transducers and activators of transcription 3), a latent transcription factor whose abnormal activation plays a critical role in oncogenesis. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Ras proteins. Due to

>cd04177 RSR1 RSR1 subgroup

Probab=95.69  E-value=0.0064  Score=41.91  Aligned_cols=19  Identities=26%  Similarity=0.267  Sum_probs=16.2

Q ss_pred             cccCcCCCchhHHHHhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~  108 (130)
                      .|+|.+|+|||||++.+-+
T Consensus         5 ~liG~~~~GKTsli~~~~~   23 (168)
T cd04177           5 VVLGAGGVGKSALTVQFVQ   23 (168)
T ss_pred             EEECCCCCCHHHHHHHHHh
Confidence            4799999999999988543

RSR1/Bud1p is a member of the Rap subfamily of the Ras family that is found in fungi. In budding yeasts, RSR1 is involved in selecting a site for bud growth on the cell cortex, which directs the establishment of cell polarization. The Rho family GTPase cdc42 and its GEF, cdc24, then establish an axis of polarized growth by organizing the actin cytoskeleton and secretory apparatus at the bud site. It is believed that cdc42 interacts directly with RSR1 in vivo. In filamentous fungi, polar growth occurs at the tips of hypha and at novel growth sites along the extending hypha. In Ashbya gossypii, RSR1 is a key regulator of hyphal growth, localizing at the tip region and regulating in apical polarization of the actin cytoskeleton. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key featu

>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin

Probab=95.68  E-value=0.0062  Score=44.20  Aligned_cols=20  Identities=25%  Similarity=0.370  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        31 i~G~nGsGKSTLl~~i~G~~   50 (220)
T cd03265          31 LLGPNGAGKTTTIKMLTTLL   50 (220)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

In addition to DrrA, the complex includes an integral membrane protein called DrrB. DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called P-glycoprotein. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK09361 radB DNA repair and recombination protein RadB; Provisional

Probab=95.68  E-value=0.011  Score=42.93  Aligned_cols=32  Identities=16%  Similarity=-0.093  Sum_probs=24.6

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEe
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVV  125 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~V  125 (130)
                      |+|.+|+|||||+..+.....   ..-..++|++.
T Consensus        28 i~G~~GsGKT~l~~~la~~~~---~~~~~v~yi~~   59 (225)
T PRK09361         28 IYGPPGSGKTNICLQLAVEAA---KNGKKVIYIDT   59 (225)
T ss_pred             EECCCCCCHHHHHHHHHHHHH---HCCCeEEEEEC
Confidence            999999999999999877652   23356677653

>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane

Probab=95.67  E-value=0.0062  Score=43.87  Aligned_cols=20  Identities=40%  Similarity=0.418  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+....
T Consensus        32 i~G~nGsGKSTLl~~l~G~~   51 (214)
T cd03292          32 LVGPSGAGKSTLLKLIYKEE   51 (214)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999998754

The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.

>PTZ00088 adenylate kinase 1; Provisional

Probab=95.67  E-value=0.0067  Score=44.95  Aligned_cols=22  Identities=32%  Similarity=0.155  Sum_probs=19.0

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|.|+.|+||||+|+.+-+..
T Consensus         9 Ivl~G~PGsGK~T~a~~La~~~   30 (229)
T PTZ00088          9 IVLFGAPGVGKGTFAEILSKKE   30 (229)
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            4499999999999999987654

>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein

Probab=95.66  E-value=0.0063  Score=44.72  Aligned_cols=20  Identities=30%  Similarity=0.214  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|+|||||++.+....
T Consensus        33 l~G~nGsGKSTLl~~l~Gl~   52 (243)
T TIGR02315        33 IIGPSGAGKSTLLRCINRLV   52 (243)
T ss_pred             EECCCCCCHHHHHHHHhCCc
Confidence            99999999999999997654

Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates.

>PRK06761 hypothetical protein; Provisional

Probab=95.65  E-value=0.0066  Score=46.43  Aligned_cols=31  Identities=16%  Similarity=0.129  Sum_probs=23.9

Q ss_pred             cccCcCCCchhHHHHhhhhhhhhccCCCCeEEE
Q 042811           90 WPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMH  122 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~w  122 (130)
                      +|.|..|+|||||++.+.+.. . ...++...+
T Consensus         7 vI~G~~GsGKTTla~~L~~~L-~-~~g~~v~~~   37 (282)
T PRK06761          7 IIEGLPGFGKSTTAKMLNDIL-S-QNGIEVELY   37 (282)
T ss_pred             EEECCCCCCHHHHHHHHHHhc-C-cCceEEEEE
Confidence            389999999999999999987 4 234554443

>CHL00072 chlL photochlorophyllide reductase subunit L

Probab=95.65  E-value=0.0061  Score=46.59  Aligned_cols=16  Identities=31%  Similarity=0.544  Sum_probs=14.1

Q ss_pred             ccCcCCCchhHHHHhh
Q 042811           91 PFGVEGVGKITSLSKS  106 (130)
Q Consensus        91 I~GmGGvGKTTLak~v  106 (130)
                      |+|-|||||||++-.+
T Consensus         5 ~~gKGGVGKTTta~nL   20 (290)
T CHL00072          5 VYGKGGIGKSTTSCNI   20 (290)
T ss_pred             EECCCCCcHHHHHHHH
Confidence            6899999999988764

>PHA02530 pseT polynucleotide kinase; Provisional

Probab=95.64  E-value=0.0065  Score=46.05  Aligned_cols=20  Identities=30%  Similarity=0.263  Sum_probs=17.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|..|+||||+|+.+-+..
T Consensus         7 l~G~pGSGKSTla~~L~~~~   26 (300)
T PHA02530          7 TVGVPGSGKSTWAREFAAKN   26 (300)
T ss_pred             EEcCCCCCHHHHHHHHHHHC
Confidence            78999999999999986543

>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters

Probab=95.64  E-value=0.0064  Score=43.86  Aligned_cols=20  Identities=30%  Similarity=0.298  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+....
T Consensus        30 l~G~nGsGKSTLl~~l~G~~   49 (213)
T cd03235          30 IVGPNGAGKSTLLKAILGLL   49 (213)
T ss_pred             EECCCCCCHHHHHHHHcCCC
Confidence            99999999999999998754

This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc. The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor. The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri. Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.

>cd04150 Arf1_5_like Arf1-Arf5-like subfamily

Probab=95.64  E-value=0.0066  Score=41.74  Aligned_cols=18  Identities=33%  Similarity=0.353  Sum_probs=16.0

Q ss_pred             ccccCcCCCchhHHHHhh
Q 042811           89 NWPFGVEGVGKITSLSKS  106 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v  106 (130)
                      +.++|.+|+|||||+..+
T Consensus         3 v~~~G~~~~GKTsli~~l   20 (159)
T cd04150           3 ILMVGLDAAGKTTILYKL   20 (159)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            347899999999999998

This subfamily contains Arf1, Arf2, Arf3, Arf4, Arf5, and related proteins. Arfs1-5 are soluble proteins that are crucial for assembling coat proteins during vesicle formation. Each contains an N-terminal myristoylated amphipathic helix that is folded into the protein in the GDP-bound state. GDP/GTP exchange exposes the helix, which anchors to the membrane. Following GTP hydrolysis, the helix dissociates from the membrane and folds back into the protein. A general feature of Arf1-5 signaling may be the cooperation of two Arfs at the same site. Arfs1-5 are generally considered to be interchangeable in function and location, but some specific functions have been assigned. Arf1 localizes to the early/cis-Golgi, where it is activated by GBF1 and recruits the coat protein COPI. It also localizes to the trans-Golgi network (TGN), where it is activated by BIG1/BIG2 and recruits the AP1, AP3, AP4, and GGA proteins. Humans, but not rodents

>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB

Probab=95.63  E-value=0.0065  Score=43.90  Aligned_cols=21  Identities=33%  Similarity=0.178  Sum_probs=18.6

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|..|.|||||++.+....
T Consensus        27 ~i~G~nGsGKSTLl~~l~G~~   47 (214)
T cd03297          27 GIFGASGAGKSTLLRCIAGLE   47 (214)
T ss_pred             EEECCCCCCHHHHHHHHhCCC
Confidence            399999999999999997754

ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function

Probab=95.62  E-value=0.0025  Score=47.75  Aligned_cols=20  Identities=25%  Similarity=0.494  Sum_probs=19.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      +||..|+|||+|+|.+.+..
T Consensus        57 L~G~rGtGKSSlVkall~~y   76 (249)
T PF05673_consen   57 LWGARGTGKSSLVKALLNEY   76 (249)
T ss_pred             EecCCCCCHHHHHHHHHHHH
Confidence            99999999999999999877

>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional

Probab=95.62  E-value=0.0065  Score=46.22  Aligned_cols=20  Identities=20%  Similarity=0.293  Sum_probs=17.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|.+|+|||||+.++-..+
T Consensus         6 i~G~~gSGKTTLi~~Li~~L   25 (274)
T PRK14493          6 IVGYKATGKTTLVERLVDRL   25 (274)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            88999999999999987665

>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase

Probab=95.61  E-value=0.0065  Score=43.99  Aligned_cols=16  Identities=31%  Similarity=0.524  Sum_probs=13.4

Q ss_pred             ccCcCCCchhHHHHhh
Q 042811           91 PFGVEGVGKITSLSKS  106 (130)
Q Consensus        91 I~GmGGvGKTTLak~v  106 (130)
                      |.|-||+||||++-++
T Consensus         5 v~gKGGvGKTt~~~nL   20 (212)
T cd02117           5 IYGKGGIGKSTTSQNL   20 (212)
T ss_pred             EECCCcCcHHHHHHHH
Confidence            5699999999977664

Members of this family use energey from ATP hydrolysis and transfer electrons through a Fe4-S4 cluster to other subunit for reduction of substrate.

>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport

Probab=95.61  E-value=0.0067  Score=44.36  Aligned_cols=20  Identities=25%  Similarity=0.112  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+....
T Consensus        36 l~G~nGsGKSTLl~~l~G~~   55 (233)
T cd03258          36 IIGRSGAGKSTLIRCINGLE   55 (233)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999997754

Other members of this system include the MetP permease and the MetQ substrate binding protein. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]

Probab=95.60  E-value=0.0098  Score=44.69  Aligned_cols=35  Identities=20%  Similarity=0.071  Sum_probs=27.4

Q ss_pred             ccccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC
Q 042811           89 NWPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR  126 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS  126 (130)
                      +.++|-.|+|||.||..+.|..+  +..+. |++++++
T Consensus       108 l~l~G~~G~GKThLa~Ai~~~l~--~~g~s-v~f~~~~  142 (254)
T COG1484         108 LVLLGPPGVGKTHLAIAIGNELL--KAGIS-VLFITAP  142 (254)
T ss_pred             EEEECCCCCcHHHHHHHHHHHHH--HcCCe-EEEEEHH
Confidence            34999999999999999999984  34555 4666654

>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE)

Probab=95.60  E-value=0.0067  Score=44.04  Aligned_cols=20  Identities=25%  Similarity=0.180  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+....
T Consensus        36 i~G~nGsGKSTLl~~l~G~~   55 (228)
T cd03257          36 LVGESGSGKSTLARAILGLL   55 (228)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999997754

The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE). The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis. The molecular mechanism of nickel uptake in many bacteria and most archaea is not known. Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides. The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.

>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]

Probab=95.60  E-value=0.0065  Score=47.55  Aligned_cols=20  Identities=30%  Similarity=0.165  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+|||||++.|-.-.
T Consensus        34 llGPSGcGKSTlLr~IAGLe   53 (338)
T COG3839          34 LLGPSGCGKSTLLRMIAGLE   53 (338)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999987644

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]

Probab=95.59  E-value=0.0071  Score=44.84  Aligned_cols=20  Identities=30%  Similarity=0.074  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||+..+..-.
T Consensus        36 I~GpSGSGKSTLLniig~ld   55 (226)
T COG1136          36 IVGPSGSGKSTLLNLLGGLD   55 (226)
T ss_pred             EECCCCCCHHHHHHHHhccc
Confidence            99999999999999987644

>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein

Probab=95.58  E-value=0.0071  Score=43.83  Aligned_cols=20  Identities=30%  Similarity=0.069  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        36 i~G~nGsGKSTLl~~i~G~~   55 (221)
T TIGR02211        36 IVGSSGSGKSTLLHLLGGLD   55 (221)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999997754

This model represents LolD, a member of the ABC transporter family (pfam00005). LolD is involved in localization of lipoproteins in some bacteria. It works with a transmembrane protein LolC, which in some species is a paralogous pair LolC and LolE. Depending on whether the residue immediately following the new, modified N-terminal Cys residue, the nascent lipoprotein may be carried further by LolA and LolB to the outer membrane, or remain at the inner membrane. The top scoring proteins excluded by this model include homologs from the archaeal genus Methanosarcina.

>cd04123 Rab21 Rab21 subfamily

Probab=95.58  E-value=0.0075  Score=40.65  Aligned_cols=21  Identities=19%  Similarity=0.154  Sum_probs=17.1

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|-+|+|||||+..+.+.
T Consensus         3 i~i~G~~~~GKStli~~l~~~   23 (162)
T cd04123           3 VVLLGEGRVGKTSLVLRYVEN   23 (162)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            347899999999999876654

The localization and function of Rab21 are not clearly defined, with conflicting data reported. Rab21 has been reported to localize in the ER in human intestinal epithelial cells, with partial colocalization with alpha-glucosidase, a late endosomal/lysosomal marker. More recently, Rab21 was shown to colocalize with and affect the morphology of early endosomes. In Dictyostelium, GTP-bound Rab21, together with two novel LIM domain proteins, LimF and ChLim, has been shown to regulate phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site

>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK

Probab=95.58  E-value=0.0071  Score=43.56  Aligned_cols=20  Identities=30%  Similarity=0.245  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+....
T Consensus        31 l~G~nGsGKSTLl~~l~G~~   50 (213)
T cd03301          31 LLGPSGCGKTTTLRMIAGLE   50 (213)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles. ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP. In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed.

>PRK14738 gmk guanylate kinase; Provisional

Probab=95.58  E-value=0.0072  Score=43.80  Aligned_cols=19  Identities=32%  Similarity=0.347  Sum_probs=17.2

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|..|+|||||++.+.+.
T Consensus        18 i~GpsG~GK~tl~~~L~~~   36 (206)
T PRK14738         18 ISGPSGVGKDAVLARMRER   36 (206)
T ss_pred             EECcCCCCHHHHHHHHHhc
Confidence            8999999999999998753

>PRK13232 nifH nitrogenase reductase; Reviewed

Probab=95.57  E-value=0.0067  Score=45.59  Aligned_cols=18  Identities=28%  Similarity=0.451  Sum_probs=14.6

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |+|-|||||||++-++--
T Consensus         6 v~gKGGVGKTT~a~nLA~   23 (273)
T PRK13232          6 IYGKGGIGKSTTTQNLTA   23 (273)
T ss_pred             EECCCCCcHHHHHHHHHH
Confidence            459999999998877643

>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD

Probab=95.57  E-value=0.0071  Score=44.29  Aligned_cols=20  Identities=20%  Similarity=0.140  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        17 i~G~nGsGKSTLl~~l~Gl~   36 (230)
T TIGR02770        17 LVGESGSGKSLTCLAILGLL   36 (230)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999998865

This family represents the NikD subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase. NikD and NikE are homologous.

>cd04101 RabL4 RabL4 (Rab-like4) subfamily

Probab=95.57  E-value=0.0075  Score=41.11  Aligned_cols=19  Identities=21%  Similarity=0.048  Sum_probs=16.3

Q ss_pred             ccccCcCCCchhHHHHhhh
Q 042811           89 NWPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~  107 (130)
                      +.|+|.+|+|||||+..+.
T Consensus         3 i~vvG~~~~GKtsl~~~l~   21 (164)
T cd04101           3 CAVVGDPAVGKTAFVQMFH   21 (164)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3478999999999999874

RabL4s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like. As in other Rab-like proteins, RabL4 lacks a prenylation site at the C-terminus. The specific function of RabL4 remains unknown.

>PRK13541 cytochrome c biogenesis protein CcmA; Provisional

Probab=95.57  E-value=0.0072  Score=43.15  Aligned_cols=20  Identities=25%  Similarity=0.192  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+....
T Consensus        31 l~G~nGsGKSTLl~~l~G~~   50 (195)
T PRK13541         31 IKGANGCGKSSLLRMIAGIM   50 (195)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999998754

>cd01898 Obg Obg subfamily

Probab=95.56  E-value=0.0074  Score=41.31  Aligned_cols=21  Identities=29%  Similarity=0.154  Sum_probs=17.7

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||++.+.+.
T Consensus         3 v~ivG~~~~GKStl~~~l~~~   23 (170)
T cd01898           3 VGLVGLPNAGKSTLLSAISNA   23 (170)
T ss_pred             eEEECCCCCCHHHHHHHHhcC
Confidence            347899999999999998743

The Obg nucleotide binding protein subfamily has been implicated in stress response, chromosome partitioning, replication initiation, mycelium development, and sporulation. Obg proteins are among a large group of GTP binding proteins conserved from bacteria to humans. The E. coli homolog, ObgE is believed to function in ribosomal biogenesis. Members of the subfamily contain two equally and highly conserved domains, a C-terminal GTP binding domain and an N-terminal glycine-rich domain.

>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional

Probab=95.56  E-value=0.0072  Score=44.27  Aligned_cols=20  Identities=30%  Similarity=0.069  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        40 l~G~nGsGKSTLl~~l~Gl~   59 (233)
T PRK11629         40 IVGSSGSGKSTLLHLLGGLD   59 (233)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999998754

>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import

Probab=95.56  E-value=0.0072  Score=44.44  Aligned_cols=20  Identities=30%  Similarity=0.157  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        33 i~G~nGsGKSTLl~~l~Gl~   52 (239)
T cd03296          33 LLGPSGSGKTTLLRLIAGLE   52 (239)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function

Probab=95.56  E-value=0.0074  Score=43.48  Aligned_cols=18  Identities=22%  Similarity=0.183  Sum_probs=16.8

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |+|-.|+|||||++.++.
T Consensus        27 i~G~nGsGKStll~al~~   44 (197)
T cd03278          27 IVGPNGSGKSNIIDAIRW   44 (197)
T ss_pred             EECCCCCCHHHHHHHHHH
Confidence            999999999999999874

Barmotin belongs to the SMC protein family. SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, w

>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional

Probab=95.55  E-value=0.0074  Score=43.99  Aligned_cols=20  Identities=30%  Similarity=0.125  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+..-.
T Consensus        41 i~G~nGsGKSTLl~~i~Gl~   60 (228)
T PRK10584         41 LIGESGSGKSTLLAILAGLD   60 (228)
T ss_pred             EECCCCCCHHHHHHHHHcCC
Confidence            99999999999999998754

>PRK14527 adenylate kinase; Provisional

Probab=95.55  E-value=0.008  Score=42.81  Aligned_cols=22  Identities=27%  Similarity=0.244  Sum_probs=18.8

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|.|..|+||||+|+.+.+..
T Consensus         9 i~i~G~pGsGKsT~a~~La~~~   30 (191)
T PRK14527          9 VIFLGPPGAGKGTQAERLAQEL   30 (191)
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            3499999999999999987654

>cd01861 Rab6 Rab6 subfamily

Probab=95.54  E-value=0.0077  Score=40.84  Aligned_cols=21  Identities=19%  Similarity=0.229  Sum_probs=16.9

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus         3 i~liG~~~~GKSsli~~l~~~   23 (161)
T cd01861           3 LVFLGDQSVGKTSIITRFMYD   23 (161)
T ss_pred             EEEECCCCCCHHHHHHHHHcC
Confidence            347899999999999886433

Rab6 is involved in microtubule-dependent transport pathways through the Golgi and from endosomes to the Golgi. Rab6A of mammals is implicated in retrograde transport through the Golgi stack, and is also required for a slow, COPI-independent, retrograde transport pathway from the Golgi to the endoplasmic reticulum (ER). This pathway may allow Golgi residents to be recycled through the ER for scrutiny by ER quality-control systems. Yeast Ypt6p, the homolog of the mammalian Rab6 GTPase, is not essential for cell viability. Ypt6p acts in endosome-to-Golgi, in intra-Golgi retrograde transport, and possibly also in Golgi-to-ER trafficking. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate

>TIGR03499 FlhF flagellar biosynthetic protein FlhF

Probab=95.54  E-value=0.011  Score=45.05  Aligned_cols=20  Identities=45%  Similarity=0.624  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|.+|+||||++.++...+
T Consensus       199 ~vGptGvGKTTt~~kLa~~~  218 (282)
T TIGR03499       199 LVGPTGVGKTTTLAKLAARF  218 (282)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            99999999999999988766

>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake

Probab=95.54  E-value=0.0073  Score=43.66  Aligned_cols=20  Identities=30%  Similarity=0.351  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        36 i~G~nGsGKSTLl~~l~Gl~   55 (218)
T cd03266          36 LLGPNGAGKTTTLRMLAGLL   55 (218)
T ss_pred             EECCCCCCHHHHHHHHhCCc
Confidence            99999999999999998754

NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein.

>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D

Probab=95.53  E-value=0.0075  Score=44.24  Aligned_cols=20  Identities=30%  Similarity=0.184  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+..-.
T Consensus        16 i~G~nGsGKSTLl~~l~Gl~   35 (230)
T TIGR01184        16 LIGHSGCGKSTLLNLISGLA   35 (230)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

This model describes the ATP binding subunits of nitrate transport in bacteria and archaea. This protein belongs to the ATP-binding cassette (ABC) superfamily. It is thought that the two subunits encoded by ntrC and ntrD form the binding surface for interaction with ATP. This model is restricted in identifying ATP binding subunit associated with the nitrate transport. Nitrate assimilation is aided by other proteins derived from the operon which among others include products of ntrA - a regulatory protein; ntrB - a hydropbobic transmembrane permease and narB - a reductase.

>TIGR01978 sufC FeS assembly ATPase SufC

Probab=95.53  E-value=0.0073  Score=44.33  Aligned_cols=19  Identities=26%  Similarity=0.205  Sum_probs=17.9

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|.|||||++.+...
T Consensus        31 i~G~nGsGKSTLl~~l~Gl   49 (243)
T TIGR01978        31 IMGPNGSGKSTLSKTIAGH   49 (243)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            9999999999999999875

SufC is part of the SUF system, shown in E. coli to consist of six proteins and believed to act in Fe-S cluster formation during oxidative stress. SufC forms a complex with SufB and SufD. SufC belongs to the ATP-binding cassette transporter family (pfam00005) but is no longer thought to be part of a transporter. The complex is reported as cytosolic (PubMed:12554644) or associated with the membrane (PubMed:11943156). The SUF system also includes a cysteine desulfurase (SufS, enhanced by SufE) and a probable iron-sulfur cluster assembly scaffold protein, SufA.

>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group

Probab=95.53  E-value=0.0075  Score=43.16  Aligned_cols=20  Identities=30%  Similarity=0.091  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        29 i~G~nGsGKSTLl~~l~G~~   48 (206)
T TIGR03608        29 IIGESGSGKSTLLNIIGLLE   48 (206)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999998754

A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.

>TIGR02173 cyt_kin_arch cytidylate kinase, putative

Probab=95.52  E-value=0.0083  Score=41.42  Aligned_cols=19  Identities=26%  Similarity=0.067  Sum_probs=16.5

Q ss_pred             cccCcCCCchhHHHHhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~  108 (130)
                      .|.|..|+||||+|+.+-+
T Consensus         4 ~i~G~~GSGKstia~~la~   22 (171)
T TIGR02173         4 TISGPPGSGKTTVAKILAE   22 (171)
T ss_pred             EEECCCCCCHHHHHHHHHH
Confidence            3789999999999999854

Proteins in this family are believed to be cytidylate kinase. Members of this family are found in the archaea and in spirochaetes, and differ considerably from the common bacterial form of cytidylate kinase described by TIGR00017.

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]

Probab=95.51  E-value=0.008  Score=48.15  Aligned_cols=20  Identities=30%  Similarity=0.293  Sum_probs=19.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |||-.|+|||.|++.+.|..
T Consensus       118 i~G~~GlGKTHLl~Aign~~  137 (408)
T COG0593         118 IYGGVGLGKTHLLQAIGNEA  137 (408)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            99999999999999999987

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes

Probab=95.51  E-value=0.0077  Score=42.03  Aligned_cols=19  Identities=37%  Similarity=0.438  Sum_probs=16.1

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+.|+||||++..+...
T Consensus         5 ~~G~~G~GKTt~~~~la~~   23 (173)
T cd03115           5 LVGLQGVGKTTTAAKLALY   23 (173)
T ss_pred             EECCCCCCHHHHHHHHHHH
Confidence            6899999999998887544

SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The SRP-polypeptide complex is then targeted to the membrane by an interaction between SRP and its cognated receptor (SR). In mammals, SRP consists of six protein subunits and a 7SL RNA. One of these subunits is a 54 kd protein (SRP54), which is a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 is a multidomain protein that consists of an N-terminal domain, followed by a central G (GTPase) domain and a C-terminal M domain.

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids

Probab=95.51  E-value=0.007  Score=43.07  Aligned_cols=20  Identities=25%  Similarity=0.338  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+..-.
T Consensus        30 l~G~nGsGKSTLl~~l~Gl~   49 (177)
T cd03222          30 IVGPNGTGKTTAVKILAGQL   49 (177)
T ss_pred             EECCCCChHHHHHHHHHcCC
Confidence            99999999999999998754

RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.

>cd01878 HflX HflX subfamily

Probab=95.51  E-value=0.0079  Score=42.88  Aligned_cols=21  Identities=19%  Similarity=0.017  Sum_probs=18.2

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|.+|+|||||+..+.+..
T Consensus        45 ~iiG~~g~GKStLl~~l~~~~   65 (204)
T cd01878          45 ALVGYTNAGKSTLFNALTGAD   65 (204)
T ss_pred             EEECCCCCCHHHHHHHHhcch
Confidence            489999999999999888753

A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily. The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual biological functions of these GTPases remain unclear. HflX is widespread, but not universally represented in all three superkingdoms.

>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system

Probab=95.50  E-value=0.0078  Score=44.18  Aligned_cols=20  Identities=30%  Similarity=0.335  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        32 i~G~nGsGKSTLl~~l~G~~   51 (236)
T TIGR03864        32 LLGPNGAGKSTLFSLLTRLY   51 (236)
T ss_pred             EECCCCCCHHHHHHHHhCCc
Confidence            99999999999999998654

Members of this protein family are the ATP-binding subunit of an ABC transporter system that is associated with PQQ biosynthesis and PQQ-dependent alcohol dehydrogenases. While this family shows homology to several efflux ABC transporter subunits, the presence of a periplasmic substrate-binding protein and association with systems for catabolism of alcohols suggests a role in import rather than detoxification.

>PRK02496 adk adenylate kinase; Provisional

Probab=95.50  E-value=0.0086  Score=42.27  Aligned_cols=21  Identities=24%  Similarity=0.067  Sum_probs=17.7

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|.|..|+||||+++.+...
T Consensus         4 i~i~G~pGsGKst~a~~la~~   24 (184)
T PRK02496          4 LIFLGPPGAGKGTQAVVLAEH   24 (184)
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            448899999999999988653

>CHL00095 clpC Clp protease ATP binding subunit

Probab=95.50  E-value=0.0032  Score=54.47  Aligned_cols=32  Identities=19%  Similarity=0.179  Sum_probs=25.2

Q ss_pred             eeecccCCCCcc------------ccCcCCCchhHHHHhhhhhh
Q 042811           79 KLGDVRRNGNNW------------PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        79 ivG~~~~~~~l~------------I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|++...+.+.            ++|..|+|||+||+.+....
T Consensus       181 ~igr~~ei~~~~~~L~r~~~~n~lL~G~pGvGKTal~~~la~~i  224 (821)
T CHL00095        181 VIGREKEIERVIQILGRRTKNNPILIGEPGVGKTAIAEGLAQRI  224 (821)
T ss_pred             CCCcHHHHHHHHHHHcccccCCeEEECCCCCCHHHHHHHHHHHH
Confidence            588876444332            99999999999999987765

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional

Probab=95.50  E-value=0.0068  Score=49.83  Aligned_cols=20  Identities=30%  Similarity=0.202  Sum_probs=18.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+||||+|+.+.+..
T Consensus        41 f~GppGtGKTTlA~~lA~~l   60 (504)
T PRK14963         41 FSGPRGVGKTTTARLIAMAV   60 (504)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            99999999999999998876

>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine

Probab=95.50  E-value=0.0077  Score=44.07  Aligned_cols=20  Identities=25%  Similarity=0.240  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        31 l~G~nGsGKSTLl~~l~Gl~   50 (236)
T cd03219          31 LIGPNGAGKTTLFNLISGFL   50 (236)
T ss_pred             EECCCCCCHHHHHHHHcCCC
Confidence            99999999999999998754

MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).

>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional

Probab=95.49  E-value=0.017  Score=45.55  Aligned_cols=21  Identities=24%  Similarity=0.238  Sum_probs=19.3

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +|+|..|+|||||+..+....
T Consensus         9 ~i~G~~gsGKTTl~~~l~~~l   29 (369)
T PRK14490          9 AFCGYSGSGKTTLITALVRRL   29 (369)
T ss_pred             EEEeCCCCCHHHHHHHHHHHH
Confidence            389999999999999999877

>cd04114 Rab30 Rab30 subfamily

Probab=95.49  E-value=0.0081  Score=41.14  Aligned_cols=20  Identities=25%  Similarity=0.230  Sum_probs=17.2

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|..|+|||||+..+-+
T Consensus        10 v~v~G~~~~GKSsli~~l~~   29 (169)
T cd04114          10 IVLIGNAGVGKTCLVRRFTQ   29 (169)
T ss_pred             EEEECCCCCCHHHHHHHHHh
Confidence            33999999999999999763

Rab30 appears to be associated with the Golgi stack. It is expressed in a wide variety of tissue types and in humans maps to chromosome 11. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN

Probab=95.49  E-value=0.008  Score=45.18  Aligned_cols=21  Identities=24%  Similarity=0.107  Sum_probs=18.3

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++.|..|+||||||+.+.+..
T Consensus        25 LL~G~~GtGKT~lA~~la~~l   45 (262)
T TIGR02640        25 HLRGPAGTGKTTLAMHVARKR   45 (262)
T ss_pred             EEEcCCCCCHHHHHHHHHHHh
Confidence            388999999999999998743

Members of this family are the GvpN protein associated with the production of gas vesicles produced in some prokaryotes to give cells buoyancy. This family belongs to a larger family of ATPases (pfam07728).

>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids

Probab=95.47  E-value=0.008  Score=43.54  Aligned_cols=20  Identities=30%  Similarity=0.356  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|+|||||++.+..-.
T Consensus        31 i~G~nGsGKSTLl~~l~Gl~   50 (222)
T cd03224          31 LLGRNGAGKTTLLKTIMGLL   50 (222)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999987654

The E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.

>PRK00454 engB GTP-binding protein YsxC; Reviewed

Probab=95.47  E-value=0.0081  Score=42.26  Aligned_cols=21  Identities=19%  Similarity=0.039  Sum_probs=18.7

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        27 v~ivG~~~~GKSsli~~l~~~   47 (196)
T PRK00454         27 IAFAGRSNVGKSSLINALTNR   47 (196)
T ss_pred             EEEEcCCCCCHHHHHHHHhCC
Confidence            449999999999999999874

>PRK13538 cytochrome c biogenesis protein CcmA; Provisional

Probab=95.45  E-value=0.0082  Score=43.15  Aligned_cols=20  Identities=25%  Similarity=0.089  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        32 l~G~nGsGKSTLl~~l~G~~   51 (204)
T PRK13538         32 IEGPNGAGKTSLLRILAGLA   51 (204)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily

Probab=95.45  E-value=0.0086  Score=41.60  Aligned_cols=21  Identities=19%  Similarity=0.082  Sum_probs=17.4

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|-.|+|||||++.+.+.
T Consensus         4 v~l~G~~g~GKTtl~~~~~~~   24 (180)
T cd04137           4 IAVLGSRSVGKSSLTVQFVEG   24 (180)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            448999999999999987543

Rheb was initially identified in rat brain, where its expression is elevated by seizures or by long-term potentiation. It is expressed ubiquitously, with elevated levels in muscle and brain. Rheb functions as an important mediator between the tuberous sclerosis complex proteins, TSC1 and TSC2, and the mammalian target of rapamycin (TOR) kinase to stimulate cell growth. TOR kinase regulates cell growth by controlling nutrient availability, growth factors, and the energy status of the cell. TSC1 and TSC2 form a dimeric complex that has tumor suppressor activity, and TSC2 is a GTPase activating protein (GAP) for Rheb. The TSC1/TSC2 complex inhibits the activation of TOR kinase through Rheb. Rheb has also been shown to induce the formation of large cytoplasmic vacuoles in a process that is dependent on the GTPase cycle of Rheb, but independent of the TOR kinase, suggesting Rheb plays a role in endocytic trafficking that le

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional

Probab=95.45  E-value=0.016  Score=45.97  Aligned_cols=20  Identities=35%  Similarity=0.431  Sum_probs=18.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+||||++.++-...
T Consensus       142 lvGptGvGKTTtiakLA~~~  161 (374)
T PRK14722        142 LMGPTGVGKTTTTAKLAARC  161 (374)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            99999999999999998865

>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E

Probab=95.45  E-value=0.008  Score=44.05  Aligned_cols=20  Identities=25%  Similarity=0.165  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+..-.
T Consensus        33 i~G~nGsGKSTLl~~l~Gl~   52 (237)
T cd03252          33 IVGRSGSGKSTLTKLIQRFY   52 (237)
T ss_pred             EECCCCCCHHHHHHHHhcCc
Confidence            99999999999999997653

coli. The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane. HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB. This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport. Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.

>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance

Probab=95.44  E-value=0.0086  Score=43.04  Aligned_cols=20  Identities=25%  Similarity=0.325  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        31 i~G~nGsGKSTLl~~l~Gl~   50 (208)
T cd03268          31 FLGPNGAGKTTTMKIILGLI   50 (208)
T ss_pred             EECCCCCCHHHHHHHHhCCc
Confidence            99999999999999997653

Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis. The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC. Bacitracin has potent antibiotic activity against gram-positive bacteria. The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin. The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC. B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.

>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids

Probab=95.44  E-value=0.0083  Score=43.78  Aligned_cols=20  Identities=25%  Similarity=0.282  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|.|||||++.+....
T Consensus        31 l~G~nGsGKSTLl~~l~Gl~   50 (232)
T cd03218          31 LLGPNGAGKTTTFYMIVGLV   50 (232)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999997754

The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis. YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein. Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli. The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.

>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively

Probab=95.43  E-value=0.0085  Score=43.13  Aligned_cols=20  Identities=30%  Similarity=0.106  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+..-.
T Consensus        31 l~G~nGsGKSTLl~~l~G~~   50 (213)
T cd03262          31 IIGPSGSGKSTLLRCINLLE   50 (213)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP. HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM. The two HisP subunits form a homodimer within the complex. The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems. All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria. The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM

>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional

Probab=95.43  E-value=0.0085  Score=43.56  Aligned_cols=20  Identities=20%  Similarity=-0.004  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+..-.
T Consensus        18 l~G~NGsGKSTLlk~i~Gl~   37 (213)
T PRK15177         18 ILAAPGSGKTTLTRLLCGLD   37 (213)
T ss_pred             EECCCCCCHHHHHHHHhCCc
Confidence            99999999999999998754

>PRK04195 replication factor C large subunit; Provisional

Probab=95.43  E-value=0.0083  Score=48.88  Aligned_cols=22  Identities=23%  Similarity=0.347  Sum_probs=19.5

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+||||||+.+.+..
T Consensus        42 lLL~GppG~GKTtla~ala~el   63 (482)
T PRK04195         42 LLLYGPPGVGKTSLAHALANDY   63 (482)
T ss_pred             EEEECCCCCCHHHHHHHHHHHc
Confidence            3499999999999999998865

>PRK09183 transposase/IS protein; Provisional

Probab=95.43  E-value=0.0082  Score=45.16  Aligned_cols=22  Identities=27%  Similarity=0.075  Sum_probs=19.6

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+||||||..+.+..
T Consensus       105 v~l~Gp~GtGKThLa~al~~~a  126 (259)
T PRK09183        105 IVLLGPSGVGKTHLAIALGYEA  126 (259)
T ss_pred             EEEEeCCCCCHHHHHHHHHHHH
Confidence            4499999999999999998765

>PRK11124 artP arginine transporter ATP-binding subunit; Provisional

Probab=95.42  E-value=0.0086  Score=44.07  Aligned_cols=20  Identities=25%  Similarity=0.142  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        33 i~G~nGsGKSTLl~~l~G~~   52 (242)
T PRK11124         33 LLGPSGAGKSSLLRVLNLLE   52 (242)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

>TIGR00150 HI0065_YjeE ATPase, YjeE family

Probab=95.42  E-value=0.0095  Score=40.65  Aligned_cols=20  Identities=25%  Similarity=0.192  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|.-|+|||||+|.+.+..
T Consensus        27 l~G~lGaGKTtl~~~l~~~l   46 (133)
T TIGR00150        27 LKGDLGAGKTTLVQGLLQGL   46 (133)
T ss_pred             EEcCCCCCHHHHHHHHHHHc
Confidence            89999999999999998865

Members of this family have a conserved nucleotide-binding motif GXXGXGKT and a nucleotide-binding fold. Member protein YjeE of Haemophilus influenzae (HI0065) was shown to have ATPase activity.

>PRK08939 primosomal protein DnaI; Reviewed

Probab=95.42  E-value=0.011  Score=45.59  Aligned_cols=35  Identities=20%  Similarity=0.062  Sum_probs=26.8

Q ss_pred             ccccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC
Q 042811           89 NWPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR  126 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS  126 (130)
                      +.|+|-.|+|||+||..+.|..+  ...+. +.+++++
T Consensus       159 l~L~G~~G~GKThLa~Aia~~l~--~~g~~-v~~~~~~  193 (306)
T PRK08939        159 LYLYGDFGVGKSYLLAAIANELA--KKGVS-STLLHFP  193 (306)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHH--HcCCC-EEEEEHH
Confidence            34999999999999999999884  34444 4666554

>cd04122 Rab14 Rab14 subfamily

Probab=95.41  E-value=0.009  Score=41.03  Aligned_cols=21  Identities=29%  Similarity=0.218  Sum_probs=17.4

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|.+|+|||||+..+.+.
T Consensus         5 i~iiG~~~vGKTsli~~~~~~   25 (166)
T cd04122           5 YIIIGDMGVGKSCLLHQFTEK   25 (166)
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            348999999999999987544

Rab14 GTPases are localized to biosynthetic compartments, including the rough ER, the Golgi complex, and the trans-Golgi network, and to endosomal compartments, including early endosomal vacuoles and associated vesicles. Rab14 is believed to function in both the biosynthetic and recycling pathways between the Golgi and endosomal compartments. Rab14 has also been identified on GLUT4 vesicles, and has been suggested to help regulate GLUT4 translocation. In addition, Rab14 is believed to play a role in the regulation of phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GT

>cd04136 Rap_like Rap-like subfamily

Probab=95.40  E-value=0.0094  Score=40.42  Aligned_cols=19  Identities=26%  Similarity=0.212  Sum_probs=15.7

Q ss_pred             ccccCcCCCchhHHHHhhh
Q 042811           89 NWPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~  107 (130)
                      +.|+|-.|+|||||+..+.
T Consensus         4 i~i~G~~~vGKTsl~~~~~   22 (163)
T cd04136           4 VVVLGSGGVGKSALTVQFV   22 (163)
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            3478999999999988744

The Rap subfamily consists of the Rap1, Rap2, and RSR1. Rap subfamily proteins perform different cellular functions, depending on the isoform and its subcellular localization. For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules. Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and microsomal membrane of the pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts. Rap1 localizes in the nucleus of human oropharyngeal squamous cell carcinomas (SCCs) and cell lines. Rap1 plays a role in phagocytosis by controlling the binding of adhesion receptors (typically integrins) to their ligands. In yeast, Rap1 has been implicated in multiple functions, including activation and silencing of transcription and maintenance of telomeres.

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional

Probab=95.39  E-value=0.0096  Score=48.17  Aligned_cols=20  Identities=25%  Similarity=0.257  Sum_probs=18.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+|||+||+.|.+..
T Consensus       222 L~GPPGTGKT~LAraIA~el  241 (438)
T PTZ00361        222 LYGPPGTGKTLLAKAVANET  241 (438)
T ss_pred             EECCCCCCHHHHHHHHHHhh
Confidence            89999999999999999965

>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism]

Probab=95.39  E-value=0.0089  Score=42.63  Aligned_cols=18  Identities=33%  Similarity=0.206  Sum_probs=15.9

Q ss_pred             cccCcCCCchhHHHHhhh
Q 042811           90 WPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~  107 (130)
                      .|-|..|+||||+++.+-
T Consensus         4 ~ITGTPGvGKTT~~~~L~   21 (180)
T COG1936           4 AITGTPGVGKTTVCKLLR   21 (180)
T ss_pred             EEeCCCCCchHHHHHHHH
Confidence            478999999999999874

>PLN02200 adenylate kinase family protein

Probab=95.39  E-value=0.0096  Score=44.17  Aligned_cols=21  Identities=33%  Similarity=0.407  Sum_probs=18.3

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|+.|+||||+++.+-...
T Consensus        47 ~I~G~PGSGKsT~a~~La~~~   67 (234)
T PLN02200         47 FVLGGPGSGKGTQCEKIVETF   67 (234)
T ss_pred             EEECCCCCCHHHHHHHHHHHh
Confidence            399999999999999987654

>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional

Probab=95.38  E-value=0.0088  Score=44.67  Aligned_cols=20  Identities=30%  Similarity=0.248  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        32 i~G~nGsGKSTLl~~l~Gl~   51 (255)
T PRK11248         32 VLGPSGCGKTTLLNLIAGFV   51 (255)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

>TIGR00455 apsK adenylylsulfate kinase (apsK)

Probab=95.38  E-value=0.0097  Score=42.03  Aligned_cols=21  Identities=29%  Similarity=0.472  Sum_probs=19.0

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +|.|..|+||||||+.+....
T Consensus        22 ~i~G~~GsGKstla~~l~~~l   42 (184)
T TIGR00455        22 WLTGLSGSGKSTIANALEKKL   42 (184)
T ss_pred             EEECCCCCCHHHHHHHHHHHH
Confidence            399999999999999998865

Important residue (active site in E.coli) is residue 100 of the seed alignment.

>cd02032 Bchl_like This family of proteins contains bchL and chlL

Probab=95.37  E-value=0.0086  Score=44.76  Aligned_cols=16  Identities=38%  Similarity=0.582  Sum_probs=13.3

Q ss_pred             ccCcCCCchhHHHHhh
Q 042811           91 PFGVEGVGKITSLSKS  106 (130)
Q Consensus        91 I~GmGGvGKTTLak~v  106 (130)
                      |.|-||+||||++-++
T Consensus         5 v~gKGGvGKTT~a~nL   20 (267)
T cd02032           5 VYGKGGIGKSTTSSNL   20 (267)
T ss_pred             EecCCCCCHHHHHHHH
Confidence            5689999999977664

Protochlorophyllide reductase catalyzes the reductive formation of chlorophyllide from protochlorophyllide during biosynthesis of chlorophylls and bacteriochlorophylls. Three genes, bchL, bchN and bchB, are involved in light-independent protochlorophyllide reduction in bacteriochlorophyll biosynthesis. In cyanobacteria, algae, and gymnosperms, three similar genes, chlL, chlN and chlB are involved in protochlorophyllide reduction during chlorophylls biosynthesis. BchL/chlL, bchN/chlN and bchB/chlB exhibit significant sequence similarity to the nifH, nifD and nifK subunits of nitrogenase, respectively. Nitrogenase catalyzes the reductive formation of ammonia from dinitrogen.

>cd04154 Arl2 Arl2 subfamily

Probab=95.36  E-value=0.0093  Score=41.35  Aligned_cols=21  Identities=33%  Similarity=0.392  Sum_probs=17.8

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|.+|+|||||+..+...
T Consensus        17 v~ivG~~~~GKTsL~~~l~~~   37 (173)
T cd04154          17 ILILGLDNAGKTTILKKLLGE   37 (173)
T ss_pred             EEEECCCCCCHHHHHHHHccC
Confidence            349999999999999987654

Arl2 (Arf-like 2) GTPases are members of the Arf family that bind GDP and GTP with very low affinity. Unlike most Arf family proteins, Arl2 is not myristoylated at its N-terminal helix. The protein PDE-delta, first identified in photoreceptor rod cells, binds specifically to Arl2 and is structurally very similar to RhoGDI. Despite the high structural similarity between Arl2 and Rho proteins and between PDE-delta and RhoGDI, the interactions between the GTPases and their effectors are very different. In its GTP bound form, Arl2 interacts with the protein Binder of Arl2 (BART), and the complex is believed to play a role in mitochondrial adenine nucleotide transport. In its GDP bound form, Arl2 interacts with tubulin- folding Cofactor D; this interaction is believed to play a role in regulation of microtubule dynamics that impact the cytoskeleton, cell division, and cytokinesis.

>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment

Probab=95.36  E-value=0.0094  Score=43.91  Aligned_cols=20  Identities=25%  Similarity=0.303  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        32 i~G~nGsGKSTLl~~l~G~~   51 (242)
T cd03295          32 LIGPSGSGKTTTMKMINRLI   51 (242)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999998754

ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional

Probab=95.35  E-value=0.0093  Score=44.39  Aligned_cols=24  Identities=29%  Similarity=0.136  Sum_probs=20.1

Q ss_pred             CCcc-ccCcCCCchhHHHHhhhhhh
Q 042811           87 GNNW-PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        87 ~~l~-I~GmGGvGKTTLak~v~~~~  110 (130)
                      .+++ |+|..|.|||||++.+....
T Consensus        31 Ge~~~l~G~nGsGKSTLl~~i~G~~   55 (257)
T PRK10619         31 GDVISIIGSSGSGKSTFLRCINFLE   55 (257)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCCC
Confidence            3344 99999999999999998764

>PRK14737 gmk guanylate kinase; Provisional

Probab=95.35  E-value=0.0098  Score=42.60  Aligned_cols=20  Identities=30%  Similarity=0.233  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+.+..
T Consensus         9 l~GpsG~GK~tl~~~l~~~~   28 (186)
T PRK14737          9 ISSVAGGGKSTIIQALLEEH   28 (186)
T ss_pred             EECCCCCCHHHHHHHHHhcC
Confidence            89999999999999998765

>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]

Probab=95.35  E-value=0.0093  Score=44.63  Aligned_cols=20  Identities=30%  Similarity=0.245  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.++.-.
T Consensus        35 iIG~SGaGKSTLLR~lngl~   54 (258)
T COG3638          35 IIGPSGAGKSTLLRSLNGLV   54 (258)
T ss_pred             EECCCCCcHHHHHHHHhccc
Confidence            99999999999999998743

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis

Probab=95.35  E-value=0.0095  Score=41.91  Aligned_cols=20  Identities=30%  Similarity=0.330  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        33 i~G~nGsGKStLl~~l~G~~   52 (178)
T cd03247          33 LLGRSGSGKSTLLQLLTGDL   52 (178)
T ss_pred             EECCCCCCHHHHHHHHhccC
Confidence            99999999999999998764

The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes. CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space. In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.

>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed

Probab=95.35  E-value=0.0093  Score=43.85  Aligned_cols=20  Identities=30%  Similarity=0.134  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        32 l~G~nGsGKSTLl~~l~G~~   51 (240)
T PRK09493         32 IIGPSGSGKSTLLRCINKLE   51 (240)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional

Probab=95.35  E-value=0.0093  Score=43.87  Aligned_cols=20  Identities=25%  Similarity=0.296  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        34 l~G~nGsGKSTLl~~l~G~~   53 (241)
T PRK10895         34 LLGPNGAGKTTTFYMVVGIV   53 (241)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

>cd01394 radB RadB

Probab=95.35  E-value=0.019  Score=41.47  Aligned_cols=32  Identities=16%  Similarity=-0.071  Sum_probs=22.9

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEe
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVV  125 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~V  125 (130)
                      |.|.+|+|||||+..+-....  ... ..++|+..
T Consensus        24 i~G~~GsGKT~l~~~~a~~~~--~~g-~~v~yi~~   55 (218)
T cd01394          24 VYGPPGTGKTNIAIQLAVETA--GQG-KKVAYIDT   55 (218)
T ss_pred             EECCCCCCHHHHHHHHHHHHH--hcC-CeEEEEEC
Confidence            999999999999999876542  122 34566643

The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.

>cd01866 Rab2 Rab2 subfamily

Probab=95.34  E-value=0.0099  Score=41.02  Aligned_cols=21  Identities=29%  Similarity=0.215  Sum_probs=18.1

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+-+.
T Consensus         7 i~vvG~~~vGKSsLl~~l~~~   27 (168)
T cd01866           7 YIIIGDTGVGKSCLLLQFTDK   27 (168)
T ss_pred             EEEECCCCCCHHHHHHHHHcC
Confidence            348999999999999998764

Rab2 is localized on cis-Golgi membranes and interacts with Golgi matrix proteins. Rab2 is also implicated in the maturation of vesicular tubular clusters (VTCs), which are microtubule-associated intermediates in transport between the ER and Golgi apparatus. In plants, Rab2 regulates vesicle trafficking between the ER and the Golgi bodies and is important to pollen tube growth. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key featur

>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein

Probab=95.34  E-value=0.0093  Score=44.08  Aligned_cols=20  Identities=30%  Similarity=0.220  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+..-.
T Consensus        32 i~G~nGsGKSTLl~~l~G~~   51 (247)
T TIGR00972        32 LIGPSGCGKSTLLRSLNRMN   51 (247)
T ss_pred             EECCCCCCHHHHHHHHhccC
Confidence            99999999999999997643

This model represents the ATP-binding protein of a family of ABC transporters for inorganic phosphate. In the model species Escherichia coli, a constitutive transporter for inorganic phosphate, with low affinity, is also present. The high affinity transporter that includes this polypeptide is induced when extracellular phosphate concentrations are low. The proteins most similar to the members of this family but not included appear to be amino acid transporters.

>cd04110 Rab35 Rab35 subfamily

Probab=95.34  E-value=0.0098  Score=42.49  Aligned_cols=20  Identities=30%  Similarity=0.250  Sum_probs=17.2

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|.+|+|||||+..+.+
T Consensus         9 ivvvG~~~vGKTsli~~l~~   28 (199)
T cd04110           9 LLIIGDSGVGKSSLLLRFAD   28 (199)
T ss_pred             EEEECCCCCCHHHHHHHHhc
Confidence            44999999999999988754

Rab35 is one of several Rab proteins to be found to participate in the regulation of osteoclast cells in rats. In addition, Rab35 has been identified as a protein that interacts with nucleophosmin-anaplastic lymphoma kinase (NPM-ALK) in human cells. Overexpression of NPM-ALK is a key oncogenic event in some anaplastic large-cell lymphomas; since Rab35 interacts with N|PM-ALK, it may provide a target for cancer treatments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is

>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional

Probab=95.33  E-value=0.0094  Score=47.65  Aligned_cols=20  Identities=35%  Similarity=0.320  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+.+..
T Consensus       224 I~G~~gsGKTTL~~~La~~~  243 (399)
T PRK08099        224 ILGGESSGKSTLVNKLANIF  243 (399)
T ss_pred             EEcCCCCCHHHHHHHHHHHh
Confidence            99999999999999988764

>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional

Probab=95.33  E-value=0.0098  Score=43.44  Aligned_cols=20  Identities=30%  Similarity=0.212  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+....
T Consensus        38 i~G~nGsGKSTLl~~l~G~~   57 (225)
T PRK10247         38 ITGPSGCGKSTLLKIVASLI   57 (225)
T ss_pred             EECCCCCCHHHHHHHHhccc
Confidence            99999999999999998754

>PF13479 AAA_24: AAA domain

Probab=95.32  E-value=0.0083  Score=43.69  Aligned_cols=17  Identities=29%  Similarity=0.378  Sum_probs=15.6

Q ss_pred             cccCcCCCchhHHHHhh
Q 042811           90 WPFGVEGVGKITSLSKS  106 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v  106 (130)
                      +|||-.|+||||||..+
T Consensus         7 lIyG~~G~GKTt~a~~~   23 (213)
T PF13479_consen    7 LIYGPPGSGKTTLAASL   23 (213)
T ss_pred             EEECCCCCCHHHHHHhC
Confidence            39999999999999986

>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake

Probab=95.31  E-value=0.0097  Score=43.81  Aligned_cols=20  Identities=30%  Similarity=0.308  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        52 i~G~NGsGKSTLl~~i~Gl~   71 (236)
T cd03267          52 FIGPNGAGKTTTLKILSGLL   71 (236)
T ss_pred             EECCCCCCHHHHHHHHhCCc
Confidence            99999999999999998754

NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.

>TIGR00101 ureG urease accessory protein UreG

Probab=95.30  E-value=0.01  Score=42.87  Aligned_cols=20  Identities=20%  Similarity=0.199  Sum_probs=17.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+.+..
T Consensus         6 i~G~~GsGKTTll~~l~~~l   25 (199)
T TIGR00101         6 VAGPVGSGKTALIEALTRAL   25 (199)
T ss_pred             EECCCCCCHHHHHHHHHHhh
Confidence            78999999999999887763

This model represents UreG, a GTP hydrolase that acts in the assembly of the nickel metallocenter of urease. It is found only in urease-positive species, although some urease-positive species (e.g. Bacillus subtilis) lack this protein. A similar protein, hypB, is an accessory protein for expression of hydrogenase, which also uses nickel.

>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos)

Probab=95.30  E-value=0.01  Score=41.97  Aligned_cols=20  Identities=15%  Similarity=0.091  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+....
T Consensus        31 i~G~nGsGKSTLl~~l~G~~   50 (182)
T cd03215          31 IAGLVGNGQTELAEALFGLR   50 (182)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis. In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains. However, it is assumed that two copies of the ABC domains are present in the assembled transporter.

>PRK14242 phosphate transporter ATP-binding protein; Provisional

Probab=95.29  E-value=0.0098  Score=44.06  Aligned_cols=19  Identities=32%  Similarity=0.223  Sum_probs=17.6

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|..|.|||||++.+..-
T Consensus        37 i~G~nGsGKSTLl~~l~Gl   55 (253)
T PRK14242         37 LIGPSGCGKSTFLRCLNRM   55 (253)
T ss_pred             EECCCCCCHHHHHHHHHhh
Confidence            9999999999999999863

>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning]

Probab=95.29  E-value=0.012  Score=42.91  Aligned_cols=20  Identities=40%  Similarity=0.363  Sum_probs=19.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|.+|.|||||+|.+|...
T Consensus        33 l~GpSGAGKSTllkLi~~~e   52 (223)
T COG2884          33 LTGPSGAGKSTLLKLIYGEE   52 (223)
T ss_pred             EECCCCCCHHHHHHHHHhhh
Confidence            99999999999999999977

>TIGR03689 pup_AAA proteasome ATPase

Probab=95.29  E-value=0.017  Score=47.59  Aligned_cols=20  Identities=20%  Similarity=0.275  Sum_probs=19.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+|||+||+.+.+..
T Consensus       221 LyGPPGTGKT~LAKAlA~eL  240 (512)
T TIGR03689       221 LYGPPGCGKTLIAKAVANSL  240 (512)
T ss_pred             EECCCCCcHHHHHHHHHHhh
Confidence            99999999999999999976

In the Actinobacteria, as shown for Mycobacterium tuberculosis, some proteins are modified by ligation between an epsilon-amino group of a lysine side chain and the C-terminal carboxylate of the ubiquitin-like protein Pup. This modification leads to protein degradation by the archaeal-like proteasome found in the Actinobacteria. Members of this protein family belong to the AAA family of ATPases and tend to be clustered with the genes for Pup, the Pup ligase PafA, and structural components of the proteasome. This protein forms hexameric rings with ATPase activity.

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA

Probab=95.29  E-value=0.0043  Score=53.05  Aligned_cols=32  Identities=19%  Similarity=0.150  Sum_probs=25.3

Q ss_pred             eeecccCCCCc------------cccCcCCCchhHHHHhhhhhh
Q 042811           79 KLGDVRRNGNN------------WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        79 ivG~~~~~~~l------------~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|++..++.+            .++|..|+||||||+.+.+..
T Consensus       184 ~igr~~ei~~~~~~L~~~~~~n~lL~G~pG~GKT~l~~~la~~~  227 (731)
T TIGR02639       184 LIGREDELERTIQVLCRRKKNNPLLVGEPGVGKTAIAEGLALRI  227 (731)
T ss_pred             ccCcHHHHHHHHHHHhcCCCCceEEECCCCCCHHHHHHHHHHHH
Confidence            58887643333            299999999999999998875

>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB

Probab=95.28  E-value=0.01  Score=41.58  Aligned_cols=21  Identities=19%  Similarity=0.039  Sum_probs=18.5

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        21 i~ivG~~~~GKStlin~l~~~   41 (179)
T TIGR03598        21 IAFAGRSNVGKSSLINALTNR   41 (179)
T ss_pred             EEEEcCCCCCHHHHHHHHhCC
Confidence            349999999999999998775

Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes.

>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor

Probab=95.28  E-value=0.01  Score=44.26  Aligned_cols=20  Identities=25%  Similarity=0.325  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|+|||||++.+....
T Consensus        30 i~G~NGsGKSTLlk~L~G~~   49 (246)
T cd03237          30 ILGPNGIGKTTFIKMLAGVL   49 (246)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998764

The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.

>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional

Probab=95.27  E-value=0.01  Score=43.86  Aligned_cols=20  Identities=30%  Similarity=0.126  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        34 i~G~nGsGKSTLl~~l~G~~   53 (250)
T PRK11264         34 IIGPSGSGKTTLLRCINLLE   53 (250)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999987653

>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.27  E-value=0.01  Score=43.97  Aligned_cols=18  Identities=33%  Similarity=0.244  Sum_probs=16.9

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |+|..|.|||||++.+..
T Consensus        34 i~G~nGsGKSTLl~~i~G   51 (250)
T PRK14245         34 FIGPSGCGKSTFLRLFNR   51 (250)
T ss_pred             EECCCCCCHHHHHHHHhh
Confidence            999999999999999964

>cd01868 Rab11_like Rab11-like

Probab=95.27  E-value=0.011  Score=40.41  Aligned_cols=21  Identities=33%  Similarity=0.284  Sum_probs=17.9

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|-+|+|||||++.+.+.
T Consensus         6 i~vvG~~~~GKSsli~~l~~~   26 (165)
T cd01868           6 IVLIGDSGVGKSNLLSRFTRN   26 (165)
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            348999999999999998654

Rab11a, Rab11b, and Rab25 are closely related, evolutionary conserved Rab proteins that are differentially expressed. Rab11a is ubiquitously synthesized, Rab11b is enriched in brain and heart and Rab25 is only found in epithelia. Rab11/25 proteins seem to regulate recycling pathways from endosomes to the plasma membrane and to the trans-Golgi network. Furthermore, Rab11a is thought to function in the histamine-induced fusion of tubulovesicles containing H+, K+ ATPase with the plasma membrane in gastric parietal cells and in insulin-stimulated insertion of GLUT4 in the plasma membrane of cardiomyocytes. Overexpression of Rab25 has recently been observed in ovarian cancer and breast cancer, and has been correlated with worsened outcomes in both diseases. In addition, Rab25 overexpression has also been observed in prostate cancer, transitional cell carcinoma of the bladder, and invasive breast tumor cells. GTPase activating proteins (GAPs) interact with GTP

>PRK00698 tmk thymidylate kinase; Validated

Probab=95.27  E-value=0.011  Score=41.98  Aligned_cols=20  Identities=25%  Similarity=0.313  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|.-|+||||+++.+.+..
T Consensus         8 ieG~~gsGKsT~~~~L~~~l   27 (205)
T PRK00698          8 IEGIDGAGKSTQIELLKELL   27 (205)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            88999999999999998865

>PRK00279 adk adenylate kinase; Reviewed

Probab=95.26  E-value=0.011  Score=42.86  Aligned_cols=20  Identities=25%  Similarity=0.086  Sum_probs=16.7

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      ++|.|..|+||||+++.+-.
T Consensus         3 I~v~G~pGsGKsT~a~~la~   22 (215)
T PRK00279          3 LILLGPPGAGKGTQAKFIAE   22 (215)
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            45899999999999998643

>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.26  E-value=0.01  Score=43.90  Aligned_cols=20  Identities=30%  Similarity=0.227  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|+|||||++.+....
T Consensus        34 i~G~nGsGKSTLl~~i~G~~   53 (250)
T PRK14247         34 LMGPSGSGKSTLLRVFNRLI   53 (250)
T ss_pred             EECCCCCCHHHHHHHHhccC
Confidence            99999999999999998754

>cd04118 Rab24 Rab24 subfamily

Probab=95.26  E-value=0.011  Score=41.66  Aligned_cols=20  Identities=25%  Similarity=0.273  Sum_probs=16.6

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|-+|+|||||+..+.+
T Consensus         3 i~vvG~~~vGKSsLi~~~~~   22 (193)
T cd04118           3 VVMLGKESVGKTSLVERYVH   22 (193)
T ss_pred             EEEECCCCCCHHHHHHHHHh
Confidence            34789999999999988653

Rab24 is distinct from other Rabs in several ways. It exists primarily in the GTP-bound state, having a low intrinsic GTPase activity; it is not efficiently geranyl-geranylated at the C-terminus; it does not form a detectable complex with Rab GDP-dissociation inhibitors (GDIs); and it has recently been shown to undergo tyrosine phosphorylation when overexpressed in vitro. The specific function of Rab24 still remains unknown. It is found in a transport route between ER-cis-Golgi and late endocytic compartments. It is putatively involved in an autophagic pathway, possibly directing misfolded proteins in the ER to degradative pathways. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilita

>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional

Probab=95.25  E-value=0.01  Score=44.49  Aligned_cols=20  Identities=30%  Similarity=0.122  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+....
T Consensus        43 I~G~NGsGKSTLlk~l~Gl~   62 (257)
T PRK11247         43 VVGRSGCGKSTLLRLLAGLE   62 (257)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999998754

>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily

Probab=95.25  E-value=0.011  Score=42.25  Aligned_cols=19  Identities=26%  Similarity=0.330  Sum_probs=16.1

Q ss_pred             ccccCcCCCchhHHHHhhh
Q 042811           89 NWPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~  107 (130)
                      +.|+|..|+|||||++.+-
T Consensus         3 ivivG~~~vGKTsli~~l~   21 (201)
T cd04107           3 VLVIGDLGVGKTSIIKRYV   21 (201)
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            3478999999999999754

Rab32 and Rab38 are members of the Rab family of small GTPases. Human Rab32 was first identified in platelets but it is expressed in a variety of cell types, where it functions as an A-kinase anchoring protein (AKAP). Rab38 has been shown to be melanocyte-specific. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)

Probab=95.25  E-value=0.011  Score=41.15  Aligned_cols=20  Identities=25%  Similarity=0.300  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        31 l~G~nGsGKSTLl~~i~G~~   50 (163)
T cd03216          31 LLGENGAGKSTLMKILSGLY   50 (163)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis. Pentoses include xylose, arabinose, and ribose. Important hexoses include glucose, galactose, and fructose. In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains. However, it is assumed that two copies of the ABC domains are present in the assembled transporter.

>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism]

Probab=95.24  E-value=0.01  Score=42.26  Aligned_cols=19  Identities=47%  Similarity=0.553  Sum_probs=16.5

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|+||||+.+.+-..
T Consensus         9 itGVpGvGKTTVl~~~~~~   27 (189)
T COG2019           9 ITGVPGVGKTTVLKIALKE   27 (189)
T ss_pred             EEcCCCCChHHHHHHHHHH
Confidence            8999999999999876554

>PRK10908 cell division protein FtsE; Provisional

Probab=95.24  E-value=0.011  Score=42.99  Aligned_cols=20  Identities=30%  Similarity=0.117  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|+|||||++.+....
T Consensus        33 i~G~nGsGKSTLl~~l~G~~   52 (222)
T PRK10908         33 LTGHSGAGKSTLLKLICGIE   52 (222)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999997754

>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE

Probab=95.24  E-value=0.011  Score=43.22  Aligned_cols=20  Identities=35%  Similarity=0.414  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        31 l~G~nGsGKSTLl~~l~G~~   50 (230)
T TIGR03410        31 VLGRNGVGKTTLLKTLMGLL   50 (230)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.

>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional

Probab=95.24  E-value=0.01  Score=43.93  Aligned_cols=20  Identities=25%  Similarity=0.293  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+..-.
T Consensus        36 l~G~nGsGKSTLl~~l~Gl~   55 (255)
T PRK11300         36 LIGPNGAGKTTVFNCLTGFY   55 (255)
T ss_pred             EECCCCCCHHHHHHHHhCCc
Confidence            99999999999999998754

>PRK13540 cytochrome c biogenesis protein CcmA; Provisional

Probab=95.24  E-value=0.011  Score=42.36  Aligned_cols=20  Identities=30%  Similarity=0.215  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        32 l~G~nGsGKSTLl~~i~G~~   51 (200)
T PRK13540         32 LKGSNGAGKTTLLKLIAGLL   51 (200)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999998764

>cd04163 Era Era subfamily

Probab=95.23  E-value=0.011  Score=39.59  Aligned_cols=19  Identities=32%  Similarity=0.268  Sum_probs=16.9

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|..|+|||||+..+.+.
T Consensus         8 ~~G~~g~GKttl~~~l~~~   26 (168)
T cd04163           8 IVGRPNVGKSTLLNALVGQ   26 (168)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            7899999999999997654

Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria. It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA. It also contacts several assembly elements of the 30S subunit. Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism. Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding. Both domains are important for Era function. Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA.

>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional

Probab=95.22  E-value=0.01  Score=45.45  Aligned_cols=19  Identities=26%  Similarity=0.265  Sum_probs=16.8

Q ss_pred             ccccCcCCCchhHHHHhhh
Q 042811           89 NWPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~  107 (130)
                      +.|.|+.|+||||+++.+.
T Consensus         9 i~i~G~~GsGKtt~~~~l~   27 (288)
T PRK05416          9 VIVTGLSGAGKSVALRALE   27 (288)
T ss_pred             EEEECCCCCcHHHHHHHHH
Confidence            4499999999999999874

>cd04103 Centaurin_gamma Centaurin gamma

Probab=95.22  E-value=0.011  Score=40.82  Aligned_cols=17  Identities=18%  Similarity=0.042  Sum_probs=14.8

Q ss_pred             cccCcCCCchhHHHHhh
Q 042811           90 WPFGVEGVGKITSLSKS  106 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v  106 (130)
                      .++|.+|+|||||++..
T Consensus         4 ~vvG~~gvGKTsli~~~   20 (158)
T cd04103           4 GIVGNLQSGKSALVHRY   20 (158)
T ss_pred             EEECCCCCcHHHHHHHH
Confidence            47899999999999864

The centaurins (alpha, beta, gamma, and delta) are large, multi-domain proteins that all contain an ArfGAP domain and ankyrin repeats, and in some cases, numerous additional domains. Centaurin gamma contains an additional GTPase domain near its N-terminus. The specific function of this GTPase domain has not been well characterized, but centaurin gamma 2 (CENTG2) may play a role in the development of autism. Centaurin gamma 1 is also called PIKE (phosphatidyl inositol (PI) 3-kinase enhancer) and centaurin gamma 2 is also known as AGAP (ArfGAP protein with a GTPase-like domain, ankyrin repeats and a Pleckstrin homology domain) or GGAP. Three isoforms of PIKE have been identified. PIKE-S (short) and PIKE-L (long) are brain-specific isoforms, with PIKE-S restricted to the nucleus and PIKE-L found in multiple cellular compartments. A third isoform, PIKE-A was identified in human glioblastoma brain cancers and has been found in various tissues.

>PRK13231 nitrogenase reductase-like protein; Reviewed

Probab=95.21  E-value=0.011  Score=44.22  Aligned_cols=19  Identities=32%  Similarity=0.524  Sum_probs=15.4

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|-||+||||++.++-..
T Consensus         7 v~~KGGvGKTT~a~nLA~~   25 (264)
T PRK13231          7 IYGKGGIGKSTTVSNMAAA   25 (264)
T ss_pred             EECCCCCcHHHHHHHHhcc
Confidence            5589999999998886543

>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain

Probab=95.21  E-value=0.011  Score=41.40  Aligned_cols=20  Identities=25%  Similarity=0.164  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+....
T Consensus        33 i~G~nGsGKStLl~~l~G~~   52 (173)
T cd03246          33 IIGPSGSGKSTLARLILGLL   52 (173)
T ss_pred             EECCCCCCHHHHHHHHHhcc
Confidence            99999999999999998754

They export degradative enzymes by using a type I protein secretion system and lack an N-terminal signal peptide, but contain a C-terminal secretion signal. The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP). For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli. The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior. HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels. The spectrum of transport substra

>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases

Probab=95.21  E-value=0.01  Score=41.77  Aligned_cols=21  Identities=29%  Similarity=0.381  Sum_probs=18.2

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|.|..|+|||||++.+.+.
T Consensus        17 ililGl~~sGKTtll~~l~~~   37 (175)
T PF00025_consen   17 ILILGLDGSGKTTLLNRLKNG   37 (175)
T ss_dssp             EEEEESTTSSHHHHHHHHHSS
T ss_pred             EEEECCCccchHHHHHHhhhc
Confidence            349999999999999998764

This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including: Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain. This entry represents a branch of the small GTPase superfamily that includes the ADP ribosylation factor Arf, Arl (Arf-like), Arp (Arf-related proteins) and the remotely related Sar (Secretion-associated and Ras-related) proteins. Arf proteins are major regulators of vesicle biogenesis in intracellular traffic []. They cycle between inactive GDP-bound and active GTP-bound forms that bind selectively to effectors. The classical structural GDP/GTP switch is characterised by conformational changes at the so-called switch 1 and switch 2 regions, which bind tightly to the gamma-phosphate of GTP but poorly or not at all to the GDP nucleotide. Structural studies of Arf1 and Arf6 have revealed that although these proteins feature the switch 1 and 2 conformational changes, they depart from other small GTP-binding proteins in that they use an additional, unique switch to propagate structural information from one side of the protein to the other. The GDP/GTP structural cycles of human Arf1 and Arf6 feature a unique conformational change that affects the beta2-beta3 strands connecting switch 1 and switch 2 (interswitch) and also the amphipathic helical N terminus. In GDP-bound Arf1 and Arf6, the interswitch is retracted and forms a pocket to which the N-terminal helix binds, the latter serving as a molecular hasp to maintain the inactive conformation. In the GTP-bound form of these proteins, the interswitch undergoes a two-residue register shift that pulls switch 1 and switch 2 up, restoring an active conformation that can bind GTP. In this conformation, the interswitch projects out of the protein and extrudes the N-terminal hasp by occluding its binding pocket.; GO: 0005525 GTP binding; PDB: 2H57_B 2W83_B 3N5C_B 2J5X_A 3LVR_E 2BAO_A 3LVQ_E 2A5F_A 3PCR_B 1E0S_A ....

>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily

Probab=95.21  E-value=0.012  Score=40.73  Aligned_cols=21  Identities=19%  Similarity=0.075  Sum_probs=17.4

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.++|-+|+|||||+..+...
T Consensus         5 i~vvG~~~vGKTsli~~~~~~   25 (170)
T cd04115           5 IIVIGDSNVGKTCLTYRFCAG   25 (170)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            348999999999999987543

Rab33B is ubiquitously expressed in mouse tissues and cells, where it is localized to the medial Golgi cisternae. It colocalizes with alpha-mannose II. Together with the other cisternal Rabs, Rab6A and Rab6A', it is believed to regulate the Golgi response to stress and is likely a molecular target in stress-activated signaling pathways. Rab33A (previously known as S10) is expressed primarily in the brain and immune system cells. In humans, it is located on the X chromosome at Xq26 and its expression is down-regulated in tuberculosis patients. Experimental evidence suggests that Rab33A is a novel CD8+ T cell factor that likely plays a role in tuberculosis disease processes. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine

>PRK14241 phosphate transporter ATP-binding protein; Provisional

Probab=95.20  E-value=0.011  Score=44.05  Aligned_cols=20  Identities=30%  Similarity=0.263  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+....
T Consensus        35 i~G~nGsGKSTLl~~laGl~   54 (258)
T PRK14241         35 FIGPSGCGKSTVLRTLNRMH   54 (258)
T ss_pred             EECCCCCCHHHHHHHHhccC
Confidence            99999999999999998754

>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity

Probab=95.20  E-value=0.011  Score=41.33  Aligned_cols=20  Identities=25%  Similarity=0.306  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+....
T Consensus        31 i~G~nGsGKStLl~~l~G~~   50 (173)
T cd03230          31 LLGPNGAGKTTLIKIILGLL   50 (173)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins. Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family. The ATP-binding domain shows the highest similarity between all members of the ABC transporter family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PTZ00132 GTP-binding nuclear protein Ran; Provisional

Probab=95.20  E-value=0.011  Score=42.66  Aligned_cols=21  Identities=38%  Similarity=0.403  Sum_probs=16.8

Q ss_pred             cccCcCCCchhHHHH-hhhhhh
Q 042811           90 WPFGVEGVGKITSLS-KSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak-~v~~~~  110 (130)
                      .|+|-.|+|||||+. .+.+.+
T Consensus        13 ~liG~~g~GKTtLi~~~~~~~~   34 (215)
T PTZ00132         13 ILVGDGGVGKTTFVKRHLTGEF   34 (215)
T ss_pred             EEECCCCCCHHHHHHHHHhCCC
Confidence            499999999999994 565543

>PRK13233 nifH nitrogenase reductase; Reviewed

Probab=95.20  E-value=0.01  Score=44.55  Aligned_cols=20  Identities=25%  Similarity=0.488  Sum_probs=15.6

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-|||||||++-++---.
T Consensus         7 v~~KGGVGKTT~a~nLA~~L   26 (275)
T PRK13233          7 IYGKGGIGKSTTTQNTAAAM   26 (275)
T ss_pred             EEcCCCCcHHHHHHHHHHHH
Confidence            55899999999988765443

>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases

Probab=95.20  E-value=0.012  Score=41.60  Aligned_cols=21  Identities=24%  Similarity=0.254  Sum_probs=18.0

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||++.+...
T Consensus        20 i~ivG~~~~GKTsli~~l~~~   40 (184)
T smart00178       20 ILFLGLDNAGKTTLLHMLKND   40 (184)
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            349999999999999988664

Yeast SAR1 is an essential gene required for transport of secretory proteins from the endoplasmic reticulum to the Golgi apparatus.

>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases

Probab=95.19  E-value=0.012  Score=40.74  Aligned_cols=19  Identities=26%  Similarity=0.265  Sum_probs=16.2

Q ss_pred             ccccCcCCCchhHHHHhhh
Q 042811           89 NWPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~  107 (130)
                      +.|+|..|+|||||+..+.
T Consensus         3 i~vvG~~~vGKTsli~~~~   21 (166)
T cd00877           3 LVLVGDGGTGKTTFVKRHL   21 (166)
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            3478999999999998863

Ran GTPase is involved in diverse biological functions, such as nuclear transport, spindle formation during mitosis, DNA replication, and cell division. Among the Ras superfamily, Ran is a unique small G protein. It does not have a lipid modification motif at the C-terminus to bind to the membrane, which is often observed within the Ras superfamily. Ran may therefore interact with a wide range of proteins in various intracellular locations. Like other GTPases, Ran exists in GTP- and GDP-bound conformations that interact differently with effectors. Conversion between these forms and the assembly or disassembly of effector complexes requires the interaction of regulator proteins. The intrinsic GTPase activity of Ran is very low, but it is greatly stimulated by a GTPase-activating protein (RanGAP1) located in the cytoplasm. By contrast, RCC1, a guanine nucleotide exchange factor that generates RanGTP, is

>cd04149 Arf6 Arf6 subfamily

Probab=95.19  E-value=0.011  Score=41.06  Aligned_cols=19  Identities=32%  Similarity=0.331  Sum_probs=16.7

Q ss_pred             ccccCcCCCchhHHHHhhh
Q 042811           89 NWPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~  107 (130)
                      +.|+|.+|+|||||+..+.
T Consensus        12 v~i~G~~~~GKTsli~~l~   30 (168)
T cd04149          12 ILMLGLDAAGKTTILYKLK   30 (168)
T ss_pred             EEEECcCCCCHHHHHHHHc
Confidence            4499999999999998874

Arf6 (ADP ribosylation factor 6) proteins localize to the plasma membrane, where they perform a wide variety of functions. In its active, GTP-bound form, Arf6 is involved in cell spreading, Rac-induced formation of plasma membrane ruffles, cell migration, wound healing, and Fc-mediated phagocytosis. Arf6 appears to change the actin structure at the plasma membrane by activating Rac, a Rho family protein involved in membrane ruffling. Arf6 is required for and enhances Rac formation of ruffles. Arf6 can regulate dendritic branching in hippocampal neurons, and in yeast it localizes to the growing bud, where it plays a role in polarized growth and bud site selection. In leukocytes, Arf6 is required for chemokine-stimulated migration across endothelial cells. Arf6 also plays a role in down-regulation of beta2-adrenergic receptors and luteinizing hormone receptors by facilitating the release of sequestered arrestin to allow endocytosis. Arf6 is believed t

>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans

Probab=95.19  E-value=0.011  Score=40.34  Aligned_cols=21  Identities=24%  Similarity=0.109  Sum_probs=17.8

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus         3 i~~~G~~~~GKssli~~l~~~   23 (168)
T cd01897           3 LVIAGYPNVGKSSLVNKLTRA   23 (168)
T ss_pred             EEEEcCCCCCHHHHHHHHhcC
Confidence            347899999999999998664

NOG1 is functionally linked to ribosome biogenesis and found in association with the nuclear pore complexes and identified in many preribosomal complexes. Thus, defects in NOG1 can lead to defects in 60S biogenesis. The S. cerevisiae NOG1 gene is essential for cell viability, and mutations in the predicted G motifs abrogate function. It is a member of the ODN family of GTP-binding proteins that also includes the bacterial Obg and DRG proteins.

>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL

Probab=95.18  E-value=0.011  Score=42.86  Aligned_cols=20  Identities=35%  Similarity=0.521  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|.|||||++.+....
T Consensus        39 l~G~nGsGKSTLl~~i~G~~   58 (224)
T TIGR02324        39 LSGPSGAGKSTLLKSLYANY   58 (224)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998764

Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lysase complex. This protein (PhnL) and the adjacent-encoded PhnK (TIGR02323) resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se.

>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters

Probab=95.18  E-value=0.012  Score=42.04  Aligned_cols=19  Identities=32%  Similarity=0.314  Sum_probs=17.7

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|-.|.|||||++.+...
T Consensus        38 l~G~nGsGKSTLl~~l~G~   56 (192)
T cd03232          38 LMGESGAGKTTLLDVLAGR   56 (192)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            9999999999999999863

PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. This PDR subfamily represents domain I of its (ABC-IM)2 organization. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK04213 GTP-binding protein; Provisional

Probab=95.18  E-value=0.012  Score=41.88  Aligned_cols=21  Identities=24%  Similarity=0.102  Sum_probs=18.2

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        12 i~i~G~~~~GKSsLin~l~~~   32 (201)
T PRK04213         12 IVFVGRSNVGKSTLVRELTGK   32 (201)
T ss_pred             EEEECCCCCCHHHHHHHHhCC
Confidence            449999999999999998764

>PTZ00133 ADP-ribosylation factor; Provisional

Probab=95.18  E-value=0.011  Score=41.69  Aligned_cols=20  Identities=30%  Similarity=0.245  Sum_probs=17.3

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.++|.+|+|||||+..+..
T Consensus        20 v~lvG~~~vGKTsli~~~~~   39 (182)
T PTZ00133         20 ILMVGLDAAGKTTILYKLKL   39 (182)
T ss_pred             EEEEcCCCCCHHHHHHHHhc
Confidence            44999999999999999843

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]

Probab=95.18  E-value=0.01  Score=42.89  Aligned_cols=20  Identities=35%  Similarity=0.521  Sum_probs=16.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+||||.+-++....
T Consensus         6 lvGptGvGKTTt~aKLAa~~   25 (196)
T PF00448_consen    6 LVGPTGVGKTTTIAKLAARL   25 (196)
T ss_dssp             EEESTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCchHhHHHHHHHHH
Confidence            78999999999888775544

SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. This entry represents the GTPase domain of the 54 kDa SRP54 component, a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 of the signal recognition particle has a three-domain structure: an N-terminal helical bundle domain, a GTPase domain, and the M-domain that binds the 7s RNA and also binds the signal sequence. The extreme C-terminal region is glycine-rich and lower in complexity and poorly conserved between species. The GTPase domain is evolutionary related to P-loop NTPase domains found in a variety of other proteins []. These proteins include Escherichia coli and Bacillus subtilis ffh protein (P48), which seems to be the prokaryotic counterpart of SRP54; signal recognition particle receptor alpha subunit (docking protein), an integral membrane GTP-binding protein which ensures, in conjunction with SRP, the correct targeting of nascent secretory proteins to the endoplasmic reticulum membrane; bacterial FtsY protein, which is believed to play a similar role to that of the docking protein in eukaryotes; the pilA protein from Neisseria gonorrhoeae, the homologue of ftsY; and bacterial flagellar biosynthesis protein flhF.; GO: 0005525 GTP binding, 0006614 SRP-dependent cotranslational protein targeting to membrane; PDB: 2OG2_A 3B9Q_A 3DM9_B 3DMD_B 3E70_C 3DM5_B 2XXA_C 2J28_9 1ZU5_B 1ZU4_A ....

>cd04135 Tc10 TC10 subfamily

Probab=95.17  E-value=0.012  Score=40.52  Aligned_cols=18  Identities=28%  Similarity=0.152  Sum_probs=15.4

Q ss_pred             ccccCcCCCchhHHHHhh
Q 042811           89 NWPFGVEGVGKITSLSKS  106 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v  106 (130)
                      +.|+|-+|+|||||+..+
T Consensus         3 i~i~G~~~~GKTsl~~~~   20 (174)
T cd04135           3 CVVVGDGAVGKTCLLMSY   20 (174)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            347899999999999775

TC10 is a Rho family protein that has been shown to induce microspike formation and neurite outgrowth in vitro. Its expression changes dramatically after peripheral nerve injury, suggesting an important role in promoting axonal outgrowth and regeneration. TC10 regulates translocation of insulin-stimulated GLUT4 in adipocytes and has also been shown to bind directly to Golgi COPI coat proteins. GTP-bound TC10 in vitro can bind numerous potential effectors. Depending on its subcellular localization and distinct functional domains, TC10 can differentially regulate two types of filamentous actin in adipocytes. TC10 mRNAs are highly expressed in three types of mouse muscle tissues: leg skeletal muscle, cardiac muscle, and uterus; they were also present in brain, with higher levels in adults than in newborns. TC10 has also been shown to play a role in regulating the expression of cystic fibrosis transmembrane conductance regulator (CFTR) through interacti

>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.17  E-value=0.011  Score=44.27  Aligned_cols=18  Identities=33%  Similarity=0.331  Sum_probs=17.1

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |.|..|.|||||++.+..
T Consensus        52 i~G~nGsGKSTLl~~l~G   69 (268)
T PRK14248         52 LIGPSGCGKSTFLRSINR   69 (268)
T ss_pred             EECCCCCCHHHHHHHHHh
Confidence            999999999999999976

>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional

Probab=95.17  E-value=0.011  Score=43.93  Aligned_cols=20  Identities=30%  Similarity=0.348  Sum_probs=18.6

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        37 i~G~nGsGKSTLl~~l~Gl~   56 (258)
T PRK11701         37 IVGESGSGKTTLLNALSARL   56 (258)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998864

>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional

Probab=95.17  E-value=0.011  Score=44.36  Aligned_cols=20  Identities=30%  Similarity=0.340  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+....
T Consensus        38 i~G~nGsGKSTLl~~l~Gl~   57 (269)
T PRK11831         38 IMGPSGIGKTTLLRLIGGQI   57 (269)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B

Probab=95.17  E-value=0.025  Score=41.18  Aligned_cols=35  Identities=14%  Similarity=-0.098  Sum_probs=25.0

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccC----CCCeEEEEEeC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEG----IFLIKMHDVVR  126 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~----~Fd~~~wv~VS  126 (130)
                      |+|-.|+|||||+..+.-.. ....    .-..++|++-.
T Consensus        24 i~G~~GsGKT~l~~~l~~~~-~~~~~~~g~~~~viyi~~e   62 (235)
T cd01123          24 IFGEFGSGKTQLCHQLAVTV-QLPIELGGLEGKAVYIDTE   62 (235)
T ss_pred             EECCCCCCHHHHHHHHHHHe-eCccccCCCCccEEEEeCC
Confidence            99999999999999985333 1111    13578888755

This group of recombinases includes the eukaryotic proteins RAD51, RAD55/57 and the meiosis-specific protein DMC1, and the archaeal proteins radA and radB. They are closely related to the bacterial RecA group. Rad51 proteins catalyze a similiar recombination reaction as RecA, using ATP-dependent DNA binding activity and a DNA-dependent ATPase. However, this reaction is less efficient and requires accessory proteins such as RAD55/57 .

>PRK13235 nifH nitrogenase reductase; Reviewed

Probab=95.17  E-value=0.011  Score=44.50  Aligned_cols=17  Identities=29%  Similarity=0.558  Sum_probs=13.9

Q ss_pred             ccCcCCCchhHHHHhhh
Q 042811           91 PFGVEGVGKITSLSKSY  107 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~  107 (130)
                      |+|-|||||||++-++-
T Consensus         6 v~~KGGVGKTT~~~nLA   22 (274)
T PRK13235          6 IYGKGGIGKSTTTQNTV   22 (274)
T ss_pred             EeCCCCccHHHHHHHHH
Confidence            55899999999877653

>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only]

Probab=95.17  E-value=0.13  Score=42.87  Aligned_cols=104  Identities=15%  Similarity=0.168  Sum_probs=0.0

Q ss_pred             chHHHHHHHHHHHHHHHHHhhh--ccCccCCchhhhHHHHHHHHHHHHHHHHHhccCcccccc------------cCCcc
Q 042811            3 RLHKIQMGLTRVQALETEVDNL--GGYYFMNCKSSYEFGKKLAKKLQVLANLKEEENYEDVAD------------RLSED   68 (130)
Q Consensus         3 ~~~~v~~Wl~~v~~~~~e~edi--~~~~~~~~~~~~~i~k~i~~~~~~i~~l~~~~~~~~~~~------------~~~~~   68 (130)
                      ...+++.|.++=+++..-=+=|  .+.|.      -..++++..+...++.+..++-...+..            ..|+|
T Consensus       315 ~~~q~K~~~kqqk~i~~~K~~ia~~g~g~------a~~~rka~s~~K~~~km~~~gL~ek~~~~k~l~~~f~~vg~~p~p  388 (614)
T KOG0927|consen  315 EENQMKAYEKQQKQIAHMKDLIARFGHGS------AKLGRKAQSKEKTLDKMEADGLTEKVVGEKVLSFRFPEVGKIPPP  388 (614)
T ss_pred             hHHHHHHHHHHHhHHHHhhHHHHhhcccc------hhhhHHHhhhhhhHHHHhhccccccccCCceEEEEcccccCCCCC


Q ss_pred             cccccCCCCceeecccCCCCcc--------------ccCcCCCchhHHHHhhhhhhhhccCC
Q 042811           69 SVDDRPVETTKLGDVRRNGNNW--------------PFGVEGVGKITSLSKSYPEFLEDEGI  116 (130)
Q Consensus        69 ~~~~~~~~~~ivG~~~~~~~l~--------------I~GmGGvGKTTLak~v~~~~~~~~~~  116 (130)
                      .+--   +..-+|.+... .+-              ++|..|+|||||+|.++.+.....++
T Consensus       389 vi~~---~nv~F~y~~~~-~iy~~l~fgid~~srvAlVGPNG~GKsTLlKl~~gdl~p~~G~  446 (614)
T KOG0927|consen  389 VIMV---QNVSFGYSDNP-MIYKKLNFGIDLDSRVALVGPNGAGKSTLLKLITGDLQPTIGM  446 (614)
T ss_pred             eEEE---eccccCCCCcc-hhhhhhhcccCcccceeEecCCCCchhhhHHHHhhcccccccc

>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria

Probab=95.16  E-value=0.012  Score=43.14  Aligned_cols=20  Identities=30%  Similarity=0.365  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        32 l~G~nGsGKSTLl~~i~Gl~   51 (236)
T cd03253          32 IVGPSGSGKSTILRLLFRFY   51 (236)
T ss_pred             EECCCCCCHHHHHHHHhccc
Confidence            99999999999999998754

Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>TIGR00554 panK_bact pantothenate kinase, bacterial type

Probab=95.16  E-value=0.011  Score=45.33  Aligned_cols=20  Identities=25%  Similarity=0.117  Sum_probs=17.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|+||||||+.+-.-.
T Consensus        67 IaG~~GSGKSTlar~L~~ll   86 (290)
T TIGR00554        67 IAGSVAVGKSTTARILQALL   86 (290)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            78999999999998875544

Shown to be a homodimer in E. coli. This enzyme catalyzes the rate-limiting step in the biosynthesis of coenzyme A. It is very well conserved from E. coli to B. subtilis, but differs considerably from known eukaryotic forms, described in a separate model.

>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=95.16  E-value=0.011  Score=44.34  Aligned_cols=20  Identities=25%  Similarity=0.258  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|+|||||++.+....
T Consensus        32 i~G~nGsGKSTLl~~l~Gl~   51 (271)
T PRK13638         32 LVGANGCGKSTLFMNLSGLL   51 (271)
T ss_pred             EECCCCCCHHHHHHHHcCCC
Confidence            99999999999999997754

>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional

Probab=95.15  E-value=0.011  Score=44.03  Aligned_cols=20  Identities=30%  Similarity=0.320  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        44 i~G~nGsGKSTLl~~l~Gl~   63 (260)
T PRK10744         44 FIGPSGCGKSTLLRTFNRMY   63 (260)
T ss_pred             EECCCCCCHHHHHHHHhccc
Confidence            99999999999999997653

>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains

Probab=95.15  E-value=0.012  Score=42.61  Aligned_cols=17  Identities=29%  Similarity=0.364  Sum_probs=16.1

Q ss_pred             ccCcCCCchhHHHHhhh
Q 042811           91 PFGVEGVGKITSLSKSY  107 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~  107 (130)
                      |+|..|.|||||+..|+
T Consensus        27 i~G~NGsGKTTLl~ai~   43 (204)
T cd03240          27 IVGQNGAGKTTIIEALK   43 (204)
T ss_pred             EECCCCCCHHHHHHHHH
Confidence            99999999999999984

The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence. This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.

>PRK06851 hypothetical protein; Provisional

Probab=95.15  E-value=0.021  Score=45.24  Aligned_cols=34  Identities=26%  Similarity=0.218  Sum_probs=28.4

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR  126 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS  126 (130)
                      |-|..|+|||||++.+.+.. . ...|++-.+.|-+
T Consensus        35 l~G~pGtGKStl~~~i~~~~-~-~~g~~Ve~~~~~~   68 (367)
T PRK06851         35 LKGGPGTGKSTLMKKIGEEF-L-EKGYDVEFLHCSS   68 (367)
T ss_pred             EECCCCCCHHHHHHHHHHHH-H-HcCCeEEEEEcCC
Confidence            99999999999999999987 3 2468877777766

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome

Probab=95.15  E-value=0.012  Score=41.08  Aligned_cols=20  Identities=20%  Similarity=0.177  Sum_probs=18.6

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        32 i~G~nGsGKSTLl~~l~G~~   51 (166)
T cd03223          32 ITGPSGTGKSSLFRALAGLW   51 (166)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999998864

The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation. To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes. X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family. The disease is characterized by a striking and unpredictable variation in phenotypic expression. Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt

>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA

Probab=95.15  E-value=0.012  Score=42.02  Aligned_cols=20  Identities=30%  Similarity=0.268  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        31 i~G~nGsGKSTLl~~l~G~~   50 (198)
T TIGR01189        31 VTGPNGIGKTTLLRILAGLL   50 (198)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999997754

This model describes the cyt c biogenesis protein encoded by ccmA in bacteria. An exception is, an arabidopsis protein. Quite likely this is encoded by an organelle. Bacterial c-type cytocromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c.

>cd04125 RabA_like RabA-like subfamily

Probab=95.15  E-value=0.012  Score=41.38  Aligned_cols=21  Identities=29%  Similarity=0.260  Sum_probs=17.1

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.++|.+|+|||||+..+.+.
T Consensus         3 i~v~G~~~vGKSsli~~~~~~   23 (188)
T cd04125           3 VVIIGDYGVGKSSLLKRFTED   23 (188)
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            347899999999999986543

RabA was first identified in D. discoideum, where its expression levels were compared to other Rabs in growing and developing cells. The RabA mRNA levels were below the level of detection by Northern blot analysis, suggesting a very low level of expression. The function of RabA remains unknown. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.

>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily

Probab=95.14  E-value=0.012  Score=41.08  Aligned_cols=18  Identities=28%  Similarity=0.255  Sum_probs=15.3

Q ss_pred             ccccCcCCCchhHHHHhh
Q 042811           89 NWPFGVEGVGKITSLSKS  106 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v  106 (130)
                      +.|+|-.|+|||||+...
T Consensus         5 i~vvG~~~vGKTsL~~~~   22 (172)
T cd04141           5 IVMLGAGGVGKSAVTMQF   22 (172)
T ss_pred             EEEECCCCCcHHHHHHHH
Confidence            348999999999999665

Rit (Ras-like protein in all tissues), Rin (Ras-like protein in neurons) and Ric (Ras-related protein which interacts with calmodulin) form a subfamily with several unique structural and functional characteristics. These proteins all lack a the C-terminal CaaX lipid-binding motif typical of Ras family proteins, and Rin and Ric contain calmodulin-binding domains. Rin, which is expressed only in neurons, induces neurite outgrowth in rat pheochromocytoma cells through its association with calmodulin and its activation of endogenous Rac/cdc42. Rit, which is ubiquitously expressed in mammals, inhibits growth-factor withdrawl-mediated apoptosis and induces neurite extension in pheochromocytoma cells. Rit and Rin are both able to form a ternary complex with PAR6, a cell polarity-regulating protein, and Rac/cdc42. This ternary complex is proposed to have physiological function in processes such as tumorigenesis. Activated Ric is likely to sign

>PHA02544 44 clamp loader, small subunit; Provisional

Probab=95.14  E-value=0.012  Score=44.88  Aligned_cols=20  Identities=25%  Similarity=0.152  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+||||||+.+.+..
T Consensus        48 l~G~~G~GKT~la~~l~~~~   67 (316)
T PHA02544         48 HSPSPGTGKTTVAKALCNEV   67 (316)
T ss_pred             eeCcCCCCHHHHHHHHHHHh
Confidence            69999999999999998854

>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell

Probab=95.14  E-value=0.012  Score=40.81  Aligned_cols=16  Identities=38%  Similarity=0.397  Sum_probs=13.3

Q ss_pred             cCcCCCchhHHHHhhh
Q 042811           92 FGVEGVGKITSLSKSY  107 (130)
Q Consensus        92 ~GmGGvGKTTLak~v~  107 (130)
                      -+.||+||||++-.+-
T Consensus         6 ~~kgG~GKtt~a~~la   21 (179)
T cd02036           6 SGKGGVGKTTTTANLG   21 (179)
T ss_pred             eCCCCCCHHHHHHHHH
Confidence            4689999999988763

The site is determined by the min operon products MinC, MinD and MinE. MinC is a nonspecific inhibitor of the septum protein FtsZ. MinE is the supressor of MinC. MinD plays a pivotal role, selecting the mid-cell over other sites through the activation and regulation of MinC and MinE. MinD is a membrane-associated ATPase, related to nitrogenase iron protein. More distantly related proteins include flagellar biosynthesis proteins and ParA chromosome partitioning proteins. MinD is a monomer.

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases

Probab=95.14  E-value=0.013  Score=41.74  Aligned_cols=21  Identities=29%  Similarity=0.194  Sum_probs=17.9

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|-.|+|||||++.+..-.
T Consensus        29 ~I~G~tGSGKTTll~aL~~~i   49 (186)
T cd01130          29 LISGGTGSGKTTLLNALLAFI   49 (186)
T ss_pred             EEECCCCCCHHHHHHHHHhhc
Confidence            399999999999999887643

The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB. This alignment contains the C-terminal domain, which is the ATPase.

>cd04106 Rab23_lke Rab23-like subfamily

Probab=95.14  E-value=0.012  Score=39.83  Aligned_cols=20  Identities=20%  Similarity=0.185  Sum_probs=17.2

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|..|+|||||+..+.+
T Consensus         3 v~~vG~~~~GKTsl~~~~~~   22 (162)
T cd04106           3 VIVVGNGNVGKSSMIQRFVK   22 (162)
T ss_pred             EEEECCCCCCHHHHHHHHhc
Confidence            34789999999999998865

Rab23 is a member of the Rab family of small GTPases. In mouse, Rab23 has been shown to function as a negative regulator in the sonic hedgehog (Shh) signalling pathway. Rab23 mediates the activity of Gli2 and Gli3, transcription factors that regulate Shh signaling in the spinal cord, primarily by preventing Gli2 activation in the absence of Shh ligand. Rab23 also regulates a step in the cytoplasmic signal transduction pathway that mediates the effect of Smoothened (one of two integral membrane proteins that are essential components of the Shh signaling pathway in vertebrates). In humans, Rab23 is expressed in the retina. Mice contain an isoform that shares 93% sequence identity with the human Rab23 and an alternative splicing isoform that is specific to the brain. This isoform causes the murine open brain phenotype, indicating it may have a role in the development of the central nervous system. GTPase activating proteins (GAPs) interact with G

>PRK14239 phosphate transporter ATP-binding protein; Provisional

Probab=95.13  E-value=0.012  Score=43.56  Aligned_cols=18  Identities=33%  Similarity=0.326  Sum_probs=17.0

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |+|..|.|||||++.+..
T Consensus        36 i~G~nGsGKSTLl~~l~G   53 (252)
T PRK14239         36 LIGPSGSGKSTLLRSINR   53 (252)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            999999999999999965

>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein

Probab=95.13  E-value=0.012  Score=46.16  Aligned_cols=20  Identities=25%  Similarity=0.162  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+..-.
T Consensus        36 IiG~sGaGKSTLlr~I~gl~   55 (343)
T TIGR02314        36 VIGASGAGKSTLIRCVNLLE   55 (343)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999998754

Members of this family are the ATP-binding protein of the D-methionine ABC transporter complex. Known members belong to the Proteobacteria.

>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein

Probab=95.13  E-value=0.012  Score=42.47  Aligned_cols=20  Identities=30%  Similarity=0.225  Sum_probs=18.6

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+....
T Consensus        29 i~G~nGsGKSTLl~~l~G~~   48 (213)
T TIGR01277        29 IMGPSGAGKSTLLNLIAGFI   48 (213)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999998865

This model describes the energy-transducing ATPase subunit ThiQ of the ThiBPQ thiamine (and thiamine pyrophosphate) ABC transporter in several Proteobacteria. This protein is found so far only in Proteobacteria, and is found in complete genomes only if the ThiB and ThiP subunits are also found.

>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed

Probab=95.12  E-value=0.012  Score=43.90  Aligned_cols=20  Identities=25%  Similarity=0.253  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        35 I~G~NGsGKSTLl~~i~Gl~   54 (251)
T PRK09544         35 LLGPNGAGKSTLVRVVLGLV   54 (251)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

>PRK08356 hypothetical protein; Provisional

Probab=95.12  E-value=0.012  Score=42.08  Aligned_cols=17  Identities=24%  Similarity=0.040  Sum_probs=15.9

Q ss_pred             ccCcCCCchhHHHHhhh
Q 042811           91 PFGVEGVGKITSLSKSY  107 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~  107 (130)
                      |.|+.|+||||+|+.+-
T Consensus        10 ~~G~~gsGK~t~a~~l~   26 (195)
T PRK08356         10 VVGKIAAGKTTVAKFFE   26 (195)
T ss_pred             EECCCCCCHHHHHHHHH
Confidence            89999999999999993

>CHL00131 ycf16 sulfate ABC transporter protein; Validated

Probab=95.12  E-value=0.012  Score=43.55  Aligned_cols=19  Identities=26%  Similarity=0.174  Sum_probs=17.8

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|..|+|||||++.+...
T Consensus        38 i~G~nGsGKSTLl~~i~Gl   56 (252)
T CHL00131         38 IMGPNGSGKSTLSKVIAGH   56 (252)
T ss_pred             EECCCCCCHHHHHHHHcCC
Confidence            9999999999999999874

>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX

Probab=95.12  E-value=0.0039  Score=45.58  Aligned_cols=18  Identities=22%  Similarity=0.235  Sum_probs=15.6

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      ++|-.|+|||+||+.+-.
T Consensus        27 l~GppGtGKTmlA~~l~~   44 (206)
T PF01078_consen   27 LIGPPGTGKTMLARRLPS   44 (206)
T ss_dssp             EES-CCCTHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHH
Confidence            999999999999998754

This is the first unique step in the synthesis of (bacterio)chlorophyll. As a result, it is thought that Mg-chelatase has an important role in channeling intermediates into the (bacterio)chlorophyll branch in response to conditions suitable for photosynthetic growth. ChlI and BchD have molecular weights between 38-42 kDa.; GO: 0016851 magnesium chelatase activity, 0015979 photosynthesis, 0015995 chlorophyll biosynthetic process; PDB: 2X31_J 1G8P_A 3K1J_B.

>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.12  E-value=0.012  Score=43.55  Aligned_cols=19  Identities=32%  Similarity=0.305  Sum_probs=17.8

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|-.|+|||||++.+...
T Consensus        35 i~G~nGsGKSTLl~~l~Gl   53 (252)
T PRK14256         35 IIGPSGCGKSTVLRSINRM   53 (252)
T ss_pred             EECCCCCCHHHHHHHHHhc
Confidence            9999999999999999875

>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein

Probab=95.12  E-value=0.012  Score=43.59  Aligned_cols=20  Identities=30%  Similarity=0.182  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        31 i~G~nGsGKSTLl~~l~G~~   50 (252)
T TIGR03005        31 LIGPSGSGKSTILRILMTLE   50 (252)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

Members of this family are the ATP-binding protein of a conserved four gene ABC transporter operon found next to ectoine unilization operons and ectoine biosynthesis operons. Ectoine is a compatible solute that protects enzymes from high osmolarity. It is released by some species in response to hypoosmotic shock, and it is taken up by a number of bacteria as a compatible solute or for consumption. This family shows strong sequence similiarity to a number of amino acid ABC transporter ATP-binding proteins.

>PLN02796 D-glycerate 3-kinase

Probab=95.11  E-value=0.012  Score=46.20  Aligned_cols=20  Identities=25%  Similarity=0.130  Sum_probs=18.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+....
T Consensus       105 I~G~sGSGKSTLa~~L~~lL  124 (347)
T PLN02796        105 ISAPQGCGKTTLVFALVYLF  124 (347)
T ss_pred             EECCCCCcHHHHHHHHHHHh
Confidence            99999999999999999876

>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=95.11  E-value=0.012  Score=44.37  Aligned_cols=20  Identities=25%  Similarity=0.150  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        38 l~G~nGsGKSTLl~~i~Gl~   57 (280)
T PRK13649         38 FIGHTGSGKSTIMQLLNGLH   57 (280)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999997753

>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.11  E-value=0.012  Score=43.87  Aligned_cols=20  Identities=25%  Similarity=0.182  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+....
T Consensus        38 l~G~nGsGKSTLlk~l~Gl~   57 (259)
T PRK14260         38 IIGPSGCGKSTFIKTLNRIS   57 (259)
T ss_pred             EECCCCCCHHHHHHHHHhhc
Confidence            99999999999999998743

>PRK14238 phosphate transporter ATP-binding protein; Provisional

Probab=95.11  E-value=0.012  Score=44.29  Aligned_cols=20  Identities=25%  Similarity=0.257  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+....
T Consensus        55 I~G~nGsGKSTLl~~i~Gl~   74 (271)
T PRK14238         55 IIGPSGCGKSTYIKTLNRMV   74 (271)
T ss_pred             EECCCCCCHHHHHHHHHhhc
Confidence            99999999999999998753

>PRK13539 cytochrome c biogenesis protein CcmA; Provisional

Probab=95.11  E-value=0.012  Score=42.37  Aligned_cols=20  Identities=30%  Similarity=0.197  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+....
T Consensus        33 i~G~nGsGKSTLl~~l~G~~   52 (207)
T PRK13539         33 LTGPNGSGKTTLLRLIAGLL   52 (207)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=95.11  E-value=0.012  Score=44.68  Aligned_cols=20  Identities=25%  Similarity=0.302  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        42 l~G~nGsGKSTLl~~l~Gl~   61 (289)
T PRK13645         42 VIGTTGSGKSTMIQLTNGLI   61 (289)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999997754

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional

Probab=95.11  E-value=0.0046  Score=50.69  Aligned_cols=18  Identities=33%  Similarity=0.316  Sum_probs=16.5

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      ++|..|+||||+|+.+-+
T Consensus        40 f~Gp~G~GKTT~ArilAk   57 (491)
T PRK14964         40 LVGASGVGKTTCARIISL   57 (491)
T ss_pred             EECCCCccHHHHHHHHHH
Confidence            999999999999988765

>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors

Probab=95.10  E-value=0.012  Score=42.84  Aligned_cols=20  Identities=30%  Similarity=0.330  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+....
T Consensus        38 l~G~nGsGKSTLlk~l~G~~   57 (226)
T cd03234          38 ILGSSGSGKTTLLDAISGRV   57 (226)
T ss_pred             EECCCCCCHHHHHHHHhCcc
Confidence            99999999999999998754

The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan. The pigment precursors are encoded by the white, brown, and scarlet genes, respectively. Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan. However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes. Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in

>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP

Probab=95.10  E-value=0.012  Score=42.27  Aligned_cols=20  Identities=30%  Similarity=0.101  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+....
T Consensus        29 l~G~nGsGKSTLl~~l~gl~   48 (211)
T cd03298          29 IVGPSGSGKSTLLNLIAGFE   48 (211)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK14087 dnaA chromosomal replication initiation protein; Provisional

Probab=95.10  E-value=0.024  Score=45.96  Aligned_cols=20  Identities=25%  Similarity=0.376  Sum_probs=19.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |||-.|+|||+|++.+.+..
T Consensus       146 i~G~~G~GKTHLl~Ai~~~l  165 (450)
T PRK14087        146 IYGESGMGKTHLLKAAKNYI  165 (450)
T ss_pred             EECCCCCcHHHHHHHHHHHH
Confidence            99999999999999999965

>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein

Probab=95.10  E-value=0.012  Score=43.72  Aligned_cols=20  Identities=30%  Similarity=0.288  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        32 i~G~nGsGKSTLl~~i~G~~   51 (256)
T TIGR03873        32 LLGPNGSGKSTLLRLLAGAL   51 (256)
T ss_pred             EECCCCCCHHHHHHHHcCCC
Confidence            99999999999999998754

This small clade of ABC-type transporter ATP-binding protein components is found as a three gene cassette along with a periplasmic substrate-binding protein (TIGR03868) and a permease (TIGR03869). The organisms containing this cassette are all Actinobacteria and all contain numerous genes requiring the coenzyme F420. This model was defined based on five such organisms, four of which are lacking all F420 biosynthetic capability save the final side-chain polyglutamate attachment step (via the gene cofE: TIGR01916). In Jonesia denitrificans DSM 20603 and marine actinobacterium PHSC20C1 this cassette is in an apparent operon with the cofE gene and, in PHSC20C1, also with a F420-dependent glucose-6-phosphate dehydrogenase (TIGR03554). Based on these observations we propose that this ATP-binding protein is a component of an F420-0 (that is, F420 lacking only the polyglutamate tail) transporter.

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional

Probab=95.09  E-value=0.0049  Score=51.13  Aligned_cols=20  Identities=30%  Similarity=0.135  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+||||||+.+.+..
T Consensus        43 f~Gp~GvGKTTlAr~lAk~L   62 (546)
T PRK14957         43 FTGTRGVGKTTLGRLLAKCL   62 (546)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            89999999999999987644

>PRK14243 phosphate transporter ATP-binding protein; Provisional

Probab=95.09  E-value=0.012  Score=44.02  Aligned_cols=18  Identities=33%  Similarity=0.250  Sum_probs=17.1

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |+|..|.|||||++.+..
T Consensus        41 i~G~nGsGKSTLl~~l~G   58 (264)
T PRK14243         41 FIGPSGCGKSTILRCFNR   58 (264)
T ss_pred             EECCCCCCHHHHHHHHHh
Confidence            999999999999999885

>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.09  E-value=0.013  Score=43.31  Aligned_cols=20  Identities=25%  Similarity=0.210  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|.|||||++.+....
T Consensus        34 i~G~nGsGKSTLl~~l~Gl~   53 (241)
T PRK14250         34 IVGPSGAGKSTLIKLINRLI   53 (241)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

>PRK15056 manganese/iron transporter ATP-binding protein; Provisional

Probab=95.09  E-value=0.012  Score=44.24  Aligned_cols=20  Identities=30%  Similarity=0.280  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+....
T Consensus        38 l~G~nGsGKSTLl~~l~Gl~   57 (272)
T PRK15056         38 LVGVNGSGKSTLFKALMGFV   57 (272)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999997753

>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed

Probab=95.09  E-value=0.012  Score=43.36  Aligned_cols=19  Identities=26%  Similarity=0.218  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|.|||||++.+...
T Consensus        32 i~G~nGsGKSTLl~~l~Gl   50 (248)
T PRK09580         32 IMGPNGSGKSTLSATLAGR   50 (248)
T ss_pred             EECCCCCCHHHHHHHHcCC
Confidence            9999999999999999886

>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.09  E-value=0.012  Score=43.78  Aligned_cols=19  Identities=26%  Similarity=0.228  Sum_probs=17.6

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|-.|.|||||++.+...
T Consensus        43 l~G~nGsGKSTLl~~l~G~   61 (259)
T PRK14274         43 IIGPSGCGKSTFIKTLNLM   61 (259)
T ss_pred             EECCCCCCHHHHHHHHHhh
Confidence            9999999999999999764

>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.08  E-value=0.012  Score=44.16  Aligned_cols=19  Identities=32%  Similarity=0.305  Sum_probs=17.7

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|+|||||++.+...
T Consensus        44 l~G~nGsGKSTLl~~l~Gl   62 (269)
T PRK14259         44 LIGPSGCGKSTVLRSLNRM   62 (269)
T ss_pred             EECCCCCCHHHHHHHHhcc
Confidence            9999999999999999764

>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea

Probab=95.08  E-value=0.013  Score=44.10  Aligned_cols=20  Identities=30%  Similarity=0.280  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+....
T Consensus        55 l~G~nGsGKSTLl~~L~Gl~   74 (269)
T cd03294          55 IMGLSGSGKSTLLRCINRLI   74 (269)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999997754

This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional

Probab=95.08  E-value=0.012  Score=44.03  Aligned_cols=20  Identities=30%  Similarity=0.197  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        42 i~G~nGsGKSTLl~~l~Gl~   61 (265)
T PRK10575         42 LIGHNGSGKSTLLKMLGRHQ   61 (265)
T ss_pred             EECCCCCCHHHHHHHHcCCC
Confidence            99999999999999998754

>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea

Probab=95.07  E-value=0.013  Score=41.29  Aligned_cols=20  Identities=30%  Similarity=0.297  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+....
T Consensus        30 l~G~nGsGKStLl~~i~G~~   49 (180)
T cd03214          30 ILGPNGAGKSTLLKTLAGLL   49 (180)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998854

Only very few species lack representatives of the siderophore family transporters. The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake. The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA. The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme. A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export

Probab=95.07  E-value=0.013  Score=40.92  Aligned_cols=20  Identities=30%  Similarity=0.298  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+..-.
T Consensus        33 l~G~nGsGKstLl~~i~G~~   52 (171)
T cd03228          33 IVGPSGSGKSTLLKLLLRLY   52 (171)
T ss_pred             EECCCCCCHHHHHHHHHcCC
Confidence            99999999999999998754

They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins. The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities. The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd04117 Rab15 Rab15 subfamily

Probab=95.07  E-value=0.013  Score=40.18  Aligned_cols=19  Identities=32%  Similarity=0.310  Sum_probs=15.5

Q ss_pred             ccccCcCCCchhHHHHhhh
Q 042811           89 NWPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~  107 (130)
                      +.|+|-+|+|||||+..+.
T Consensus         3 i~vvG~~~~GKTsli~~~~   21 (161)
T cd04117           3 LLLIGDSGVGKTCLLCRFT   21 (161)
T ss_pred             EEEECcCCCCHHHHHHHHh
Confidence            3478999999999996653

Rab15 colocalizes with the transferrin receptor in early endosome compartments, but not with late endosomal markers. It codistributes with Rab4 and Rab5 on early/sorting endosomes, and with Rab11 on pericentriolar recycling endosomes. It is believed to function as an inhibitory GTPase that regulates distinct steps in early endocytic trafficking. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB

Probab=95.07  E-value=0.013  Score=45.05  Aligned_cols=20  Identities=30%  Similarity=0.315  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+.+..
T Consensus       137 I~G~tGSGKTTll~al~~~i  156 (299)
T TIGR02782       137 VVGGTGSGKTTLANALLAEI  156 (299)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            99999999999999988754

The TrbB protein is found in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer. TrbB is a homolog of the vir system VirB11 ATPase, and the Flp pilus sytem ATPase TadA.

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional

Probab=95.06  E-value=0.0057  Score=48.67  Aligned_cols=20  Identities=30%  Similarity=0.275  Sum_probs=17.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+||||+|+.+-+..
T Consensus        43 f~Gp~G~GKtt~A~~~a~~l   62 (397)
T PRK14955         43 FSGLRGVGKTTAARVFAKAV   62 (397)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            89999999999999876654

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth

Probab=95.06  E-value=0.013  Score=39.98  Aligned_cols=20  Identities=35%  Similarity=0.341  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+....
T Consensus        31 i~G~nGsGKStLl~~l~G~~   50 (144)
T cd03221          31 LVGRNGAGKSTLLKLIAGEL   50 (144)
T ss_pred             EECCCCCCHHHHHHHHcCCC
Confidence            99999999999999998754

EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site. The reaction requires ATP hydrolysis. EF-3 contains two ATP nucleotide binding sequence (NBS) motifs. NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.

>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1

Probab=95.06  E-value=0.012  Score=43.07  Aligned_cols=20  Identities=30%  Similarity=0.287  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+....
T Consensus        34 l~G~nGsGKSTLl~~i~G~~   53 (238)
T cd03249          34 LVGSSGCGKSTVVSLLERFY   53 (238)
T ss_pred             EEeCCCCCHHHHHHHHhccC
Confidence            99999999999999998764

In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD. MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.

>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends

Probab=95.06  E-value=0.012  Score=42.62  Aligned_cols=18  Identities=33%  Similarity=0.305  Sum_probs=16.5

Q ss_pred             cccCcCCCchhHHHHhhh
Q 042811           90 WPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~  107 (130)
                      .|+|..|.|||||++.|.
T Consensus        32 ~i~G~NGsGKSTll~~i~   49 (213)
T cd03279          32 LICGPTGAGKSTILDAIT   49 (213)
T ss_pred             EEECCCCCCHHHHHHHhe
Confidence            399999999999999975

They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family

Probab=95.06  E-value=0.0056  Score=53.27  Aligned_cols=32  Identities=22%  Similarity=0.142  Sum_probs=25.6

Q ss_pred             eeecccCCCCcc------------ccCcCCCchhHHHHhhhhhh
Q 042811           79 KLGDVRRNGNNW------------PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        79 ivG~~~~~~~l~------------I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|++..+..+.            ++|-.|+||||||+.+....
T Consensus       189 ~iGr~~ei~~~i~~l~r~~~~n~lLvG~pGvGKTal~~~La~~i  232 (852)
T TIGR03345       189 VLGRDDEIRQMIDILLRRRQNNPILTGEAGVGKTAVVEGLALRI  232 (852)
T ss_pred             ccCCHHHHHHHHHHHhcCCcCceeEECCCCCCHHHHHHHHHHHH
Confidence            588876444332            99999999999999998865

Members of this protein family are homologs of ClpB, an ATPase associated with chaperone-related functions. These ClpB homologs, designated ClpV1, are a key component of the bacterial pathogenicity-associated type VI secretion system.

>cd04120 Rab12 Rab12 subfamily

Probab=95.06  E-value=0.013  Score=42.37  Aligned_cols=18  Identities=28%  Similarity=0.405  Sum_probs=15.4

Q ss_pred             cccCcCCCchhHHHHhhh
Q 042811           90 WPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~  107 (130)
                      .++|.+|+|||||++...
T Consensus         4 vvlG~~gVGKTSli~r~~   21 (202)
T cd04120           4 IIIGSRGVGKTSLMRRFT   21 (202)
T ss_pred             EEECcCCCCHHHHHHHHH
Confidence            478999999999997753

Rab12 was first identified in canine cells, where it was localized to the Golgi complex. The specific function of Rab12 remains unknown, and inconsistent results about its cellular localization have been reported. More recent studies have identified Rab12 associated with post-Golgi vesicles, or with other small vesicle-like structures but not with the Golgi complex. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic

>TIGR00064 ftsY signal recognition particle-docking protein FtsY

Probab=95.06  E-value=0.024  Score=43.06  Aligned_cols=20  Identities=40%  Similarity=0.592  Sum_probs=17.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|.+|+||||++.++....
T Consensus        77 l~G~~G~GKTTt~akLA~~l   96 (272)
T TIGR00064        77 FVGVNGVGKTTTIAKLANKL   96 (272)
T ss_pred             EECCCCCcHHHHHHHHHHHH
Confidence            77999999999999987766

There is a weak division between FtsY and SRP54; both are GTPases. In E.coli, ftsY is an essential gene located in an operon with cell division genes ftsE and ftsX, but its apparent function is as the signal recognition particle docking protein.

>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism]

Probab=95.05  E-value=0.011  Score=41.65  Aligned_cols=20  Identities=25%  Similarity=0.310  Sum_probs=17.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..++|||||+..+-...
T Consensus         7 ivG~k~SGKTTLie~lv~~L   26 (161)
T COG1763           7 IVGYKNSGKTTLIEKLVRKL   26 (161)
T ss_pred             EEecCCCChhhHHHHHHHHH
Confidence            89999999999999986655

>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism]

Probab=95.05  E-value=0.013  Score=41.64  Aligned_cols=21  Identities=24%  Similarity=0.058  Sum_probs=17.5

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      |.++||-|+||||+.+.+-+.
T Consensus         5 IvLiG~mGaGKSTIGr~LAk~   25 (172)
T COG0703           5 IVLIGFMGAGKSTIGRALAKA   25 (172)
T ss_pred             EEEEcCCCCCHhHHHHHHHHH
Confidence            347999999999999998544

>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters

Probab=95.05  E-value=0.013  Score=42.20  Aligned_cols=20  Identities=25%  Similarity=0.152  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|.|||||++.+....
T Consensus        38 i~G~nGsGKSTLl~~l~G~~   57 (202)
T cd03233          38 VLGRPGSGCSTLLKALANRT   57 (202)
T ss_pred             EECCCCCCHHHHHHHhcccC
Confidence            99999999999999998764

PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. This PDR subfamily represents domain I of its (ABC-IM)2 organization. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional

Probab=95.05  E-value=0.03  Score=45.14  Aligned_cols=20  Identities=35%  Similarity=0.396  Sum_probs=17.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+||||++.++-...
T Consensus       196 lvGpnG~GKTTtlakLA~~~  215 (420)
T PRK14721        196 LIGPTGVGKTTTTAKLAARA  215 (420)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            99999999999999887653

>cd04127 Rab27A Rab27a subfamily

Probab=95.04  E-value=0.014  Score=40.52  Aligned_cols=20  Identities=30%  Similarity=0.325  Sum_probs=17.1

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|..|+|||||+..+.+
T Consensus         7 i~ivG~~~vGKTsli~~~~~   26 (180)
T cd04127           7 FLALGDSGVGKTSFLYQYTD   26 (180)
T ss_pred             EEEECCCCCCHHHHHHHHhc
Confidence            34899999999999988754

The Rab27a subfamily consists of Rab27a and its highly homologous isoform, Rab27b. Unlike most Rab proteins whose functions remain poorly defined, Rab27a has many known functions. Rab27a has multiple effector proteins, and depending on which effector it binds, Rab27a has different functions as well as tissue distribution and/or cellular localization. Putative functions have been assigned to Rab27a when associated with the effector proteins Slp1, Slp2, Slp3, Slp4, Slp5, DmSlp, rabphilin, Dm/Ce-rabphilin, Slac2-a, Slac2-b, Slac2-c, Noc2, JFC1, and Munc13-4. Rab27a has been associated with several human diseases, including hemophagocytic syndrome (Griscelli syndrome or GS), Hermansky-Pudlak syndrome, and choroidermia. In the case of GS, a rare, autosomal recessive disease, a Rab27a mutation is directly responsible for the disorder. When Rab27a is localized to the secretory granules of pancreatic beta cells, it is believed to mediate glucose-stimulated

>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit

Probab=95.04  E-value=0.013  Score=44.82  Aligned_cols=20  Identities=25%  Similarity=0.340  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+..-.
T Consensus        24 l~G~NGaGKSTLl~~l~Gl~   43 (302)
T TIGR01188        24 FLGPNGAGKTTTIRMLTTLL   43 (302)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc.

>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.04  E-value=0.013  Score=43.39  Aligned_cols=18  Identities=33%  Similarity=0.342  Sum_probs=17.0

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |+|-.|.|||||++.+..
T Consensus        36 l~G~nGsGKSTLl~~l~G   53 (252)
T PRK14255         36 LIGPSGCGKSTYLRTLNR   53 (252)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            999999999999999965

>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional

Probab=95.04  E-value=0.013  Score=43.56  Aligned_cols=20  Identities=30%  Similarity=0.235  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        33 l~G~nGsGKSTLl~~l~Gl~   52 (255)
T PRK11231         33 LIGPNGCGKSTLLKCFARLL   52 (255)
T ss_pred             EECCCCCCHHHHHHHHhCCc
Confidence            99999999999999997753

>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor

Probab=95.04  E-value=0.0045  Score=43.70  Aligned_cols=21  Identities=19%  Similarity=0.015  Sum_probs=19.3

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +|+|-.|+||+.+|+.|++..
T Consensus        26 lI~GE~GtGK~~lA~~IH~~s   46 (168)
T PF00158_consen   26 LITGETGTGKELLARAIHNNS   46 (168)
T ss_dssp             EEECSTTSSHHHHHHHHHHCS
T ss_pred             EEEcCCCCcHHHHHHHHHHhh
Confidence            399999999999999999965

These have a conserved domain of about 230 residues involved in the ATP-dependent [, ] interaction with sigma-54. About half of the proteins in which this domain is found (algB, dcdT, flbD, hoxA, hupR1, hydG, ntrC, pgtA and pilR) belong to signal transduction two-component systems [] and possess a domain that can be phosphorylated by a sensor-kinase protein in their N-terminal section. Almost all of these proteins possess a helix-turn-helix DNA-binding domain in their C-terminal section. The domain which interacts with the sigma-54 factor has an ATPase activity. This may be required to promote a conformational change necessary for the interaction []. The domain contains an atypical ATP-binding motif A (P-loop) as well as a form of motif B. The two ATP-binding motifs are located in the N-terminal section of the domain.; GO: 0005524 ATP binding, 0008134 transcription factor binding, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 1NY6_K 3M0E_G 1NY5_A 1OJL_A 3DZD_B 2C9C_A 2C98_A 2C96_A 2BJV_A 2C99_A ....

>cd03290 ABCC_SUR1_N The SUR domain 1

Probab=95.03  E-value=0.013  Score=42.37  Aligned_cols=20  Identities=30%  Similarity=0.302  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        32 i~G~nGsGKSTLl~~i~G~~   51 (218)
T cd03290          32 IVGQVGCGKSSLLLAILGEM   51 (218)
T ss_pred             EECCCCCCHHHHHHHHhccC
Confidence            99999999999999998754

The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.

>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.03  E-value=0.013  Score=43.31  Aligned_cols=19  Identities=32%  Similarity=0.307  Sum_probs=17.7

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|..|.|||||++.+..-
T Consensus        34 i~G~nGsGKSTLl~~i~Gl   52 (250)
T PRK14262         34 IIGPSGCGKTTLLRSINRM   52 (250)
T ss_pred             EECCCCCCHHHHHHHHhcc
Confidence            9999999999999999863

>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins

Probab=95.03  E-value=0.013  Score=42.77  Aligned_cols=20  Identities=25%  Similarity=0.215  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        33 i~G~nGsGKSTLl~~l~Gl~   52 (234)
T cd03251          33 LVGPSGSGKSTLVNLIPRFY   52 (234)
T ss_pred             EECCCCCCHHHHHHHHhccc
Confidence            99999999999999997654

ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export

Probab=95.03  E-value=0.013  Score=42.80  Aligned_cols=20  Identities=30%  Similarity=0.293  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+....
T Consensus        53 i~G~nGsGKSTLl~~l~G~~   72 (224)
T cd03220          53 LIGRNGAGKSTLLRLLAGIY   72 (224)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2.

>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes

Probab=95.02  E-value=0.015  Score=40.72  Aligned_cols=20  Identities=40%  Similarity=0.524  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||+..+....
T Consensus         6 i~G~~gsGKTTli~~L~~~l   25 (159)
T cd03116           6 FVGYSGSGKTTLLEKLIPAL   25 (159)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            88999999999999988765

In E. coli, the synthesis of Moco involves genes from several loci: moa, mob, mod, moe and mog. The mob locus contains mobA and mobB genes. MobB catalyzes the attachment of the guanine dinucleotide to molybdopterin.

>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional

Probab=95.02  E-value=0.013  Score=45.47  Aligned_cols=20  Identities=20%  Similarity=0.064  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|.|||||++.|..-.
T Consensus        38 ivG~sGsGKSTLl~~i~Gl~   57 (330)
T PRK15093         38 LVGESGSGKSLIAKAICGVT   57 (330)
T ss_pred             EECCCCCCHHHHHHHHHccC
Confidence            99999999999999998754

>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters

Probab=95.02  E-value=0.014  Score=42.30  Aligned_cols=20  Identities=30%  Similarity=0.227  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+..-.
T Consensus        35 i~G~nGsGKSTLl~~i~G~~   54 (220)
T cd03245          35 IIGRVGSGKSTLLKLLAGLY   54 (220)
T ss_pred             EECCCCCCHHHHHHHHhcCc
Confidence            99999999999999998754

Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2. A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.

>cd01892 Miro2 Miro2 subfamily

Probab=95.02  E-value=0.014  Score=40.58  Aligned_cols=20  Identities=25%  Similarity=0.388  Sum_probs=17.3

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|-+|+|||||+..+.+.
T Consensus         8 ~~vG~~~vGKTsli~~~~~~   27 (169)
T cd01892           8 FVLGAKGSGKSALLRAFLGR   27 (169)
T ss_pred             EEECCCCCcHHHHHHHHhCC
Confidence            38999999999999997653

Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs. Genes encoding Miro-like proteins were found in several eukaryotic organisms. This CD represents the putative GTPase domain in the C terminus of Miro proteins. These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis. Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional

Probab=95.01  E-value=0.014  Score=46.60  Aligned_cols=20  Identities=20%  Similarity=0.212  Sum_probs=18.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+||||||+.+.+..
T Consensus       184 L~GppGTGKT~LAkalA~~l  203 (398)
T PTZ00454        184 LYGPPGTGKTMLAKAVAHHT  203 (398)
T ss_pred             EECCCCCCHHHHHHHHHHhc
Confidence            99999999999999998865

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response

Probab=95.01  E-value=0.033  Score=40.34  Aligned_cols=33  Identities=18%  Similarity=-0.144  Sum_probs=23.8

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCC------CeEEEEEeC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIF------LIKMHDVVR  126 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~F------d~~~wv~VS  126 (130)
                      |+|-.|+|||||+..+--..   ...-      ..++|+...
T Consensus        24 I~G~~GsGKT~l~~~ia~~~---~~~~~~~g~~~~v~yi~~e   62 (226)
T cd01393          24 IFGEFGSGKTQLCLQLAVEA---QLPGELGGLEGKVVYIDTE   62 (226)
T ss_pred             EeCCCCCChhHHHHHHHHHh---hcccccCCCcceEEEEecC
Confidence            99999999999999875543   1222      456777655

RecA couples ATP hydrolysis to DNA strand exchange. While prokaryotes have a single RecA protein, eukaryotes have multiple RecA homologs such as Rad51, DMC1 and Rad55/57. Archaea have the RecA-like homologs radA and radB.

>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.00  E-value=0.013  Score=43.34  Aligned_cols=20  Identities=30%  Similarity=0.290  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+....
T Consensus        35 l~G~nGsGKSTLl~~l~G~~   54 (253)
T PRK14267         35 LMGPSGCGKSTLLRTFNRLL   54 (253)
T ss_pred             EECCCCCCHHHHHHHHhccC
Confidence            99999999999999997753

>PLN03025 replication factor C subunit; Provisional

Probab=95.00  E-value=0.014  Score=44.91  Aligned_cols=22  Identities=32%  Similarity=0.235  Sum_probs=19.1

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.++|..|+||||+|+.+-+..
T Consensus        37 lll~Gp~G~GKTtla~~la~~l   58 (319)
T PLN03025         37 LILSGPPGTGKTTSILALAHEL   58 (319)
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
Confidence            3499999999999999988765

>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]

Probab=95.00  E-value=0.015  Score=41.81  Aligned_cols=22  Identities=27%  Similarity=0.388  Sum_probs=19.8

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +|.-|..|.||||||..++...
T Consensus        26 iW~TGLSGsGKSTiA~ale~~L   47 (197)
T COG0529          26 IWFTGLSGSGKSTIANALEEKL   47 (197)
T ss_pred             EEeecCCCCCHHHHHHHHHHHH
Confidence            4588999999999999999876

>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional

Probab=95.00  E-value=0.013  Score=42.81  Aligned_cols=20  Identities=30%  Similarity=0.248  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        30 l~G~nGsGKSTLl~~l~Gl~   49 (232)
T PRK10771         30 ILGPSGAGKSTLLNLIAGFL   49 (232)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999987653

>PF13555 AAA_29: P-loop containing region of AAA domain

Probab=95.00  E-value=0.016  Score=34.38  Aligned_cols=18  Identities=33%  Similarity=0.276  Sum_probs=15.5

Q ss_pred             cccCcCCCchhHHHHhhh
Q 042811           90 WPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~  107 (130)
                      .|.|-.|+|||||+-.+.
T Consensus        27 li~G~nGsGKSTllDAi~   44 (62)
T PF13555_consen   27 LITGPNGSGKSTLLDAIQ   44 (62)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            399999999999997654

>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.00  E-value=0.014  Score=43.33  Aligned_cols=20  Identities=30%  Similarity=0.209  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|+|||||++.+..-.
T Consensus        38 i~G~nGsGKSTLl~~l~Gl~   57 (254)
T PRK14273         38 LIGPSGCGKSTFLRTLNRMN   57 (254)
T ss_pred             EECCCCCCHHHHHHHHhccc
Confidence            99999999999999998754

>cd01865 Rab3 Rab3 subfamily

Probab=94.99  E-value=0.014  Score=40.00  Aligned_cols=22  Identities=23%  Similarity=0.154  Sum_probs=17.9

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|-.|+|||||+..+-+..
T Consensus         4 i~i~G~~~~GKSsli~~l~~~~   25 (165)
T cd01865           4 LLIIGNSSVGKTSFLFRYADDS   25 (165)
T ss_pred             EEEECCCCCCHHHHHHHHhcCC
Confidence            3478999999999999975443

The Rab3 subfamily contains Rab3A, Rab3B, Rab3C, and Rab3D. All four isoforms were found in mouse brain and endocrine tissues, with varying levels of expression. Rab3A, Rab3B, and Rab3C localized to synaptic and secretory vesicles; Rab3D was expressed at high levels only in adipose tissue, exocrine glands, and the endocrine pituitary, where it is localized to cytoplasmic secretory granules. Rab3 appears to control Ca2+-regulated exocytosis. The appropriate GDP/GTP exchange cycle of Rab3A is required for Ca2+-regulated exocytosis to occur, and interaction of the GTP-bound form of Rab3A with effector molecule(s) is widely believed to be essential for this process. Functionally, most studies point toward a role for Rab3 in the secretion of hormones and neurotransmitters. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promot

>PHA02518 ParA-like protein; Provisional

Probab=94.99  E-value=0.013  Score=41.88  Aligned_cols=16  Identities=25%  Similarity=0.233  Sum_probs=13.0

Q ss_pred             CcCCCchhHHHHhhhh
Q 042811           93 GVEGVGKITSLSKSYP  108 (130)
Q Consensus        93 GmGGvGKTTLak~v~~  108 (130)
                      .-||+||||++-++--
T Consensus         8 ~KGGvGKTT~a~~la~   23 (211)
T PHA02518          8 QKGGAGKTTVATNLAS   23 (211)
T ss_pred             CCCCCCHHHHHHHHHH
Confidence            4699999999988643

>PTZ00369 Ras-like protein; Provisional

Probab=94.99  E-value=0.014  Score=41.21  Aligned_cols=21  Identities=24%  Similarity=0.118  Sum_probs=17.3

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|-+|+|||||+..+.+.
T Consensus         8 i~iiG~~~~GKTsLi~~~~~~   28 (189)
T PTZ00369          8 LVVVGGGGVGKSALTIQFIQN   28 (189)
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            448999999999999876543

>cd04129 Rho2 Rho2 subfamily

Probab=94.99  E-value=0.014  Score=41.17  Aligned_cols=20  Identities=25%  Similarity=0.077  Sum_probs=17.3

Q ss_pred             CccccCcCCCchhHHHHhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~  107 (130)
                      ++.|+|-.|+|||||++.+.
T Consensus         3 Ki~ivG~~g~GKStLl~~l~   22 (187)
T cd04129           3 KLVIVGDGACGKTSLLSVFT   22 (187)
T ss_pred             EEEEECCCCCCHHHHHHHHH
Confidence            34589999999999999985

Rho2 is a fungal GTPase that plays a role in cell morphogenesis, control of cell wall integrity, control of growth polarity, and maintenance of growth direction. Rho2 activates the protein kinase C homolog Pck2, and Pck2 controls Mok1, the major (1-3) alpha-D-glucan synthase. Together with Rho1 (RhoA), Rho2 regulates the construction of the cell wall. Unlike Rho1, Rho2 is not an essential protein, but its overexpression is lethal. Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for proper intracellular localization via membrane attachment. As with other Rho family GTPases, the GDP/GTP cycling is regulated by GEFs (guanine nucleotide exchange factors), GAPs (GTPase-activating proteins) and GDIs (guanine nucleotide dissociation inhibitors).

>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.99  E-value=0.014  Score=43.35  Aligned_cols=18  Identities=33%  Similarity=0.272  Sum_probs=17.1

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |.|-.|+|||||++.+..
T Consensus        37 i~G~nGsGKSTLl~~l~G   54 (253)
T PRK14261         37 LIGPSGCGKSTLLRCFNR   54 (253)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            999999999999999975

>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional

Probab=94.98  E-value=0.014  Score=43.38  Aligned_cols=20  Identities=20%  Similarity=0.220  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+....
T Consensus        34 l~G~nGsGKSTLl~~l~Gl~   53 (254)
T PRK10418         34 LVGGSGSGKSLTCAAALGIL   53 (254)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily

Probab=94.98  E-value=0.015  Score=39.44  Aligned_cols=20  Identities=25%  Similarity=0.109  Sum_probs=16.3

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|-+|+|||||+..+-+
T Consensus         5 i~i~G~~~~GKtsl~~~~~~   24 (164)
T cd04145           5 LVVVGGGGVGKSALTIQFIQ   24 (164)
T ss_pred             EEEECCCCCcHHHHHHHHHh
Confidence            34899999999999987543

This subfamily contains R-Ras2/TC21, M-Ras/R-Ras3, and related members of the Ras family. M-Ras is expressed in lympho-hematopoetic cells. It interacts with some of the known Ras effectors, but appears to also have its own effectors. Expression of mutated M-Ras leads to transformation of several types of cell lines, including hematopoietic cells, mammary epithelial cells, and fibroblasts. Overexpression of M-Ras is observed in carcinomas from breast, uterus, thyroid, stomach, colon, kidney, lung, and rectum. In addition, expression of a constitutively active M-Ras mutant in murine bone marrow induces a malignant mast cell leukemia that is distinct from the monocytic leukemia induced by H-Ras. TC21, along with H-Ras, has been shown to regulate the branching morphogenesis of ureteric bud cell branching in mice. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an ali

>PRK14240 phosphate transporter ATP-binding protein; Provisional

Probab=94.98  E-value=0.014  Score=43.18  Aligned_cols=19  Identities=32%  Similarity=0.274  Sum_probs=17.6

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|.|||||++.+...
T Consensus        34 i~G~nGsGKSTLl~~i~G~   52 (250)
T PRK14240         34 LIGPSGCGKSTFLRTLNRM   52 (250)
T ss_pred             EECCCCCCHHHHHHHHhcc
Confidence            9999999999999999763

>PRK05896 DNA polymerase III subunits gamma and tau; Validated

Probab=94.97  E-value=0.0059  Score=51.15  Aligned_cols=20  Identities=20%  Similarity=0.159  Sum_probs=17.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+||||+|+.+-+..
T Consensus        43 f~GP~GvGKTTlA~~lAk~L   62 (605)
T PRK05896         43 FSGPRGIGKTSIAKIFAKAI   62 (605)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            89999999999999987654

>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2)

Probab=94.97  E-value=0.014  Score=41.96  Aligned_cols=17  Identities=24%  Similarity=0.163  Sum_probs=15.4

Q ss_pred             ccCcCCCchhHHHHhhh
Q 042811           91 PFGVEGVGKITSLSKSY  107 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~  107 (130)
                      |+|..|.|||||++.+-
T Consensus         5 ~~g~~~~GKttL~~~l~   21 (203)
T cd01888           5 TIGHVAHGKSTLVKALS   21 (203)
T ss_pred             EECCCCCCHHHHHHHHh
Confidence            78999999999999873

eIF2 is a heterotrimeric translation initiation factor that consists of alpha, beta, and gamma subunits. The GTP-bound gamma subunit also binds initiator methionyl-tRNA and delivers it to the 40S ribosomal subunit. Following hydrolysis of GTP to GDP, eIF2:GDP is released from the ribosome. The gamma subunit has no intrinsic GTPase activity, but is stimulated by the GTPase activating protein (GAP) eIF5, and GDP/GTP exchange is stimulated by the guanine nucleotide exchange factor (GEF) eIF2B. eIF2B is a heteropentamer, and the epsilon chain binds eIF2. Both eIF5 and eIF2B-epsilon are known to bind strongly to eIF2-beta, but have also been shown to bind directly to eIF2-gamma. It is possible that eIF2-beta serves simply as a high-affinity docking site for eIF5 and eIF2B-epsilon, or that eIF2-beta serves a regulatory role. eIF2-gamma is found only in eukaryotes and archaea. It is closely related to SelB, the sel

>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter

Probab=94.97  E-value=0.014  Score=41.84  Aligned_cols=20  Identities=30%  Similarity=0.120  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+....
T Consensus        31 i~G~nGsGKSTLl~~l~G~~   50 (201)
T cd03231          31 VTGPNGSGKTTLLRILAGLS   50 (201)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999987754

The CCM family is involved in bacterial cytochrome c biogenesis. Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH). CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH. The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE.

>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I

Probab=94.96  E-value=0.0056  Score=47.89  Aligned_cols=19  Identities=26%  Similarity=0.291  Sum_probs=17.1

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|..|+|||||++.+.+-
T Consensus        30 i~G~~G~gKttl~r~~~~~   48 (337)
T TIGR02030        30 VMGDRGTGKSTAVRALAAL   48 (337)
T ss_pred             EEcCCCCCHHHHHHHHHHh
Confidence            9999999999999998643

This model represents one of two ATPase subunits of the trimeric magnesium chelatase responsible for insertion of magnesium ion into protoporphyrin IX. This is an essential step in the biosynthesis of both chlorophyll and bacteriochlorophyll. This subunit is found in green plants, photosynthetic algae, cyanobacteria and other photosynthetic bacteria.

>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily

Probab=94.96  E-value=0.014  Score=40.60  Aligned_cols=20  Identities=25%  Similarity=0.227  Sum_probs=17.4

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.++|.+|+|||||+..+..
T Consensus        18 v~~~G~~~~GKTsl~~~l~~   37 (174)
T cd04153          18 VIIVGLDNAGKTTILYQFLL   37 (174)
T ss_pred             EEEECCCCCCHHHHHHHHcc
Confidence            44999999999999999854

Arl5 (Arf-like 5) and Arl8, like Arl4 and Arl7, are localized to the nucleus and nucleolus. Arl5 is developmentally regulated during embryogenesis in mice. Human Arl5 interacts with the heterochromatin protein 1-alpha (HP1alpha), a nonhistone chromosomal protein that is associated with heterochromatin and telomeres, and prevents telomere fusion. Arl5 may also play a role in embryonic nuclear dynamics and/or signaling cascades. Arl8 was identified from a fetal cartilage cDNA library. It is found in brain, heart, lung, cartilage, and kidney. No function has been assigned for Arl8 to date.

>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis

Probab=94.95  E-value=0.016  Score=40.85  Aligned_cols=20  Identities=35%  Similarity=0.542  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|||||||+..+..+.
T Consensus        40 l~G~SGvGKSSLiN~L~~~~   59 (161)
T PF03193_consen   40 LLGQSGVGKSSLINALLPEA   59 (161)
T ss_dssp             EECSTTSSHHHHHHHHHTSS
T ss_pred             EECCCCCCHHHHHHHHHhhc
Confidence            99999999999999998864

RsgA is an unusual circulary permuted GTPase that catalyzes rapid hydrolysis of GTP with a slow catalytic turnover. It is dispensible for viability, but important for overall fitness. The intrinsic GTPase activity is stimulated by the presence of 30S (160-fold increase in kcat) or 70S (96 fold increase in kcat) ribosomes []. The GTPase is inhibited by aminoglycoside antibiotics such as neomycin and paromycin [] streptomycin and spectinomycin []. This inhibition is not due to competition for binding sites on the 30S or 70S ribosome []. ; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 2YKR_W 2YV5_A 1T9H_A 2RCN_A 4A2I_V 1U0L_B.

>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains

Probab=94.95  E-value=0.014  Score=42.80  Aligned_cols=17  Identities=24%  Similarity=0.280  Sum_probs=16.5

Q ss_pred             ccCcCCCchhHHHHhhh
Q 042811           91 PFGVEGVGKITSLSKSY  107 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~  107 (130)
                      |+|..|.|||||++.|+
T Consensus        28 i~GpNGsGKStll~ai~   44 (243)
T cd03272          28 VVGRNGSGKSNFFAAIR   44 (243)
T ss_pred             EECCCCCCHHHHHHHHH
Confidence            99999999999999997

Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo

>cd04132 Rho4_like Rho4-like subfamily

Probab=94.94  E-value=0.015  Score=40.66  Aligned_cols=21  Identities=24%  Similarity=0.077  Sum_probs=17.1

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||++.+.+.
T Consensus         3 i~vvG~~~vGKTsli~~l~~~   23 (187)
T cd04132           3 IVVVGDGGCGKTCLLIVYSQG   23 (187)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            347899999999999886543

Rho4 is a GTPase that controls septum degradation by regulating secretion of Eng1 or Agn1 during cytokinesis. Rho4 also plays a role in cell morphogenesis. Rho4 regulates septation and cell morphology by controlling the actin cytoskeleton and cytoplasmic microtubules. The localization of Rho4 is modulated by Rdi1, which may function as a GDI, and by Rga9, which is believed to function as a GAP. In S. pombe, both Rho4 deletion and Rho4 overexpression result in a defective cell wall, suggesting a role for Rho4 in maintaining cell wall integrity. Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.

>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein

Probab=94.92  E-value=0.015  Score=42.37  Aligned_cols=20  Identities=25%  Similarity=0.303  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+....
T Consensus        34 i~G~nGsGKSTLl~~l~G~~   53 (229)
T cd03254          34 IVGPTGAGKTTLINLLMRFY   53 (229)
T ss_pred             EECCCCCCHHHHHHHHhcCc
Confidence            99999999999999997754

In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor. This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export. The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd04175 Rap1 Rap1 subgroup

Probab=94.92  E-value=0.016  Score=39.57  Aligned_cols=19  Identities=26%  Similarity=0.247  Sum_probs=15.8

Q ss_pred             cccCcCCCchhHHHHhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~  108 (130)
                      .|+|..|+|||||+..+.+
T Consensus         5 ~~~G~~~~GKTsli~~~~~   23 (164)
T cd04175           5 VVLGSGGVGKSALTVQFVQ   23 (164)
T ss_pred             EEECCCCCCHHHHHHHHHh
Confidence            4789999999999877643

The Rap1 subgroup is part of the Rap subfamily of the Ras family. It can be further divided into the Rap1a and Rap1b isoforms. In humans, Rap1a and Rap1b share 95% sequence homology, but are products of two different genes located on chromosomes 1 and 12, respectively. Rap1a is sometimes called smg p21 or Krev1 in the older literature. Rap1 proteins are believed to perform different cellular functions, depending on the isoform, its subcellular localization, and the effector proteins it binds. For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules. Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and the microsomal membrane of pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts. High expression of Rap1 has been observed in the n

>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2

Probab=94.92  E-value=0.016  Score=39.88  Aligned_cols=21  Identities=29%  Similarity=0.262  Sum_probs=17.8

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus         6 i~vvG~~~~GKSsl~~~~~~~   26 (167)
T cd01867           6 LLLIGDSGVGKSCLLLRFSED   26 (167)
T ss_pred             EEEECCCCCCHHHHHHHHhhC
Confidence            448999999999999998654

Rab8/Sec4/Ypt2 are known or suspected to be involved in post-Golgi transport to the plasma membrane. It is likely that these Rabs have functions that are specific to the mammalian lineage and have no orthologs in plants. Rab8 modulates polarized membrane transport through reorganization of actin and microtubules, induces the formation of new surface extensions, and has an important role in directed membrane transport to cell surfaces. The Ypt2 gene of the fission yeast Schizosaccharomyces pombe encodes a member of the Ypt/Rab family of small GTP-binding proteins, related in sequence to Sec4p of Saccharomyces cerevisiae but closer to mammalian Rab8. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhi

>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C

Probab=94.91  E-value=0.015  Score=42.11  Aligned_cols=20  Identities=25%  Similarity=0.267  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        35 i~G~nGsGKSTLl~~l~G~~   54 (221)
T cd03244          35 IVGRTGSGKSSLLLALFRLV   54 (221)
T ss_pred             EECCCCCCHHHHHHHHHcCC
Confidence            99999999999999997653

This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional

Probab=94.91  E-value=0.014  Score=46.89  Aligned_cols=20  Identities=45%  Similarity=0.584  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|.+|+||||++.++....
T Consensus       246 LVGptGvGKTTTiaKLA~~L  265 (436)
T PRK11889        246 LIGPTGVGKTTTLAKMAWQF  265 (436)
T ss_pred             EECCCCCcHHHHHHHHHHHH
Confidence            99999999999999998766

>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains

Probab=94.90  E-value=0.015  Score=43.14  Aligned_cols=18  Identities=28%  Similarity=0.276  Sum_probs=16.8

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |+|-.|.|||||+..|+-
T Consensus        30 IvG~NGsGKStll~Ai~~   47 (251)
T cd03273          30 ITGLNGSGKSNILDAICF   47 (251)
T ss_pred             EECCCCCCHHHHHHHHHH
Confidence            999999999999999974

Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo

>PRK12402 replication factor C small subunit 2; Reviewed

Probab=94.90  E-value=0.016  Score=44.38  Aligned_cols=22  Identities=23%  Similarity=0.219  Sum_probs=19.2

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.++|-.|+||||||+.+.+..
T Consensus        39 lll~Gp~GtGKT~la~~~~~~l   60 (337)
T PRK12402         39 LLVQGPPGSGKTAAVRALAREL   60 (337)
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            3499999999999999988765

>smart00763 AAA_PrkA PrkA AAA domain

Probab=94.90  E-value=0.017  Score=45.64  Aligned_cols=20  Identities=20%  Similarity=0.145  Sum_probs=18.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+||||||+.+-+..
T Consensus        83 L~GPPGsGKStla~~La~~l  102 (361)
T smart00763       83 LLGPVGGGKSSLVECLKRGL  102 (361)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            99999999999999998876

This is a family of PrkA bacterial and archaeal serine kinases approximately 630 residues long. This is the N-terminal AAA domain.

>PRK15467 ethanolamine utilization protein EutP; Provisional

Probab=94.89  E-value=0.015  Score=40.19  Aligned_cols=23  Identities=22%  Similarity=0.210  Sum_probs=19.6

Q ss_pred             CccccCcCCCchhHHHHhhhhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++.++|..|+|||||+..+++..
T Consensus         3 ~i~~iG~~~~GKstl~~~l~~~~   25 (158)
T PRK15467          3 RIAFVGAVGAGKTTLFNALQGNY   25 (158)
T ss_pred             EEEEECCCCCCHHHHHHHHcCCC
Confidence            45589999999999999998764

>TIGR00073 hypB hydrogenase accessory protein HypB

Probab=94.89  E-value=0.032  Score=40.30  Aligned_cols=20  Identities=25%  Similarity=0.293  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+|||||++.+....
T Consensus        27 ~~G~~gsGKTTli~~l~~~~   46 (207)
T TIGR00073        27 FMSSPGSGKTTLIEKLIDNL   46 (207)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            89999999999999988764

HypB is implicated in insertion of nickel into the large subunit of NiFe hydrogenases.

>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism]

Probab=94.88  E-value=0.015  Score=43.62  Aligned_cols=20  Identities=40%  Similarity=0.360  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+..+.
T Consensus        62 I~G~NGsGKTTLL~ll~~~~   81 (257)
T COG1119          62 IVGPNGAGKTTLLSLLTGEH   81 (257)
T ss_pred             EECCCCCCHHHHHHHHhccc
Confidence            99999999999999997765

>PRK14235 phosphate transporter ATP-binding protein; Provisional

Probab=94.88  E-value=0.016  Score=43.50  Aligned_cols=20  Identities=30%  Similarity=0.136  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+....
T Consensus        50 i~G~nGsGKSTLl~~l~Gl~   69 (267)
T PRK14235         50 FIGPSGCGKSTFLRCLNRMN   69 (267)
T ss_pred             EECCCCCCHHHHHHHHHhhc
Confidence            99999999999999998743

>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis]

Probab=94.87  E-value=0.015  Score=47.83  Aligned_cols=19  Identities=32%  Similarity=0.337  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      +||..|+|||||++.|-+-
T Consensus       111 LvGrNG~GKsTLLRaia~~  129 (582)
T KOG0062|consen  111 LVGRNGIGKSTLLRAIANG  129 (582)
T ss_pred             eeCCCCCcHHHHHHHHHhc
Confidence            9999999999999999983

>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional

Probab=94.87  E-value=0.015  Score=45.41  Aligned_cols=20  Identities=25%  Similarity=0.149  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+..-.
T Consensus        36 iiG~nGsGKSTLlk~L~Gl~   55 (343)
T PRK11153         36 VIGASGAGKSTLIRCINLLE   55 (343)
T ss_pred             EECCCCCcHHHHHHHHhCCC
Confidence            99999999999999997754

>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional

Probab=94.87  E-value=0.015  Score=43.36  Aligned_cols=20  Identities=35%  Similarity=0.395  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+....
T Consensus        33 i~G~nGsGKSTLl~~i~G~~   52 (258)
T PRK13548         33 ILGPNGAGKSTLLRALSGEL   52 (258)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.87  E-value=0.015  Score=43.00  Aligned_cols=19  Identities=32%  Similarity=0.223  Sum_probs=17.8

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|..|.|||||++.+...
T Consensus        35 i~G~nGsGKSTLl~~l~G~   53 (251)
T PRK14270         35 LIGPSGCGKSTFLRCLNRM   53 (251)
T ss_pred             EECCCCCCHHHHHHHHHhc
Confidence            9999999999999999874

>cd01895 EngA2 EngA2 subfamily

Probab=94.87  E-value=0.016  Score=39.28  Aligned_cols=20  Identities=25%  Similarity=0.207  Sum_probs=17.3

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus         6 ~i~G~~~~GKstli~~l~~~   25 (174)
T cd01895           6 AIIGRPNVGKSSLVNALLGE   25 (174)
T ss_pred             EEEcCCCCCHHHHHHHHhCc
Confidence            38999999999999998654

This CD represents the second GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains. Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability. A recent report suggests that E. coli Der functions in ribosome assembly and stability.

>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional

Probab=94.86  E-value=0.015  Score=43.91  Aligned_cols=20  Identities=30%  Similarity=0.381  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+....
T Consensus        32 l~G~nGsGKSTLl~~laG~~   51 (272)
T PRK13547         32 LLGRNGAGKSTLLKALAGDL   51 (272)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999997754

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A

Probab=94.86  E-value=0.015  Score=41.52  Aligned_cols=20  Identities=30%  Similarity=0.428  Sum_probs=14.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+||||++..+-...
T Consensus        22 i~GpPGTGKT~~l~~~i~~~   41 (236)
T PF13086_consen   22 IQGPPGTGKTTTLASIIAQL   41 (236)
T ss_dssp             EE-STTSSHHHHHHHHHHHH
T ss_pred             EECCCCCChHHHHHHHHHHh
Confidence            99999999997666654433

>PRK13543 cytochrome c biogenesis protein CcmA; Provisional

Probab=94.85  E-value=0.016  Score=42.05  Aligned_cols=20  Identities=30%  Similarity=0.200  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+....
T Consensus        42 i~G~nGsGKSTLl~~i~G~~   61 (214)
T PRK13543         42 VQGDNGAGKTTLLRVLAGLL   61 (214)
T ss_pred             EEcCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A

Probab=94.84  E-value=0.029  Score=40.35  Aligned_cols=20  Identities=30%  Similarity=0.285  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|.+|+||||+++.+.+-.
T Consensus        23 l~G~aGtGKT~~l~~~~~~~   42 (196)
T PF13604_consen   23 LQGPAGTGKTTLLKALAEAL   42 (196)
T ss_dssp             EEESTTSTHHHHHHHHHHHH
T ss_pred             EEECCCCCHHHHHHHHHHHH
Confidence            78999999999999988766

>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE

Probab=94.84  E-value=0.016  Score=43.39  Aligned_cols=20  Identities=25%  Similarity=0.096  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        42 i~G~nGsGKSTLl~~l~Gl~   61 (265)
T TIGR02769        42 LLGRSGCGKSTLARLLLGLE   61 (265)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999988754

This family represents the NikE subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase.

>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.84  E-value=0.016  Score=43.70  Aligned_cols=19  Identities=32%  Similarity=0.197  Sum_probs=17.6

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|..|.|||||++.+...
T Consensus        51 IiG~nGsGKSTLl~~l~Gl   69 (274)
T PRK14265         51 FIGPSGCGKSTLLRCFNRM   69 (274)
T ss_pred             EECCCCCCHHHHHHHHhcc
Confidence            9999999999999999854

>PRK14528 adenylate kinase; Provisional

Probab=94.84  E-value=0.018  Score=41.06  Aligned_cols=21  Identities=29%  Similarity=0.156  Sum_probs=17.9

Q ss_pred             CccccCcCCCchhHHHHhhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~  108 (130)
                      .++|.|..|+||||+++.+..
T Consensus         3 ~i~i~G~pGsGKtt~a~~la~   23 (186)
T PRK14528          3 NIIFMGPPGAGKGTQAKILCE   23 (186)
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            345899999999999999864

>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily

Probab=94.83  E-value=0.017  Score=40.24  Aligned_cols=21  Identities=19%  Similarity=0.173  Sum_probs=17.4

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.++|-+|+|||||++.+.+.
T Consensus         3 i~ivG~~~vGKTsli~~~~~~   23 (170)
T cd04108           3 VIVVGDLSVGKTCLINRFCKD   23 (170)
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            447999999999999986554

Rab34, found primarily in the Golgi, interacts with its effector, Rab-interacting lysosomal protein (RILP). This enables its participation in microtubular dynenin-dynactin-mediated repositioning of lysosomes from the cell periphery to the Golgi. A Rab34 (Rah) isoform that lacks the consensus GTP-binding region has been identified in mice. This isoform is associated with membrane ruffles and promotes macropinosome formation. Rab36 has been mapped to human chromosome 22q11.2, a region that is homozygously deleted in malignant rhabdoid tumors (MRTs). However, experimental assessments do not implicate Rab36 as a tumor suppressor that would enable tumor formation through a loss-of-function mechanism. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further re

>CHL00081 chlI Mg-protoporyphyrin IX chelatase

Probab=94.83  E-value=0.0057  Score=48.10  Aligned_cols=20  Identities=25%  Similarity=0.321  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|+||||+|+.+++-.
T Consensus        43 i~G~~GtGKs~~ar~~~~~l   62 (350)
T CHL00081         43 IMGDRGTGKSTTIRALVDLL   62 (350)
T ss_pred             EEcCCCCCHHHHHHHHHHHH
Confidence            99999999999999997765

>PRK14237 phosphate transporter ATP-binding protein; Provisional

Probab=94.83  E-value=0.017  Score=43.39  Aligned_cols=20  Identities=30%  Similarity=0.207  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+....
T Consensus        51 I~G~nGsGKSTLl~~l~Gl~   70 (267)
T PRK14237         51 LIGPSGSGKSTYLRSLNRMN   70 (267)
T ss_pred             EECCCCCCHHHHHHHHHhcc
Confidence            99999999999999998754

>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.83  E-value=0.017  Score=42.77  Aligned_cols=19  Identities=26%  Similarity=0.253  Sum_probs=17.6

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|..|.|||||++.+...
T Consensus        34 i~G~nGsGKSTLl~~l~Gl   52 (250)
T PRK14266         34 LIGPSGCGKSTFIRTLNRM   52 (250)
T ss_pred             EECCCCCCHHHHHHHHHhh
Confidence            9999999999999999853

>cd01131 PilT Pilus retraction ATPase PilT

Probab=94.82  E-value=0.017  Score=41.52  Aligned_cols=20  Identities=30%  Similarity=0.310  Sum_probs=16.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+||||+++.+....
T Consensus         6 I~GptGSGKTTll~~ll~~~   25 (198)
T cd01131           6 VTGPTGSGKSTTLAAMIDYI   25 (198)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            88999999999999765444

PilT is a nucleotide binding protein responsible for the retraction of type IV pili, likely by pili disassembly. This retraction provides the force required for travel of bacteria in low water environments by a mechanism known as twitching motility.

>TIGR00041 DTMP_kinase thymidylate kinase

Probab=94.82  E-value=0.018  Score=40.77  Aligned_cols=20  Identities=25%  Similarity=0.277  Sum_probs=18.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |-|.-|+||||+++.+.+..
T Consensus         8 ieG~~GsGKsT~~~~L~~~l   27 (195)
T TIGR00041         8 IEGIDGAGKTTQANLLKKLL   27 (195)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            88999999999999999877

Function: phosphorylation of DTMP to form DTDP in both de novo and salvage pathways of DTTP synthesis. Catalytic activity: ATP + thymidine 5'-phosphate = ADP + thymidine 5'-diphosphate.

>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]

Probab=94.81  E-value=0.016  Score=43.67  Aligned_cols=20  Identities=30%  Similarity=0.318  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||+|.+-.-.
T Consensus        35 iiGPNGaGKSTLlK~iLGll   54 (254)
T COG1121          35 LIGPNGAGKSTLLKAILGLL   54 (254)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999987743

>cd01858 NGP_1 NGP-1

Probab=94.81  E-value=0.016  Score=39.92  Aligned_cols=20  Identities=20%  Similarity=0.200  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|+.|+||+||...+..+.
T Consensus       107 ~~G~~nvGKStliN~l~~~~  126 (157)
T cd01858         107 FIGYPNVGKSSIINTLRSKK  126 (157)
T ss_pred             EEeCCCCChHHHHHHHhcCC
Confidence            99999999999999997754

Autoantigen NGP-1 (Nucleolar G-protein gene 1) has been shown to localize in the nucleolus and nucleolar organizers in all cell types analyzed, which is indicative of a function in ribosomal assembly. NGP-1 and its homologs show a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with NKXD motif) are relocated to the N terminus.

>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional

Probab=94.81  E-value=0.016  Score=43.61  Aligned_cols=20  Identities=25%  Similarity=0.233  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        55 liG~NGsGKSTLlk~L~Gl~   74 (264)
T PRK13546         55 LVGINGSGKSTLSNIIGGSL   74 (264)
T ss_pred             EECCCCCCHHHHHHHHhCCc
Confidence            99999999999999998864

>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1)

Probab=94.81  E-value=0.017  Score=41.54  Aligned_cols=20  Identities=25%  Similarity=0.295  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+..-.
T Consensus        39 i~G~nGsGKSTLl~~l~Gl~   58 (207)
T cd03369          39 IVGRTGAGKSTLILALFRFL   58 (207)
T ss_pred             EECCCCCCHHHHHHHHhccc
Confidence            99999999999999997643

NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters. Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.

>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules

Probab=94.80  E-value=0.017  Score=42.01  Aligned_cols=20  Identities=25%  Similarity=0.238  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+....
T Consensus        45 i~G~nGsGKSTLl~~l~Gl~   64 (226)
T cd03248          45 LVGPSGSGKSTVVALLENFY   64 (226)
T ss_pred             EECCCCCCHHHHHHHHhcCc
Confidence            99999999999999998754

Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells. Subsequently, virus-infected or malignantly transformed cells can be eliminated. TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif

Probab=94.80  E-value=0.017  Score=41.12  Aligned_cols=35  Identities=14%  Similarity=0.071  Sum_probs=25.6

Q ss_pred             ccccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC
Q 042811           89 NWPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR  126 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS  126 (130)
                      +.++|..|+|||.||..+-+..++  +... +.++.++
T Consensus        50 l~l~G~~G~GKThLa~ai~~~~~~--~g~~-v~f~~~~   84 (178)
T PF01695_consen   50 LILYGPPGTGKTHLAVAIANEAIR--KGYS-VLFITAS   84 (178)
T ss_dssp             EEEEESTTSSHHHHHHHHHHHHHH--TT---EEEEEHH
T ss_pred             EEEEhhHhHHHHHHHHHHHHHhcc--CCcc-eeEeecC
Confidence            449999999999999999998743  4444 4666543

They are found associated with IS21 family insertion sequences []. Functionally they have not been characterised, but they may be involved in transposition [].; GO: 0005524 ATP binding; PDB: 3EC2_A 3ECC_A 2W58_A 2QGZ_A.

>cd01870 RhoA_like RhoA-like subfamily

Probab=94.80  E-value=0.017  Score=39.74  Aligned_cols=22  Identities=18%  Similarity=0.012  Sum_probs=18.4

Q ss_pred             CccccCcCCCchhHHHHhhhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~~  109 (130)
                      ++.|+|-.|+|||||+..+.+.
T Consensus         3 ki~iiG~~~~GKTsl~~~~~~~   24 (175)
T cd01870           3 KLVIVGDGACGKTCLLIVFSKD   24 (175)
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            3458999999999999998764

The RhoA subfamily consists of RhoA, RhoB, and RhoC. RhoA promotes the formation of stress fibers and focal adhesions, regulating cell shape, attachment, and motility. RhoA can bind to multiple effector proteins, thereby triggering different downstream responses. In many cell types, RhoA mediates local assembly of the contractile ring, which is necessary for cytokinesis. RhoA is vital for muscle contraction; in vascular smooth muscle cells, RhoA plays a key role in cell contraction, differentiation, migration, and proliferation. RhoA activities appear to be elaborately regulated in a time- and space-dependent manner to control cytoskeletal changes. Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho proteins. RhoA and RhoC are observed only in geranyl

>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=94.80  E-value=0.017  Score=43.48  Aligned_cols=20  Identities=25%  Similarity=0.147  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|+|||||++.+..-.
T Consensus        40 l~G~nGsGKSTLl~~l~Gl~   59 (271)
T PRK13632         40 ILGHNGSGKSTISKILTGLL   59 (271)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999998754

>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK

Probab=94.79  E-value=0.017  Score=42.83  Aligned_cols=20  Identities=30%  Similarity=0.243  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+....
T Consensus        34 i~G~nGsGKSTLl~~l~G~~   53 (253)
T TIGR02323        34 IVGESGSGKSTLLGCLAGRL   53 (253)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999987764

Members of this family are the PhnK protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated complex. This protein (PhnK) and the adjacent-encoded PhnL resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this complex rather than part of a transporter per se.

>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD

Probab=94.79  E-value=0.017  Score=42.45  Aligned_cols=20  Identities=25%  Similarity=0.275  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        33 l~G~nGsGKSTLl~~l~G~~   52 (242)
T TIGR03411        33 IIGPNGAGKTTMMDVITGKT   52 (242)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.

>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=94.79  E-value=0.017  Score=43.72  Aligned_cols=20  Identities=25%  Similarity=0.235  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|.|||||++.+..-.
T Consensus        38 i~G~nGsGKSTLl~~l~Gl~   57 (279)
T PRK13650         38 IIGHNGSGKSTTVRLIDGLL   57 (279)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999998754

>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional

Probab=94.79  E-value=0.016  Score=43.18  Aligned_cols=20  Identities=30%  Similarity=0.263  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+....
T Consensus        35 i~G~nGsGKSTLl~~i~G~~   54 (262)
T PRK09984         35 LLGPSGSGKSTLLRHLSGLI   54 (262)
T ss_pred             EECCCCCCHHHHHHHHhccC
Confidence            99999999999999998754

>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional

Probab=94.79  E-value=0.016  Score=43.35  Aligned_cols=20  Identities=30%  Similarity=0.283  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|.|||||++.+....
T Consensus        38 i~G~nGsGKSTLl~~i~G~~   57 (265)
T PRK10253         38 IIGPNGCGKSTLLRTLSRLM   57 (265)
T ss_pred             EECCCCCCHHHHHHHHcCCC
Confidence            99999999999999998764

>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.77  E-value=0.017  Score=42.73  Aligned_cols=19  Identities=32%  Similarity=0.184  Sum_probs=17.6

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|..|.|||||++.+...
T Consensus        36 I~G~nGsGKSTLl~~i~G~   54 (251)
T PRK14244         36 FIGPSGCGKSTFLRCFNRM   54 (251)
T ss_pred             EECCCCCCHHHHHHHHHhh
Confidence            9999999999999999764

>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.77  E-value=0.017  Score=42.74  Aligned_cols=20  Identities=30%  Similarity=0.160  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|.|||||++.+....
T Consensus        35 i~G~nGsGKSTLl~~l~Gl~   54 (251)
T PRK14251         35 LIGPSGCGKSTFLRCLNRMN   54 (251)
T ss_pred             EECCCCCCHHHHHHHHhhcc
Confidence            99999999999999998754

>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional

Probab=94.77  E-value=0.017  Score=43.25  Aligned_cols=20  Identities=35%  Similarity=0.556  Sum_probs=15.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-|||||||++-++-.-.
T Consensus         7 v~~KGGVGKTT~~~nLA~~l   26 (270)
T PRK13185          7 VYGKGGIGKSTTSSNLSAAF   26 (270)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            55899999999887765544

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH

Probab=94.76  E-value=0.019  Score=46.92  Aligned_cols=21  Identities=24%  Similarity=0.142  Sum_probs=19.0

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++|..|+||||||+.+.+..
T Consensus        92 LL~GppGtGKT~la~alA~~~  112 (495)
T TIGR01241        92 LLVGPPGTGKTLLAKAVAGEA  112 (495)
T ss_pred             EEECCCCCCHHHHHHHHHHHc
Confidence            399999999999999998865

HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH.

>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed

Probab=94.76  E-value=0.018  Score=44.40  Aligned_cols=20  Identities=25%  Similarity=0.252  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+||.|+||||+++.+....
T Consensus       138 l~G~~GsGKStvg~~La~~L  157 (309)
T PRK08154        138 LIGLRGAGKSTLGRMLAARL  157 (309)
T ss_pred             EECCCCCCHHHHHHHHHHHc
Confidence            99999999999999987653

>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional

Probab=94.75  E-value=0.017  Score=42.33  Aligned_cols=20  Identities=30%  Similarity=0.365  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        36 i~G~nGsGKSTLl~~l~G~~   55 (237)
T PRK11614         36 LIGANGAGKTTLLGTLCGDP   55 (237)
T ss_pred             EECCCCCCHHHHHHHHcCCC
Confidence            99999999999999997654

>PRK14974 cell division protein FtsY; Provisional

Probab=94.75  E-value=0.025  Score=44.26  Aligned_cols=20  Identities=35%  Similarity=0.434  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|+.|+||||++.++....
T Consensus       145 ~~G~~GvGKTTtiakLA~~l  164 (336)
T PRK14974        145 FVGVNGTGKTTTIAKLAYYL  164 (336)
T ss_pred             EEcCCCCCHHHHHHHHHHHH
Confidence            99999999999888888766

>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.74  E-value=0.017  Score=43.61  Aligned_cols=20  Identities=30%  Similarity=0.217  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        52 I~G~nGsGKSTLl~~l~Gl~   71 (276)
T PRK14271         52 LMGPTGSGKTTFLRTLNRMN   71 (276)
T ss_pred             EECCCCCCHHHHHHHHhccC
Confidence            99999999999999998754

>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional

Probab=94.74  E-value=0.017  Score=45.65  Aligned_cols=20  Identities=30%  Similarity=0.109  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+..-.
T Consensus        34 l~G~nGsGKSTLL~~iaGl~   53 (369)
T PRK11000         34 FVGPSGCGKSTLLRMIAGLE   53 (369)
T ss_pred             EECCCCCcHHHHHHHHhCCC
Confidence            99999999999999998754

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional

Probab=94.74  E-value=0.032  Score=46.34  Aligned_cols=20  Identities=35%  Similarity=0.541  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|.+|+||||++.++...+
T Consensus       355 LVGPtGvGKTTtaakLAa~l  374 (559)
T PRK12727        355 LVGPTGAGKTTTIAKLAQRF  374 (559)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            99999999999999987765

>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]

Probab=94.73  E-value=0.016  Score=43.96  Aligned_cols=20  Identities=25%  Similarity=0.018  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|+|||||++.|-.-.
T Consensus        44 lVGESG~GKSTlgr~i~~L~   63 (268)
T COG4608          44 LVGESGCGKSTLGRLILGLE   63 (268)
T ss_pred             EEecCCCCHHHHHHHHHcCc
Confidence            99999999999999987754

>TIGR01420 pilT_fam pilus retraction protein PilT

Probab=94.73  E-value=0.033  Score=43.54  Aligned_cols=20  Identities=30%  Similarity=0.318  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+||||+++.+.+..
T Consensus       127 i~G~tGSGKTT~l~al~~~i  146 (343)
T TIGR01420       127 VTGPTGSGKSTTLASMIDYI  146 (343)
T ss_pred             EECCCCCCHHHHHHHHHHhh
Confidence            99999999999999987754

This model represents the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway). PilT is an apparent cytosolic ATPase associated with type IV pilus systems. It is not required for pilin biogenesis, but is required for twitching motility and social gliding behaviors, shown in some species, powered by pilus retraction. Members of this family may be found in some species that type IV pili but have related structures for DNA uptake and natural transformation.

>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit

Probab=94.73  E-value=0.017  Score=47.33  Aligned_cols=20  Identities=30%  Similarity=0.210  Sum_probs=17.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+..-.
T Consensus       366 IvG~SGsGKSTLl~lL~g~~  385 (529)
T TIGR02868       366 ILGPSGSGKSTLLMLLTGLL  385 (529)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999986544

The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain (pfam00664) and a C-terminal ATP-binding domain (pfam00005). In E. coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in export of redox-active thiol compounds such as cysteine and glutathione. The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this model are all either found in the gammproteobacterial context or the CydABCD context. All members of this family scoring above trusted at the time of its creation were from genomes which encode a cytochrome bd complex.

>cd04134 Rho3 Rho3 subfamily

Probab=94.72  E-value=0.018  Score=40.69  Aligned_cols=19  Identities=21%  Similarity=0.106  Sum_probs=16.2

Q ss_pred             ccccCcCCCchhHHHHhhh
Q 042811           89 NWPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~  107 (130)
                      +.|+|-+|+|||||++.+.
T Consensus         3 ivivG~~~vGKTsli~~~~   21 (189)
T cd04134           3 VVVLGDGACGKTSLLNVFT   21 (189)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            4478999999999998864

Rho3 is a member of the Rho family found only in fungi. Rho3 is believed to regulate cell polarity by interacting with the diaphanous/formin family protein For3 to control both the actin cytoskeleton and microtubules. Rho3 is also believed to have a direct role in exocytosis that is independent of its role in regulating actin polarity. The function in exocytosis may be two-pronged: first, in the transport of post-Golgi vesicles from the mother cell to the bud, mediated by myosin (Myo2); second, in the docking and fusion of vesicles to the plasma membrane, mediated by an exocyst (Exo70) protein. Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.

>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=94.72  E-value=0.018  Score=43.22  Aligned_cols=20  Identities=25%  Similarity=0.066  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+..-.
T Consensus        40 I~G~nGsGKSTLl~~i~Gl~   59 (269)
T PRK13648         40 IVGHNGSGKSTIAKLMIGIE   59 (269)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999998754

>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor

Probab=94.72  E-value=0.018  Score=43.15  Aligned_cols=20  Identities=30%  Similarity=0.403  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|.|||||++.+..-.
T Consensus        31 IvG~nGsGKSTLlk~l~Gl~   50 (255)
T cd03236          31 LVGPNGIGKSTALKILAGKL   50 (255)
T ss_pred             EECCCCCCHHHHHHHHhCCc
Confidence            99999999999999987765

The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated

Probab=94.72  E-value=0.017  Score=46.56  Aligned_cols=21  Identities=38%  Similarity=0.507  Sum_probs=18.0

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++|.+|+||||++.++-...
T Consensus       225 ~~vGptGvGKTTt~~kLA~~~  245 (424)
T PRK05703        225 ALVGPTGVGKTTTLAKLAARY  245 (424)
T ss_pred             EEECCCCCCHHHHHHHHHHHH
Confidence            399999999999998886655

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional

Probab=94.71  E-value=0.014  Score=50.33  Aligned_cols=20  Identities=25%  Similarity=0.180  Sum_probs=18.6

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|-.|+|||+||+.+....
T Consensus       212 LvGppGvGKT~lae~la~~i  231 (758)
T PRK11034        212 LVGESGVGKTAIAEGLAWRI  231 (758)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            99999999999999998765

>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit

Probab=94.71  E-value=0.018  Score=42.02  Aligned_cols=20  Identities=30%  Similarity=0.333  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        11 l~G~nGsGKSTLl~~l~G~~   30 (223)
T TIGR03771        11 LLGPNGAGKTTLLRAILGLI   30 (223)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            89999999999999998754

This protein family is the ATP-binding cassette subunit of binding protein-dependent ABC transporter complex that strictly co-occurs with TIGR03769. TIGRFAMs model TIGR03769 describes a protein domain that occurs singly or as one of up to three repeats in proteins of a number of Actinobacteria, including Propionibacterium acnes KPA171202. The TIGR03769 domain occurs both in an adjacent gene for the substrate-binding protein and in additional (often nearby) proteins, often with LPXTG-like sortase recognition signals. Homologous ATP-binding subunits outside the scope of this family include manganese transporter MntA in Synechocystis sp. PCC 6803 and chelated iron transporter subunits. The function of this transporter complex is unknown.

>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules

Probab=94.71  E-value=0.019  Score=39.44  Aligned_cols=20  Identities=30%  Similarity=0.243  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+....
T Consensus        30 i~G~nGsGKStll~~l~g~~   49 (157)
T cd00267          30 LVGPNGSGKSTLLRAIAGLL   49 (157)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998854

The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK11144 modC molybdate transporter ATP-binding protein; Provisional

Probab=94.71  E-value=0.017  Score=45.22  Aligned_cols=20  Identities=25%  Similarity=0.293  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+..-.
T Consensus        29 l~G~nGsGKSTLl~~iaGl~   48 (352)
T PRK11144         29 IFGRSGAGKTSLINAISGLT   48 (352)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

>PRK13236 nitrogenase reductase; Reviewed

Probab=94.70  E-value=0.017  Score=44.14  Aligned_cols=20  Identities=25%  Similarity=0.491  Sum_probs=16.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|-|||||||++-.+---.
T Consensus        11 ~~GKGGVGKTt~a~NLA~~L   30 (296)
T PRK13236         11 FYGKGGIGKSTTSQNTLAAM   30 (296)
T ss_pred             EECCCcCCHHHHHHHHHHHH
Confidence            89999999999887765544

>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional

Probab=94.70  E-value=0.017  Score=44.86  Aligned_cols=24  Identities=25%  Similarity=0.154  Sum_probs=19.9

Q ss_pred             CCcc-ccCcCCCchhHHHHhhhhhh
Q 042811           87 GNNW-PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        87 ~~l~-I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++. |+|-.|+|||||++.+..-.
T Consensus        33 Ge~~~lvG~sGsGKSTL~~~l~Gll   57 (326)
T PRK11022         33 GEVVGIVGESGSGKSVSSLAIMGLI   57 (326)
T ss_pred             CCEEEEECCCCChHHHHHHHHHcCC
Confidence            3444 99999999999999998754

>PRK10865 protein disaggregation chaperone; Provisional

Probab=94.70  E-value=0.0078  Score=52.41  Aligned_cols=32  Identities=19%  Similarity=0.194  Sum_probs=25.3

Q ss_pred             eeecccCCCCc------------cccCcCCCchhHHHHhhhhhh
Q 042811           79 KLGDVRRNGNN------------WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        79 ivG~~~~~~~l------------~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|++..+..+            +++|-.|+||||||+.+-...
T Consensus       180 vigr~~ei~~~i~iL~r~~~~n~lL~G~pGvGKT~l~~~la~~i  223 (857)
T PRK10865        180 VIGRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRI  223 (857)
T ss_pred             CCCCHHHHHHHHHHHhcCCcCceEEECCCCCCHHHHHHHHHHHh
Confidence            58887643332            299999999999999988865

>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit

Probab=94.70  E-value=0.018  Score=41.80  Aligned_cols=20  Identities=30%  Similarity=0.288  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|.|||||++.+....
T Consensus        31 i~G~nGsGKSTLl~~l~G~~   50 (223)
T TIGR03740        31 LLGPNGAGKSTLLKMITGIL   50 (223)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

Model TIGR03731 represents the family of all lantibiotics related to gallidermin, including epidermin, mutatin, and nisin. This protein family describes the ATP-binding subunit of a gallidermin/epidermin class lantibiotic protection transporter. It is largely restricted to gallidermin-family lantibiotic biosynthesis and export cassettes, but also occurs in orphan transporter cassettes in species that lack candidate lantibiotic precursor and synthetase genes.

>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II []

Probab=94.69  E-value=0.018  Score=43.69  Aligned_cols=21  Identities=19%  Similarity=0.099  Sum_probs=16.6

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +|+|..|+||||+|+.+-..+
T Consensus         5 il~G~P~SGKTt~a~~L~~~~   25 (270)
T PF08433_consen    5 ILCGLPCSGKTTRAKELKKYL   25 (270)
T ss_dssp             EEE--TTSSHHHHHHHHHHHH
T ss_pred             EEEcCCCCcHHHHHHHHHHHH
Confidence            389999999999999998765

The Elongator complex has histone acetyltransferase activity. ; PDB: 3ADB_B 3ADC_B 3A4M_B 3A4N_B 3AM1_A 3A4L_B 3ADD_A.

>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.69  E-value=0.019  Score=42.46  Aligned_cols=19  Identities=32%  Similarity=0.244  Sum_probs=17.8

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|-.|.|||||++.+...
T Consensus        33 i~G~nGsGKSTLl~~l~Gl   51 (246)
T PRK14269         33 LIGASGCGKSTFLRCFNRM   51 (246)
T ss_pred             EECCCCCCHHHHHHHHhcc
Confidence            9999999999999999874

>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]

Probab=94.68  E-value=0.019  Score=42.74  Aligned_cols=24  Identities=29%  Similarity=0.300  Sum_probs=20.4

Q ss_pred             CCcc-ccCcCCCchhHHHHhhhhhh
Q 042811           87 GNNW-PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        87 ~~l~-I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++. +.|..|+|||||++.|..-.
T Consensus        29 Geiv~llG~NGaGKTTlLkti~Gl~   53 (237)
T COG0410          29 GEIVALLGRNGAGKTTLLKTIMGLV   53 (237)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCCC
Confidence            3444 99999999999999998865

>PRK10416 signal recognition particle-docking protein FtsY; Provisional

Probab=94.68  E-value=0.018  Score=44.73  Aligned_cols=21  Identities=38%  Similarity=0.620  Sum_probs=19.0

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++|..|+||||++.++....
T Consensus       118 ~lvGpnGsGKTTt~~kLA~~l  138 (318)
T PRK10416        118 LVVGVNGVGKTTTIGKLAHKY  138 (318)
T ss_pred             EEECCCCCcHHHHHHHHHHHH
Confidence            389999999999999998876

>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional

Probab=94.68  E-value=0.022  Score=47.20  Aligned_cols=25  Identities=16%  Similarity=0.121  Sum_probs=20.7

Q ss_pred             CCCccccCcCCCchhHHHHhhhhhh
Q 042811           86 NGNNWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        86 ~~~l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ...+.++||.|+||||+.+.+-+..
T Consensus         6 ~~~i~LiG~~GaGKttvg~~LA~~L   30 (542)
T PRK14021          6 RPQAVIIGMMGAGKTRVGKEVAQMM   30 (542)
T ss_pred             CccEEEECCCCCCHHHHHHHHHHHh
Confidence            3445599999999999999998765

>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]

Probab=94.67  E-value=0.018  Score=47.71  Aligned_cols=20  Identities=25%  Similarity=0.111  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|+||||||+.+-.-.
T Consensus       322 lVGeSGsGKSTlar~i~gL~  341 (539)
T COG1123         322 LVGESGSGKSTLARILAGLL  341 (539)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999987644

>cd03110 Fer4_NifH_child This protein family's function is unkown

Probab=94.67  E-value=0.019  Score=40.21  Aligned_cols=15  Identities=33%  Similarity=0.355  Sum_probs=12.9

Q ss_pred             cCcCCCchhHHHHhh
Q 042811           92 FGVEGVGKITSLSKS  106 (130)
Q Consensus        92 ~GmGGvGKTTLak~v  106 (130)
                      -|-||+||||++-++
T Consensus         6 s~kgG~GKSt~a~nL   20 (179)
T cd03110           6 SGKGGTGKTTVTAAL   20 (179)
T ss_pred             cCCCCCCHHHHHHHH
Confidence            478999999998775

It contains nucleotide binding site. It uses NTP as energy source to transfer electron or ion.

>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains

Probab=94.67  E-value=0.019  Score=41.91  Aligned_cols=17  Identities=24%  Similarity=0.360  Sum_probs=16.0

Q ss_pred             ccCcCCCchhHHHHhhh
Q 042811           91 PFGVEGVGKITSLSKSY  107 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~  107 (130)
                      |+|..|.|||||.+.|.
T Consensus        30 ivGpNGaGKSTll~~i~   46 (212)
T cd03274          30 IVGPNGSGKSNVIDSML   46 (212)
T ss_pred             EECCCCCCHHHHHHHHH
Confidence            99999999999999975

Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo

>PRK03695 vitamin B12-transporter ATPase; Provisional

Probab=94.66  E-value=0.019  Score=42.66  Aligned_cols=19  Identities=32%  Similarity=0.324  Sum_probs=17.4

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|-.|.|||||++.+..-
T Consensus        27 l~G~nGsGKSTLl~~l~Gl   45 (248)
T PRK03695         27 LVGPNGAGKSTLLARMAGL   45 (248)
T ss_pred             EECCCCCCHHHHHHHHcCC
Confidence            9999999999999998764

>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein

Probab=94.66  E-value=0.018  Score=45.10  Aligned_cols=20  Identities=30%  Similarity=0.240  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        28 l~G~nGsGKSTLl~~iaGl~   47 (354)
T TIGR02142        28 IFGRSGSGKTTLIRLIAGLT   47 (354)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999997754

This model represents the ATP-binding cassette (ABC) protein of the three subunit molybdate ABC transporter. The three proteins of this complex are homologous to proteins of the sulfate ABC transporter. Molybdenum may be used in nitrogenases of nitrogen-fixing bacteria and in molybdopterin cofactors. In some cases, molybdate may be transported by a sulfate transporter rather than by a specific molybdate transporter.

>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR)

Probab=94.64  E-value=0.019  Score=41.02  Aligned_cols=19  Identities=32%  Similarity=0.319  Sum_probs=17.6

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|..|.|||||++.+..-
T Consensus        40 l~G~nGsGKStLl~~i~Gl   58 (194)
T cd03213          40 IMGPSGAGKSTLLNALAGR   58 (194)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            9999999999999998774

DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.

>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.63  E-value=0.019  Score=43.63  Aligned_cols=19  Identities=32%  Similarity=0.265  Sum_probs=17.7

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|.|||||++.+..-
T Consensus        70 l~G~nGsGKSTLl~~L~Gl   88 (286)
T PRK14275         70 IIGPSGCGKSTFLRAINRM   88 (286)
T ss_pred             EECCCCCCHHHHHHHHhcc
Confidence            9999999999999999873

>PRK04220 2-phosphoglycerate kinase; Provisional

Probab=94.63  E-value=0.02  Score=44.15  Aligned_cols=20  Identities=25%  Similarity=0.175  Sum_probs=18.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+||||||+.+....
T Consensus        97 I~G~sgsGKStlA~~La~~l  116 (301)
T PRK04220         97 IGGASGVGTSTIAFELASRL  116 (301)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            99999999999999998876

>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI

Probab=94.63  E-value=0.019  Score=43.93  Aligned_cols=20  Identities=25%  Similarity=0.223  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+....
T Consensus        35 l~G~NGaGKSTLl~~l~Gl~   54 (303)
T TIGR01288        35 LLGPNGAGKSTIARMLLGMI   54 (303)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999997754

This model does not recognize the highly divergent NodI from Azorhizobium caulinodans.

>smart00072 GuKc Guanylate kinase homologues

Probab=94.63  E-value=0.021  Score=40.50  Aligned_cols=20  Identities=40%  Similarity=0.393  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+....
T Consensus         7 l~Gpsg~GK~tl~~~L~~~~   26 (184)
T smart00072        7 LSGPSGVGKGTLLAELIQEI   26 (184)
T ss_pred             EECCCCCCHHHHHHHHHhcC
Confidence            89999999999999997763

Active enzymes catalyze ATP-dependent phosphorylation of GMP to GDP. Structure resembles that of adenylate kinase. So-called membrane-associated guanylate kinase homologues (MAGUKs) do not possess guanylate kinase activities; instead at least some possess protein-binding functions.

>cd04116 Rab9 Rab9 subfamily

Probab=94.63  E-value=0.02  Score=39.26  Aligned_cols=20  Identities=25%  Similarity=0.326  Sum_probs=16.8

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.++|-.|+|||||+..+-+
T Consensus         8 i~vvG~~~~GKTsli~~~~~   27 (170)
T cd04116           8 VILLGDGGVGKSSLMNRYVT   27 (170)
T ss_pred             EEEECCCCCCHHHHHHHHHc
Confidence            34899999999999988744

Rab9 is found in late endosomes, together with mannose 6-phosphate receptors (MPRs) and the tail-interacting protein of 47 kD (TIP47). Rab9 is a key mediator of vesicular transport from late endosomes to the trans-Golgi network (TGN) by redirecting the MPRs. Rab9 has been identified as a key component for the replication of several viruses, including HIV1, Ebola, Marburg, and measles, making it a potential target for inhibiting a variety of viruses. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CX

>PRK05564 DNA polymerase III subunit delta'; Validated

Probab=94.62  E-value=0.013  Score=44.94  Aligned_cols=34  Identities=18%  Similarity=0.128  Sum_probs=25.6

Q ss_pred             ccCcCCCchhHHHHhhhhhhhh---ccCCCCeEEEEE
Q 042811           91 PFGVEGVGKITSLSKSYPEFLE---DEGIFLIKMHDV  124 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~---~~~~Fd~~~wv~  124 (130)
                      ++|..|+||||||+.+.+....   ...|+|...|..
T Consensus        31 f~G~~G~Gk~~la~~~a~~l~c~~~~~~h~D~~~~~~   67 (313)
T PRK05564         31 IVGEDGIGKSLLAKEIALKILGKSQQREYVDIIEFKP   67 (313)
T ss_pred             eECCCCCCHHHHHHHHHHHHcCCCCCCCCCCeEEecc
Confidence            9999999999999998875421   235778766654

>cd03112 CobW_like The function of this protein family is unkown

Probab=94.62  E-value=0.019  Score=39.87  Aligned_cols=19  Identities=37%  Similarity=0.406  Sum_probs=16.1

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|+-|.|||||.+.+...
T Consensus         5 l~G~~GsGKTtl~~~l~~~   23 (158)
T cd03112           5 LTGFLGAGKTTLLNHILTE   23 (158)
T ss_pred             EEECCCCCHHHHHHHHHhc
Confidence            6899999999999976544

The amino acid sequence of YjiA protein in E. coli contains several conserved motifs that characterizes it as a P-loop GTPase. YijA gene is among the genes significantly induced in response to DNA-damage caused by mitomycin. YijA gene is a homologue of the CobW gene which encodes the cobalamin synthesis protein/P47K.

>PRK14526 adenylate kinase; Provisional

Probab=94.62  E-value=0.021  Score=41.70  Aligned_cols=20  Identities=25%  Similarity=0.009  Sum_probs=17.1

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|.|..|+||||+++.+..
T Consensus         3 i~l~G~pGsGKsT~a~~La~   22 (211)
T PRK14526          3 LVFLGPPGSGKGTIAKILSN   22 (211)
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            44789999999999998764

>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]

Probab=94.61  E-value=0.018  Score=49.24  Aligned_cols=19  Identities=32%  Similarity=0.209  Sum_probs=17.1

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|-.|+|||||+|.+-+-
T Consensus       504 IvG~SGsGKSTL~KLL~gl  522 (709)
T COG2274         504 IVGRSGSGKSTLLKLLLGL  522 (709)
T ss_pred             EECCCCCCHHHHHHHHhcC
Confidence            9999999999999997553

>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A

Probab=94.61  E-value=0.019  Score=40.28  Aligned_cols=18  Identities=33%  Similarity=0.364  Sum_probs=16.3

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |+|..|.|||||+..|.-
T Consensus        24 i~G~Ng~GKStil~ai~~   41 (202)
T PF13476_consen   24 IYGPNGSGKSTILEAIRY   41 (202)
T ss_dssp             EEESTTSSHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHH
Confidence            999999999999998744

>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.60  E-value=0.02  Score=42.37  Aligned_cols=20  Identities=30%  Similarity=0.275  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|.|||||++.+....
T Consensus        35 i~G~nGsGKSTLl~~i~G~~   54 (252)
T PRK14272         35 LIGPSGCGKTTFLRAINRMH   54 (252)
T ss_pred             EECCCCCCHHHHHHHHhccC
Confidence            99999999999999998753

>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=94.60  E-value=0.02  Score=43.22  Aligned_cols=20  Identities=25%  Similarity=0.243  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+....
T Consensus        33 l~G~nGsGKSTLl~~i~Gl~   52 (275)
T PRK13639         33 LLGPNGAGKSTLFLHFNGIL   52 (275)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999997754

>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional

Probab=94.60  E-value=0.019  Score=43.02  Aligned_cols=20  Identities=25%  Similarity=0.145  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|.|||||++.+..-.
T Consensus        44 i~G~NGsGKSTLl~~l~Gl~   63 (267)
T PRK15112         44 IIGENGSGKSTLAKMLAGMI   63 (267)
T ss_pred             EEcCCCCCHHHHHHHHhCCC
Confidence            99999999999999997754

---

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Length	Definition	Probability
Query	130
2a5y_B	549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	99.34
1vt4_I	1221	APAF-1 related killer DARK; drosophila apoptosome,	98.99
1z6t_A	591	APAF-1, apoptotic protease activating factor 1; ca	98.87
3sfz_A	1249	APAF-1, apoptotic peptidase activating factor 1; a	98.85
2w58_A	202	DNAI, primosome component (helicase loader); ATP-b	97.47
1jbk_A	195	CLPB protein; beta barrel, chaperone; 1.80A {Esche	97.35
2qen_A	350	Walker-type ATPase; unknown function; HET: ADP; 2.	97.34
2qby_A	386	CDC6 homolog 1, cell division control protein 6 ho	97.25
3ec2_A	180	DNA replication protein DNAC; helicase loader, rep	97.16
3lw7_A	179	Adenylate kinase related protein (ADKA-like); AMP,	97.06
1qhx_A	178	CPT, protein (chloramphenicol phosphotransferase);	97.06
3bos_A	242	Putative DNA replication factor; P-loop containing	97.05
1w5s_A	412	Origin recognition complex subunit 2 ORC2; replica	97.03
1njg_A	250	DNA polymerase III subunit gamma; rossman-like fol	96.99
3kb2_A	173	SPBC2 prophage-derived uncharacterized protein YOR	96.93
1zp6_A	191	Hypothetical protein ATU3015; alpha-beta protein.,	96.9
3vaa_A	199	Shikimate kinase, SK; structural genomics, center	96.89
1kag_A	173	SKI, shikimate kinase I; transferase, structural g	96.86
2fna_A	357	Conserved hypothetical protein; structural genomic	96.86
3trf_A	185	Shikimate kinase, SK; amino acid biosynthesis, tra	96.82
1ly1_A	181	Polynucleotide kinase; PNK, phosphatase, transfera	96.8
2p65_A	187	Hypothetical protein PF08_0063; CLPB, malaria, str	96.79
3iij_A	180	Coilin-interacting nuclear ATPase protein; alpha a	96.79
1kgd_A	180	CASK, peripheral plasma membrane CASK; maguk, guan	96.77
2v1u_A	387	Cell division control protein 6 homolog; DNA repli	96.77
2chg_A	226	Replication factor C small subunit; DNA-binding pr	96.77
3qfl_A	115	MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-	96.76
2jaq_A	205	Deoxyguanosine kinase; transferase, deoxyribonucle	96.75
2qby_B	384	CDC6 homolog 3, cell division control protein 6 ho	96.74
1kht_A	192	Adenylate kinase; phosphotransferase, signaling pr	96.73
3n70_A	145	Transport activator; sigma-54, ntpase, PSI, MCSG,	96.73
3t61_A	202	Gluconokinase; PSI-biology, structural genomics, p	96.7
2kjq_A	149	DNAA-related protein; solution structure, NESG, st	96.69
1l8q_A	324	Chromosomal replication initiator protein DNAA; AA	96.69
1nks_A	194	Adenylate kinase; thermophilic, transferase; HET:	96.69
2qor_A	204	Guanylate kinase; phosphotransferase, purine metab	96.68
1knq_A	175	Gluconate kinase; ALFA/beta structure, transferase	96.68
1via_A	175	Shikimate kinase; structural genomics, transferase	96.67
2bdt_A	189	BH3686; alpha-beta protein, structural genomics, P	96.66
1ye8_A	178	Protein THEP1, hypothetical UPF0334 kinase-like pr	96.65
3h4m_A	285	Proteasome-activating nucleotidase; ATPase, PAN, A	96.64
3uie_A	200	Adenylyl-sulfate kinase 1, chloroplastic; rossmann	96.64
2rhm_A	193	Putative kinase; P-loop containing nucleoside trip	96.61
4eun_A	200	Thermoresistant glucokinase; putative sugar kinase	96.61
2yvu_A	186	Probable adenylyl-sulfate kinase; transferase, str	96.6
2qz4_A	262	Paraplegin; AAA+, SPG7, protease, ADP, structural	96.59
4gp7_A	171	Metallophosphoesterase; polynucleotide kinase phos	96.55
1fnn_A	389	CDC6P, cell division control protein 6; ORC1, AAA	96.54
2j41_A	207	Guanylate kinase; GMP, GMK, transferase, ATP-bindi	96.54
1in4_A	334	RUVB, holliday junction DNA helicase RUVB; AAA+-cl	96.54
2r62_A	268	Cell division protease FTSH homolog; ATPase domain	96.51
1ixz_A	254	ATP-dependent metalloprotease FTSH; AAA domain fol	96.51
3c8u_A	208	Fructokinase; YP_612366.1, putative fructose trans	96.51
3tr0_A	205	Guanylate kinase, GMP kinase; purines, pyrimidines	96.51
1lv7_A	257	FTSH; alpha/beta domain, four helix bundle, hydrol	96.5
1lvg_A	198	Guanylate kinase, GMP kinase; transferase; HET: AD	96.5
2ze6_A	253	Isopentenyl transferase; crown GALL tumor, cytokin	96.49
3syl_A	309	Protein CBBX; photosynthesis, rubisco activase, AA	96.48
2z4s_A	440	Chromosomal replication initiator protein DNAA; AA	96.45
2bbw_A	246	Adenylate kinase 4, AK4; nucleotide kinase, nucleo	96.45
3t15_A	293	Ribulose bisphosphate carboxylase/oxygenase activ	96.44
3cm0_A	186	Adenylate kinase; ATP-binding, cytoplasm, nucleoti	96.42
3a4m_A	260	L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m	96.41
2if2_A	204	Dephospho-COA kinase; alpha-beta protein, structur	96.4
1y63_A	184	LMAJ004144AAA protein; structural genomics, protei	96.39
2iyv_A	184	Shikimate kinase, SK; transferase, aromatic amino	96.39
1e6c_A	173	Shikimate kinase; phosphoryl transfer, ADP, shikim	96.39
1tev_A	196	UMP-CMP kinase; ploop, NMP binding region, LID reg	96.38
2x8a_A	274	Nuclear valosin-containing protein-like; nuclear p	96.38
3b9p_A	297	CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc	96.37
2plr_A	213	DTMP kinase, probable thymidylate kinase; TMP-bind	96.37
1cke_A	227	CK, MSSA, protein (cytidine monophosphate kinase);	96.36
1sxj_D	353	Activator 1 41 kDa subunit; clamp loader, processi	96.36
2vli_A	183	Antibiotic resistance protein; transferase, tunica	96.35
3a00_A	186	Guanylate kinase, GMP kinase; domain movement, dim	96.35
2pt5_A	168	Shikimate kinase, SK; aromatic amino acid biosynth	96.34
1d2n_A	272	N-ethylmaleimide-sensitive fusion protein; hexamer	96.34
1znw_A	207	Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans	96.33
3cf0_A	301	Transitional endoplasmic reticulum ATPase; AAA, P9	96.33
1yrb_A	262	ATP(GTP)binding protein; GTPase, P-loop, rossman f	96.33
1hqc_A	324	RUVB; extended AAA-ATPase domain, complex with nuc	96.32
1gvn_B	287	Zeta; postsegregational killing system, plasmid; 1	96.31
1iy2_A	278	ATP-dependent metalloprotease FTSH; AAA domain fol	96.31
1zuh_A	168	Shikimate kinase; alpha-beta protein, transferase;	96.31
3co5_A	143	Putative two-component system transcriptional RES	96.3
3asz_A	211	Uridine kinase; cytidine phosphorylation, transfer	96.3
1z6g_A	218	Guanylate kinase; structural genomics, SGC, struct	96.28
2cdn_A	201	Adenylate kinase; phosphoryl transfer, associative	96.26
2c95_A	196	Adenylate kinase 1; transferase, AP4A, nucleotide	96.26
2qgz_A	308	Helicase loader, putative primosome component; str	96.24
2i3b_A	189	HCR-ntpase, human cancer-related ntpase; AAA, ross	96.22
2qt1_A	207	Nicotinamide riboside kinase 1; non-protein kinase	96.21
1xjc_A	169	MOBB protein homolog; structural genomics, midwest	96.2
1xwi_A	322	SKD1 protein; VPS4B, AAA ATPase, protein transport	96.19
3tau_A	208	Guanylate kinase, GMP kinase; structural genomics,	96.17
1jjv_A	206	Dephospho-COA kinase; P-loop nucleotide-binding fo	96.17
1aky_A	220	Adenylate kinase; ATP:AMP phosphotransferase, myok	96.17
3t1o_A	198	Gliding protein MGLA; G domain containing protein,	96.16
3nwj_A	250	ATSK2; P loop, shikimate, nucleoside monophosphate	96.15
3pxg_A	468	Negative regulator of genetic competence CLPC/MEC;	96.15
3pfi_A	338	Holliday junction ATP-dependent DNA helicase RUVB;	96.15
1ukz_A	203	Uridylate kinase; transferase; HET: ADP AMP; 1.90A	96.15
2pbr_A	195	DTMP kinase, thymidylate kinase; transferase, nucl	96.14
2ehv_A	251	Hypothetical protein PH0186; KAIC, RECA ATPase, un	96.14
1zd8_A	227	GTP:AMP phosphotransferase mitochondrial; ATP:AMP	96.14
2bwj_A	199	Adenylate kinase 5; phosphoryl transfer reaction,	96.13
1m7g_A	211	Adenylylsulfate kinase; APS kinase, transferase, s	96.13
1s96_A	219	Guanylate kinase, GMP kinase; E.coli, dimer, SAD,	96.11
1sxj_B	323	Activator 1 37 kDa subunit; clamp loader, processi	96.1
1zak_A	222	Adenylate kinase; ATP:AMP-phosphotransferase, tran	96.1
1iqp_A	327	RFCS; clamp loader, extended AAA-ATPase domain, co	96.1
3fb4_A	216	Adenylate kinase; psychrophIle, phosphotransferase	96.09
3eie_A	322	Vacuolar protein sorting-associated protein 4; AAA	96.09
1rj9_A	304	FTSY, signal recognition protein; SRP-GTPase domai	96.08
2pez_A	179	Bifunctional 3'-phosphoadenosine 5'- phosphosulfat	96.07
3tif_A	235	Uncharacterized ABC transporter ATP-binding prote;	96.07
4e22_A	252	Cytidylate kinase; P-loop, CMP/ATP binding, transf	96.06
2pcj_A	224	ABC transporter, lipoprotein-releasing system ATP-	96.05
1qf9_A	194	UMP/CMP kinase, protein (uridylmonophosphate/cytid	96.05
4a74_A	231	DNA repair and recombination protein RADA; hydrola	96.04
2ce2_X	166	GTPase HRAS; signaling protein, guanine nucleotide	96.04
1rz3_A	201	Hypothetical protein rbstp0775; MCSG, structural g	96.04
1ex7_A	186	Guanylate kinase; substrate-induced FIT, domain mo	96.04
3dl0_A	216	Adenylate kinase; phosphotransferase, zinc coordin	96.03
2zej_A	184	Dardarin, leucine-rich repeat kinase 2; parkinson'	96.02
1htw_A	158	HI0065; nucleotide-binding fold, structural genomi	96.02
2wjg_A	188	FEOB, ferrous iron transport protein B homolog; me	96.0
1oix_A	191	RAS-related protein RAB-11A; small G protein, intr	96.0
2hf9_A	226	Probable hydrogenase nickel incorporation protein	96.0
2cbz_A	237	Multidrug resistance-associated protein 1; ABC pro	95.99
1z2a_A	168	RAS-related protein RAB-23; RAB GTPase, vesicular	95.99
2f9l_A	199	RAB11B, member RAS oncogene family; RAB11B GTPase,	95.98
2z0h_A	197	DTMP kinase, thymidylate kinase; ATP-binding, nucl	95.97
2onk_A	240	Molybdate/tungstate ABC transporter, ATP-binding p	95.97
2dyk_A	161	GTP-binding protein; GTPase, ribosome-binding prot	95.97
2wwf_A	212	Thymidilate kinase, putative; transferase, malaria	95.97
2wji_A	165	Ferrous iron transport protein B homolog; membrane	95.97
2p5t_B	253	PEZT; postsegregational killing system, phosphoryl	95.97
3con_A	190	GTPase NRAS; structural genomics consortium, SGC,	95.97
1nn5_A	215	Similar to deoxythymidylate kinase (thymidylate K;	95.96
1uf9_A	203	TT1252 protein; P-loop, nucleotide binding domain,	95.95
3uk6_A	368	RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding	95.95
1g6h_A	257	High-affinity branched-chain amino acid transport	95.94
2v54_A	204	DTMP kinase, thymidylate kinase; nucleotide biosyn	95.94
3nbx_X	500	ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu	95.93
3b85_A	208	Phosphate starvation-inducible protein; PHOH2, ATP	95.93
1b0u_A	262	Histidine permease; ABC transporter, transport pro	95.93
3te6_A	318	Regulatory protein SIR3; heterochromatin, gene sil	95.92
2bjv_A	265	PSP operon transcriptional activator; AAA, transcr	95.92
1ji0_A	240	ABC transporter; ATP binding protein, structural g	95.92
3aez_A	312	Pantothenate kinase; transferase, homodimer, COA b	95.91
3b9q_A	302	Chloroplast SRP receptor homolog, alpha subunit CP	95.91
2d2e_A	250	SUFC protein; ABC-ATPase, SUF protein, 310-helix,	95.91
1sgw_A	214	Putative ABC transporter; structural genomics, P p	95.9
1ofh_A	310	ATP-dependent HSL protease ATP-binding subunit HSL	95.9
2pze_A	229	Cystic fibrosis transmembrane conductance regulat;	95.89
2cvh_A	220	DNA repair and recombination protein RADB; filamen	95.88
2qp9_X	355	Vacuolar protein sorting-associated protein 4; ATP	95.87
1mv5_A	243	LMRA, multidrug resistance ABC transporter ATP-bin	95.87
1gtv_A	214	TMK, thymidylate kinase; transferase, transferase	95.87
3d8b_A	357	Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s	95.87
2xb4_A	223	Adenylate kinase; ATP-binding, nucleotide-binding,	95.86
2olj_A	263	Amino acid ABC transporter; ABC domain, ATPase, hy	95.83
2px0_A	296	Flagellar biosynthesis protein FLHF; SRP GTPase, f	95.83
3llu_A	196	RAS-related GTP-binding protein C; structural geno	95.83
3ney_A	197	55 kDa erythrocyte membrane protein; structural ge	95.82
1odf_A	290	YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser	95.82
3be4_A	217	Adenylate kinase; malaria, cryptosporidium parvum	95.82
1e4v_A	214	Adenylate kinase; transferase(phosphotransferase);	95.82
3sop_A	270	Neuronal-specific septin-3; hydrolase; HET: GDP; 2	95.81
2ixe_A	271	Antigen peptide transporter 1; ABC ATPase, hydrola	95.81
2ff7_A	247	Alpha-hemolysin translocation ATP-binding protein	95.81
1u8z_A	168	RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH	95.81
2zu0_C	267	Probable ATP-dependent transporter SUFC; iron-sulf	95.81
2qi9_C	249	Vitamin B12 import ATP-binding protein BTUD; inner	95.8
1ak2_A	233	Adenylate kinase isoenzyme-2; nucleoside monophosp	95.8
2ghi_A	260	Transport protein; multidrug resistance protein, M	95.79
2ged_A	193	SR-beta, signal recognition particle receptor beta	95.79
2yz2_A	266	Putative ABC transporter ATP-binding protein TM_0;	95.77
3gfo_A	275	Cobalt import ATP-binding protein CBIO 1; structur	95.77
1sxj_E	354	Activator 1 40 kDa subunit; clamp loader, processi	95.76
1vpl_A	256	ABC transporter, ATP-binding protein; TM0544, stru	95.76
1c1y_A	167	RAS-related protein RAP-1A; GTP-binding proteins,	95.75
4fcw_A	311	Chaperone protein CLPB; AAA domain; HET: ADP; 2.35	95.75
2ihy_A	279	ABC transporter, ATP-binding protein; ATPase, ABC	95.74
4g1u_C	266	Hemin import ATP-binding protein HMUV; membrane tr	95.74
3pvs_A	447	Replication-associated recombination protein A; ma	95.74
1vht_A	218	Dephospho-COA kinase; structural genomics, transfe	95.73
2w0m_A	235	SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus	95.73
1z08_A	170	RAS-related protein RAB-21; RAB GTPase, vesicular	95.72
1ltq_A	301	Polynucleotide kinase; phosphatase, alpha/beta, P-	95.71
1um8_A	376	ATP-dependent CLP protease ATP-binding subunit CL;	95.7
2nzj_A	175	GTP-binding protein REM 1; GDP/GTP binding, GTP hy	95.7
2nq2_C	253	Hypothetical ABC transporter ATP-binding protein H	95.7
1ek0_A	170	Protein (GTP-binding protein YPT51); vesicular tra	95.7
1z0j_A	170	RAB-22, RAS-related protein RAB-22A; RAB GTPase, R	95.69
2jeo_A	245	Uridine-cytidine kinase 1; UCK, transferase, ATP-b	95.69
3kta_A	182	Chromosome segregation protein SMC; structural mai	95.67
3lnc_A	231	Guanylate kinase, GMP kinase; ALS collaborative cr	95.67
2erx_A	172	GTP-binding protein DI-RAS2; GTP hydrolysis, trans	95.67
1np6_A	174	Molybdopterin-guanine dinucleotide biosynthesis pr	95.65
3fwy_A	314	Light-independent protochlorophyllide reductase I	95.64
1nrj_B	218	SR-beta, signal recognition particle receptor beta	95.64
2wsm_A	221	Hydrogenase expression/formation protein (HYPB); m	95.63
1z0f_A	179	RAB14, member RAS oncogene family; RAB GTPase, ves	95.63
2vp4_A	230	Deoxynucleoside kinase; ATP-binding, DNA synthesis	95.63
3q72_A	166	GTP-binding protein RAD; G-domain, CAV2 beta, sign	95.62
3q85_A	169	GTP-binding protein REM 2; G-domain, CAV2 beta, si	95.62
2ga8_A	359	Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn	95.59
1jr3_A	373	DNA polymerase III subunit gamma; processivity, pr	95.57
1m7b_A	184	RND3/RHOE small GTP-binding protein; small GTPase,	95.56
2og2_A	359	Putative signal recognition particle receptor; nuc	95.56
2qnr_A	301	Septin-2, protein NEDD5; structural genomics conso	95.55
1n0w_A	243	DNA repair protein RAD51 homolog 1; DNA repair, ho	95.55
2eyu_A	261	Twitching motility protein PILT; pilus retraction	95.55
1ky3_A	182	GTP-binding protein YPT7P; vesicular traffic, GTP	95.55
3tlx_A	243	Adenylate kinase 2; structural genomics, structura	95.54
2pjz_A	263	Hypothetical protein ST1066; ATP binding protein,	95.54
2r8r_A	228	Sensor protein; KDPD, PFAM02702, MCSG, structural	95.53
2zan_A	444	Vacuolar protein sorting-associating protein 4B; S	95.53
1sxj_A	516	Activator 1 95 kDa subunit; clamp loader, processi	95.53
3cbq_A	195	GTP-binding protein REM 2; FLJ38964A, structural g	95.53
3tw8_B	181	RAS-related protein RAB-35; longin domain, RAB GTP	95.53
3zvl_A	416	Bifunctional polynucleotide phosphatase/kinase; hy	95.52
3kkq_A	183	RAS-related protein M-RAS; GTP-binding, GTPase, si	95.52
2fn4_A	181	P23, RAS-related protein R-RAS; GDP/GTP binding, G	95.52
2hxs_A	178	RAB-26, RAS-related protein RAB-28; GTPase, signal	95.51
1uj2_A	252	Uridine-cytidine kinase 2; alpha/beta mononucleoti	95.51
2gj8_A	172	MNME, tRNA modification GTPase TRME; G-domain dime	95.51
2f1r_A	171	Molybdopterin-guanine dinucleotide biosynthesis pr	95.5
1svi_A	195	GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro	95.5
1kao_A	167	RAP2A; GTP-binding protein, small G protein, GDP,	95.48
3pxi_A	758	Negative regulator of genetic competence CLPC/MEC;	95.48
3ihw_A	184	Centg3; RAS, centaurin, GTPase, structural genomic	95.47
3ake_A	208	Cytidylate kinase; CMP kinase, CMP complex, open c	95.47
3c5c_A	187	RAS-like protein 12; GDP, GTPase, structural genom	95.46
1pui_A	210	ENGB, probable GTP-binding protein ENGB; structura	95.46
3e70_C	328	DPA, signal recognition particle receptor; FTSY, S	95.46
1r8s_A	164	ADP-ribosylation factor 1; protein transport/excha	95.46
1lw7_A	365	Transcriptional regulator NADR; NMN, NMN adenylyl	95.46
2a9k_A	187	RAS-related protein RAL-A; bacterial ADP-ribosyltr	95.45
1wms_A	177	RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p	95.44
1r2q_A	170	RAS-related protein RAB-5A; GTPase, GNP, atomic re	95.44
2efe_B	181	Small GTP-binding protein-like; GEF, GTPase, VPS9,	95.43
2yhs_A	503	FTSY, cell division protein FTSY; cell cycle, prot	95.42
4dsu_A	189	GTPase KRAS, isoform 2B; small G-protein, signalin	95.42
2cxx_A	190	Probable GTP-binding protein ENGB; structural geno	95.4
3hws_A	363	ATP-dependent CLP protease ATP-binding subunit CL;	95.4
2bme_A	186	RAB4A, RAS-related protein RAB4A; GTP-binding prot	95.4
3pqc_A	195	Probable GTP-binding protein ENGB; rossmann fold,	95.4
2grj_A	192	Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp	95.4
3bwd_D	182	RAC-like GTP-binding protein ARAC6; G domain, cyto	95.39
1fzq_A	181	ADP-ribosylation factor-like protein 3; protein-GD	95.38
4eaq_A	229	DTMP kinase, thymidylate kinase; structural genomi	95.37
1nij_A	318	Hypothetical protein YJIA; structural genomics, P-	95.37
1upt_A	171	ARL1, ADP-ribosylation factor-like protein 1; hydr	95.37
2lkc_A	178	Translation initiation factor IF-2; NMR {Geobacill	95.36
1sxj_C	340	Activator 1 40 kDa subunit; clamp loader, processi	95.35
1sq5_A	308	Pantothenate kinase; P-loop, transferase; HET: PAU	95.35
1nlf_A	279	Regulatory protein REPA; replicative DNA helicase	95.35
2chq_A	319	Replication factor C small subunit; DNA-binding pr	95.35
1g8p_A	350	Magnesium-chelatase 38 kDa subunit; parallel beta	95.33
1g16_A	170	RAS-related protein SEC4; G protein RAB, signaling	95.33
2bov_A	206	RAla, RAS-related protein RAL-A; C3BOT, exoenzyme,	95.32
2atv_A	196	RERG, RAS-like estrogen-regulated growth inhibitor	95.32
1mh1_A	186	RAC1; GTP-binding, GTPase, small G-protein, RHO fa	95.31
1vg8_A	207	RAS-related protein RAB-7; GTP-binding protein, pr	95.31
2oil_A	193	CATX-8, RAS-related protein RAB-25; G-protein, GDP	95.3
2bbs_A	290	Cystic fibrosis transmembrane conductance regulato	95.28
1f6b_A	198	SAR1; gtpases, N-terminal helix, Mg-containing com	95.28
3r20_A	233	Cytidylate kinase; structural genomics, seattle st	95.28
2f6r_A	281	COA synthase, bifunctional coenzyme A synthase; 18	95.28
1z47_A	355	CYSA, putative ABC-transporter ATP-binding protein	95.28
1vma_A	306	Cell division protein FTSY; TM0570, structural gen	95.27
2ce7_A	476	Cell division protein FTSH; metalloprotease; HET:	95.27
4b4t_M	434	26S protease regulatory subunit 6A; hydrolase, AAA	95.27
3bc1_A	195	RAS-related protein RAB-27A; RAB27, GTPase, RAB, s	95.27
3tkl_A	196	RAS-related protein RAB-1A; vesicle trafficking, p	95.26
2iwr_A	178	Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi	95.24
3crm_A	323	TRNA delta(2)-isopentenylpyrophosphate transferase	95.23
2g6b_A	180	RAS-related protein RAB-26; G-protein, GTP analogu	95.23
2fh5_B	214	SR-beta, signal recognition particle receptor beta	95.23
2v9p_A	305	Replication protein E1; AAA+ molecular motor, DNA	95.22
1ojl_A	304	Transcriptional regulatory protein ZRAR; response	95.22
1ypw_A	806	Transitional endoplasmic reticulum ATPase; AAA, P9	95.21
1cr0_A	296	DNA primase/helicase; RECA-type protein fold, tran	95.21
2q3h_A	201	RAS homolog gene family, member U; GTPase, structu	95.2
3dz8_A	191	RAS-related protein RAB-3B; GDP, GTPase, structura	95.2
3vfd_A	389	Spastin; ATPase, microtubule severing, hydrolase;	95.2
1zbd_A	203	Rabphilin-3A; G protein, effector, RABCDR, synapti	95.2
4bas_A	199	ADP-ribosylation factor, putative (small GTPase, p	95.19
1g29_1	372	MALK, maltose transport protein MALK; ATPase, acti	95.19
3fvq_A	359	Fe(3+) IONS import ATP-binding protein FBPC; nucle	95.19
4b4t_K	428	26S protease regulatory subunit 6B homolog; hydrol	95.19
1m2o_B	190	GTP-binding protein SAR1, GTP binding protein; zin	95.18
2yyz_A	359	Sugar ABC transporter, ATP-binding protein; sugar	95.17
2vhj_A	331	Ntpase P4, P4; non- hydrolysable ATP analogue, hyd	95.17
2a5j_A	191	RAS-related protein RAB-2B; GTPase, signal transdu	95.17
4b4t_J	405	26S protease regulatory subunit 8 homolog; hydrola	95.17
3clv_A	208	RAB5 protein, putative; malaria, GTPase, structura	95.17
3tui_C	366	Methionine import ATP-binding protein METN; ABC-tr	95.16
3reg_A	194	RHO-like small GTPase; cytoskeleton, nucleotide-bi	95.16
2it1_A	362	362AA long hypothetical maltose/maltodextrin trans	95.16
3t5g_A	181	GTP-binding protein RHEB; immunoglobulin-like beta	95.15
2y8e_A	179	RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti	95.15
1v43_A	372	Sugar-binding transport ATP-binding protein; ATPas	95.15
1gwn_A	205	RHO-related GTP-binding protein RHOE; GTPase, inac	95.15
1x3s_A	195	RAS-related protein RAB-18; GTPase, GNP, structura	95.14
4b4t_L	437	26S protease subunit RPT4; hydrolase, AAA-atpases,	95.13
1ls1_A	295	Signal recognition particle protein; FFH, SRP54, S	95.12
1zu4_A	320	FTSY; GTPase, signal recognition particle, SRP, re	95.12
1zd9_A	188	ADP-ribosylation factor-like 10B; transport protei	95.12
3nh6_A	306	ATP-binding cassette SUB-family B member 6, mitoc;	95.11
2r44_A	331	Uncharacterized protein; putative ATPase, structur	95.11
1r6b_X	758	CLPA protein; AAA+, N-terminal domain, CLPS, cryst	95.1
3oes_A	201	GTPase rhebl1; small GTPase, structural genomics,	95.1
1qvr_A	854	CLPB protein; coiled coil, AAA ATPase, chaperone;	95.09
2dhr_A	499	FTSH; AAA+ protein, hexameric Zn metalloprotease,	95.09
3d3q_A	340	TRNA delta(2)-isopentenylpyrophosphate transferase	95.08
3lxx_A	239	GTPase IMAP family member 4; structural genomics c	95.07
1z06_A	189	RAS-related protein RAB-33B; RAB GTPase, RAB33B GT	95.07
3rlf_A	381	Maltose/maltodextrin import ATP-binding protein M;	95.06
2fg5_A	192	RAB-22B, RAS-related protein RAB-31; G-protein, GT	95.06
3end_A	307	Light-independent protochlorophyllide reductase ir	95.05
3tqc_A	321	Pantothenate kinase; biosynthesis of cofactors, pr	95.04
2il1_A	192	RAB12; G-protein, GDP, GTPase, predicted, structur	95.03
2gf9_A	189	RAS-related protein RAB-3D; G-protein, structural	95.01
1ksh_A	186	ARF-like protein 2; small GTPase, small GTP-bindin	95.0
2qu8_A	228	Putative nucleolar GTP-binding protein 1; GTPase,	94.99
1moz_A	183	ARL1, ADP-ribosylation factor-like protein 1; GTP-	94.98
2p5s_A	199	RAS and EF-hand domain containing; G-protein, RAB,	94.98
1q3t_A	236	Cytidylate kinase; nucleotide monophosphate kinase	94.96
2gf0_A	199	GTP-binding protein DI-RAS1; GDP/GTP binding, GTP	94.96
2o52_A	200	RAS-related protein RAB-4B; G-protein, GDP, struct	94.95
2c9o_A	456	RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-	94.93
2obl_A	347	ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O	94.93
2h57_A	190	ADP-ribosylation factor-like protein 6; GTP, GTPas	94.93
3m6a_A	543	ATP-dependent protease LA 1; alpha, beta, ATP-bind	94.91
1svm_A	377	Large T antigen; AAA+ fold, viral protein; HET: AT	94.91
1cp2_A	269	CP2, nitrogenase iron protein; oxidoreductase; 1.9	94.9
2cjw_A	192	GTP-binding protein GEM; nucleotide-binding, small	94.89
3kjh_A	254	CO dehydrogenase/acetyl-COA synthase complex, acce	94.87
3d31_A	348	Sulfate/molybdate ABC transporter, ATP-binding pro	94.86
2j1l_A	214	RHO-related GTP-binding protein RHOD; GTPase, memb	94.86
2ocp_A	241	DGK, deoxyguanosine kinase; protein-nucleotide com	94.85
2v3c_C	432	SRP54, signal recognition 54 kDa protein; nucleoti	94.84
2atx_A	194	Small GTP binding protein TC10; GTPase, P-loop, al	94.84
3a8t_A	339	Adenylate isopentenyltransferase; rossmann fold pr	94.83
2gza_A	361	Type IV secretion system protein VIRB11; ATPase, h	94.83
3q3j_B	214	RHO-related GTP-binding protein RHO6; RAS-binding	94.83
2ew1_A	201	RAS-related protein RAB-30; G-protein, GTP analogu	94.83
2fu5_C	183	RAS-related protein RAB-8A; MSS4:RAB8 protein comp	94.82
2f7s_A	217	C25KG, RAS-related protein RAB-27B; G-protein, str	94.8
1zj6_A	187	ADP-ribosylation factor-like protein 5; ARL, GTP-b	94.8
1j8m_F	297	SRP54, signal recognition 54 kDa protein; signalin	94.8
4b4t_H	467	26S protease regulatory subunit 7 homolog; hydrola	94.8
2bcg_Y	206	Protein YP2, GTP-binding protein YPT1; RABGTPase,	94.79
2yv5_A	302	YJEQ protein; hydrolase, GTPase, permutation, stru	94.79
2fv8_A	207	H6, RHO-related GTP-binding protein RHOB; GDP/GTP	94.79
2h17_A	181	ADP-ribosylation factor-like protein 5A; GDP, GTPa	94.78
3bh0_A	315	DNAB-like replicative helicase; ATPase, replicatio	94.77
1p5z_B	263	DCK, deoxycytidine kinase; nucleoside kinase, P-lo	94.77
2afh_E	289	Nitrogenase iron protein 1; nitrogen fixation, iro	94.76
2pt7_A	330	CAG-ALFA; ATPase, protein-protein complex, type IV	94.74
3gd7_A	390	Fusion complex of cystic fibrosis transmembrane co	94.73
2j0v_A	212	RAC-like GTP-binding protein ARAC7; nucleotide-bin	94.71
3cph_A	213	RAS-related protein SEC4; RAB GTPase, prenylation,	94.7
2gco_A	201	H9, RHO-related GTP-binding protein RHOC; GTPase,s	94.69
2b6h_A	192	ADP-ribosylation factor 5; membrane trafficking, G	94.69
4gzl_A	204	RAS-related C3 botulinum toxin substrate 1; rossma	94.68
2qag_C	418	Septin-7; cell cycle, cell division, GTP-binding,	94.67
1oxx_K	353	GLCV, glucose, ABC transporter, ATP binding protei	94.67
3gj0_A	221	GTP-binding nuclear protein RAN; G protein, GDP, a	94.67
2xxa_A	433	Signal recognition particle protein; protein trans	94.66
2dr3_A	247	UPF0273 protein PH0284; RECA superfamily ATPase, h	94.64
4dkx_A	216	RAS-related protein RAB-6A; GTP binding fold, memb	94.64
2qag_A	361	Septin-2, protein NEDD5; cell cycle, cell division	94.63
3cr8_A	552	Sulfate adenylyltranferase, adenylylsulfate kinase	94.63
2hup_A	201	RAS-related protein RAB-43; G-protein, GDP, struct	94.63
2npi_A	460	Protein CLP1; CLP1-PCF11 complex, ATP binding, ter	94.63
1u94_A	356	RECA protein, recombinase A; homologous recombinat	94.61
2ewv_A	372	Twitching motility protein PILT; pilus retraction	94.6
2h92_A	219	Cytidylate kinase; rossmann fold, transferase; HET	94.59
2qag_B	427	Septin-6, protein NEDD5; cell cycle, cell division	94.59
1f2t_A	149	RAD50 ABC-ATPase; DNA double-strand break repair,	94.58
2zr9_A	349	Protein RECA, recombinase A; recombination, RECA m	94.57
1bif_A	469	6-phosphofructo-2-kinase/ fructose-2,6-bisphospha;	94.54
3p32_A	355	Probable GTPase RV1496/MT1543; structural genomics	94.53
1u0l_A	301	Probable GTPase ENGC; permutation, OB-fold, zinc-f	94.52
3hu3_A	489	Transitional endoplasmic reticulum ATPase; VCP, tr	94.5
3jvv_A	356	Twitching mobility protein; hexameric P-loop ATPas	94.49
3sr0_A	206	Adenylate kinase; phosphoryl transfer analogue, AL	94.47
4b4t_I	437	26S protease regulatory subunit 4 homolog; hydrola	94.45
1tue_A	212	Replication protein E1; helicase, replication, E1E	94.44
4dzz_A	206	Plasmid partitioning protein PARF; deviant walker	94.44
3k1j_A	604	LON protease, ATP-dependent protease LON; ATP-bind	94.41
2g3y_A	211	GTP-binding protein GEM; small GTPase, GDP, inacti	94.4
1g41_A	444	Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep	94.39
3umf_A	217	Adenylate kinase; rossmann fold, transferase; 2.05	94.38
2xtz_A	354	Guanine nucleotide-binding protein alpha-1 subuni;	94.37
2rcn_A	358	Probable GTPase ENGC; YJEQ, circularly permuted, G	94.36
2dpy_A	438	FLII, flagellum-specific ATP synthase; beta barrel	94.36
3u61_B	324	DNA polymerase accessory protein 44; AAA+, ATP hyd	94.36
3cwq_A	209	Para family chromosome partitioning protein; alpha	94.35
4djt_A	218	GTP-binding nuclear protein GSP1; structural genom	94.35
3t5d_A	274	Septin-7; GTP-binding protein, cytoskeleton, signa	94.33
2x77_A	189	ADP-ribosylation factor; GTP-binding protein, smal	94.31
3ice_A	422	Transcription termination factor RHO; transcriptio	94.31
2yc2_C	208	IFT27, small RAB-related GTPase; transport protein	94.27
2xtp_A	260	GTPase IMAP family member 2; immune system, G prot	94.26
2qm8_A	337	GTPase/ATPase; G protein, G3E, metallochaperone, c	94.24
1ega_A	301	Protein (GTP-binding protein ERA); GTPase, RNA-bin	94.23
3cpj_B	223	GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl	94.22
2axn_A	520	6-phosphofructo-2-kinase/fructose-2,6- biphosphata	94.21
4edh_A	213	DTMP kinase, thymidylate kinase; structural genomi	94.19
3kl4_A	433	SRP54, signal recognition 54 kDa protein; signal r	94.17
3k53_A	271	Ferrous iron transport protein B; GTPase fold, hel	94.16
1zcb_A	362	G alpha I/13; GTP-binding, lipoprotein, membrane,	94.16
1yqt_A	538	RNAse L inhibitor; ATP-binding cassette, ribosome	94.15
2ffh_A	425	Protein (FFH); SRP54, signal recognition particle,	94.11
1ypw_A	806	Transitional endoplasmic reticulum ATPase; AAA, P9	94.09
3gmt_A	230	Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle	94.09
1pzn_A	349	RAD51, DNA repair and recombination protein RAD51,	94.03
3lxw_A	247	GTPase IMAP family member 1; immunity, structural	93.99
1yqt_A	538	RNAse L inhibitor; ATP-binding cassette, ribosome	93.98
1a7j_A	290	Phosphoribulokinase; transferase, calvin cycle; 2.	93.97
1wf3_A	301	GTP-binding protein; GTPase, riken structural geno	93.95
3th5_A	204	RAS-related C3 botulinum toxin substrate 1; rossma	93.01
3exa_A	322	TRNA delta(2)-isopentenylpyrophosphate transferase	93.94
3ozx_A	538	RNAse L inhibitor; ATP binding cassette protein, h	93.93
1g8f_A	511	Sulfate adenylyltransferase; alpha-beta protein, b	93.92
2z43_A	324	DNA repair and recombination protein RADA; archaea	93.92
2www_A	349	Methylmalonic aciduria type A protein, mitochondri	93.91
3zq6_A	324	Putative arsenical pump-driving ATPase; tail-ancho	93.89
3foz_A	316	TRNA delta(2)-isopentenylpyrophosphate transferas;	93.88
3k9g_A	267	PF-32 protein; ssgcid, SBRI, decode biostructures,	93.87
4dhe_A	223	Probable GTP-binding protein ENGB; melioidosis, RA	93.85
3iev_A	308	GTP-binding protein ERA; ERA, GTPase, KH domain, a	93.82
2orw_A	184	Thymidine kinase; TMTK, TP4A, transferase; HET: 4T	93.78
2ph1_A	262	Nucleotide-binding protein; alpha-beta protein, st	93.78
3ozx_A	538	RNAse L inhibitor; ATP binding cassette protein, h	93.77
2p67_A	341	LAO/AO transport system kinase; ARGK, structural G	93.76
1m8p_A	573	Sulfate adenylyltransferase; rossmann fold, phosph	93.67
3cf2_A	806	TER ATPase, transitional endoplasmic reticulum ATP	93.65
3ug7_A	349	Arsenical pump-driving ATPase; tail-anchored, memb	93.65
1x6v_B	630	Bifunctional 3'-phosphoadenosine 5'- phosphosulfat	93.64
1p9r_A	418	General secretion pathway protein E; bacterial typ	93.64
3lv8_A	236	DTMP kinase, thymidylate kinase; structural genomi	93.64
3b5x_A	582	Lipid A export ATP-binding/permease protein MSBA;	93.62
1h65_A	270	Chloroplast outer envelope protein OEP34; GTPase,	93.61
3dm5_A	443	SRP54, signal recognition 54 kDa protein; protein-	93.61
1tq4_A	413	IIGP1, interferon-inducible GTPase; interferon gam	93.6
3bk7_A	607	ABC transporter ATP-binding protein; ABC ATPase, i	93.6
3euj_A	483	Chromosome partition protein MUKB, linker; MUKB, M	93.6
1qhl_A	227	Protein (cell division protein MUKB); SMC, chromos	93.6
3bk7_A	607	ABC transporter ATP-binding protein; ABC ATPase, i	93.57
3ea0_A	245	ATPase, para family; alpha-beta-alpha sandwich, st	93.56
3b60_A	582	Lipid A export ATP-binding/permease protein MSBA;	93.54
3j16_B	608	RLI1P; ribosome recycling, translation, eukarya, r	93.51
3qks_A	203	DNA double-strand break repair RAD50 ATPase; RECA-	93.51
3r7w_A	307	Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT	93.51
1t9h_A	307	YLOQ, probable GTPase ENGC; N-terminal beta-barrel	93.47
3io3_A	348	DEHA2D07832P; chaperone, membrane traffic, ATPase;	93.47
2yl4_A	595	ATP-binding cassette SUB-family B member 10, mitoc	93.44
3hr8_A	356	Protein RECA; alpha and beta proteins (A/B, A+B),	93.41
2j37_W	504	Signal recognition particle 54 kDa protein (SRP54)	93.38
2oap_1	511	GSPE-2, type II secretion system protein; hexameri	93.37
3ld9_A	223	DTMP kinase, thymidylate kinase; ssgcid, NIH, niai	93.34
3v9p_A	227	DTMP kinase, thymidylate kinase; ssgcid, STRU geno	93.34
1e69_A	322	Chromosome segregation SMC protein; structural mai	93.33
3l0i_B	199	RAS-related protein RAB-1A; GEF-GDF-RAB complex, G	93.33
3def_A	262	T7I23.11 protein; chloroplast, TOC33, GTPase, hydr	93.33
3j16_B	608	RLI1P; ribosome recycling, translation, eukarya, r	93.32
1xp8_A	366	RECA protein, recombinase A; recombination, radior	93.3
3pxi_A	758	Negative regulator of genetic competence CLPC/MEC;	93.26
3q9l_A	260	Septum site-determining protein MIND; ATPase, bact	93.25
4a82_A	578	Cystic fibrosis transmembrane conductance regulat;	93.21
1v5w_A	343	DMC1, meiotic recombination protein DMC1/LIM15 hom	93.19
3qf4_B	598	Uncharacterized ABC transporter ATP-binding prote	93.19
3b1v_A	272	Ferrous iron uptake transporter protein B; G prote	93.16
2woo_A	329	ATPase GET3; tail-anchored, membrane protein, targ	93.15
2zts_A	251	Putative uncharacterized protein PH0186; KAIC like	93.14
3iqw_A	334	Tail-anchored protein targeting factor GET3; ATPas	93.14
3upu_A	459	ATP-dependent DNA helicase DDA; RECA-like domain,	93.11
3lda_A	400	DNA repair protein RAD51; DNA binding protein, ATP	93.08
1mky_A	439	Probable GTP-binding protein ENGA; GTPase, DER, KH	93.08
4hlc_A	205	DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri	93.04
2xj4_A	286	MIPZ; replication, cell division, ATPase, WACA; 1.	93.01
2e87_A	357	Hypothetical protein PH1320; GTP-binding, GTPase,	93.01
1g3q_A	237	MIND ATPase, cell division inhibitor; alpha-beta-a	92.98
2oze_A	298	ORF delta'; para, walker type atpases, DNA segrega	92.97
2dby_A	368	GTP-binding protein; GDP, structural genomics, NPP	92.95
3qf4_A	587	ABC transporter, ATP-binding protein; multidrug tr	92.89
3iby_A	256	Ferrous iron transport protein B; G protein, G dom	92.86
2o5v_A	359	DNA replication and repair protein RECF; ABC ATPas	92.84
3a1s_A	258	Iron(II) transport protein B; FEOB, iron transport	92.82
2woj_A	354	ATPase GET3; tail-anchored, membrane protein, targ	92.81
1w1w_A	430	Structural maintenance of chromosome 1; cohesin, c	92.81
1tf7_A	525	KAIC; homohexamer, hexamer, circadian clock protei	92.8
3hjn_A	197	DTMP kinase, thymidylate kinase; ATP-binding, nucl	92.8

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*

Probab=99.34  E-value=2e-13  Score=110.27  Aligned_cols=37  Identities=14%  Similarity=-0.070  Sum_probs=33.8

Q ss_pred             ccCcCCCchhHHHHhhhh--hhhhccCCCCeEEEEEeC-CC
Q 042811           91 PFGVEGVGKITSLSKSYP--EFLEDEGIFLIKMHDVVR-DM  128 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~--~~~~~~~~Fd~~~wv~VS-~~  128 (130)
                      |+||||+||||||+.+|+  +. ++..+|+.++||+|| .+
T Consensus       157 I~G~gGvGKTtLA~~v~~~~~~-~~~~~F~~~~wv~vs~~~  196 (549)
T 2a5y_B          157 LHGRAGSGKSVIASQALSKSDQ-LIGINYDSIVWLKDSGTA  196 (549)
T ss_dssp             EECSTTSSHHHHHHHHHHHCSS-TBTTTBSEEEEEECCCCS
T ss_pred             EEcCCCCCHHHHHHHHHHhhhH-HHhccCCcEEEEEECCCC
Confidence            999999999999999998  45 668899999999999 64

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A*

Probab=98.99  E-value=3.8e-11  Score=103.40  Aligned_cols=38  Identities=16%  Similarity=-0.020  Sum_probs=34.5

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCe-EEEEEeC-CCC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLI-KMHDVVR-DMS  129 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~-~~wv~VS-~~~  129 (130)
                      |+||||+||||||+.+|++. ++..+|+. ++|++|| .++
T Consensus       155 IvGmGGIGKTTLAk~Vy~d~-rV~~~Fd~gV~WVsVs~~~d  194 (1221)
T 1vt4_I          155 IDGVLGSGKTWVALDVCLSY-KVQCKMDFKIFWLNLKNCNS  194 (1221)
T ss_dssp             ECCSTTSSHHHHHHHHHHHC-HHHHHHSSCEEEEECCCSSS
T ss_pred             EEcCCCccHHHHHHHHHHhh-HHHHhCCCcEEEEEeCCCCC
Confidence            99999999999999999976 66789997 9999999 765

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}

Probab=98.87  E-value=2e-10  Score=92.67  Aligned_cols=49  Identities=16%  Similarity=0.051  Sum_probs=38.7

Q ss_pred             CceeecccCCCCcc--------------ccCcCCCchhHHHHhhhhhhhhc-cCCC-CeEEEEEeC
Q 042811           77 TTKLGDVRRNGNNW--------------PFGVEGVGKITSLSKSYPEFLED-EGIF-LIKMHDVVR  126 (130)
Q Consensus        77 ~~ivG~~~~~~~l~--------------I~GmGGvGKTTLak~v~~~~~~~-~~~F-d~~~wv~VS  126 (130)
                      +.+|||+..++.+.              |+||||+||||||+.++++. +. ..+| +.++|++++
T Consensus       124 ~~~vGR~~~l~~L~~~L~~~~~~~~~v~I~G~~GiGKTtLa~~~~~~~-~~~~~~f~~~v~wv~~~  188 (591)
T 1z6t_A          124 VVFVTRKKLVNAIQQKLSKLKGEPGWVTIHGMAGCGKSVLAAEAVRDH-SLLEGCFPGGVHWVSVG  188 (591)
T ss_dssp             SSCCCCHHHHHHHHHHHTTSTTSCEEEEEECCTTSSHHHHHHHHHCCH-HHHHHHCTTCEEEEEEE
T ss_pred             CeecccHHHHHHHHHHHhcccCCCceEEEEcCCCCCHHHHHHHHHhch-hHHHhhCCCceEEEECC
Confidence            34689876433321              99999999999999999976 44 5789 589999998

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*

Probab=98.85  E-value=3.7e-10  Score=96.72  Aligned_cols=51  Identities=14%  Similarity=0.019  Sum_probs=38.3

Q ss_pred             ceeecccCCCCcc--------------ccCcCCCchhHHHHhhhhhhhhccCCC-CeEEEEEeC-CC
Q 042811           78 TKLGDVRRNGNNW--------------PFGVEGVGKITSLSKSYPEFLEDEGIF-LIKMHDVVR-DM  128 (130)
Q Consensus        78 ~ivG~~~~~~~l~--------------I~GmGGvGKTTLak~v~~~~~~~~~~F-d~~~wv~VS-~~  128 (130)
                      .++||+..++++.              |+||||+||||||+++|++......+| +.++||+++ ++
T Consensus       125 ~~vgR~~~~~~l~~~l~~~~~~~~~v~i~G~gG~GKTtLa~~~~~~~~~~~~~~~~~~~~v~~~~~~  191 (1249)
T 3sfz_A          125 IFVTRKKLVHAIQQKLWKLNGEPGWVTIYGMAGCGKSVLAAEAVRDHSLLEGCFSGGVHWVSIGKQD  191 (1249)
T ss_dssp             SCCCCHHHHHHHHHHHHTTTTSCEEEEEECSTTSSHHHHHHHHTCCHHHHTTTSTTCEEEEECCSCC
T ss_pred             eeccHHHHHHHHHHHHhhccCCCCEEEEEeCCCCCHHHHHHHHhcChhHHHhhCCCeEEEEEECCcC
Confidence            4689986544432              999999999999999999862224445 577799998 54

>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426}

Probab=97.47  E-value=5.5e-05  Score=52.68  Aligned_cols=34  Identities=24%  Similarity=0.144  Sum_probs=25.3

Q ss_pred             ccccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEe
Q 042811           89 NWPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVV  125 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~V  125 (130)
                      +.|+|..|+||||||+.+++.. .  .....++++..
T Consensus        57 ~~l~G~~GtGKT~la~~i~~~~-~--~~~~~~~~~~~   90 (202)
T 2w58_A           57 LYLHGSFGVGKTYLLAAIANEL-A--KRNVSSLIVYV   90 (202)
T ss_dssp             EEEECSTTSSHHHHHHHHHHHH-H--TTTCCEEEEEH
T ss_pred             EEEECCCCCCHHHHHHHHHHHH-H--HcCCeEEEEEh
Confidence            4499999999999999999977 3  22334555553

>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20

Probab=97.35  E-value=2.2e-05  Score=53.19  Aligned_cols=21  Identities=24%  Similarity=0.257  Sum_probs=19.2

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+||||||+.+.+..
T Consensus        47 ll~G~~G~GKT~l~~~~~~~~   67 (195)
T 1jbk_A           47 VLIGEPGVGKTAIVEGLAQRI   67 (195)
T ss_dssp             EEECCTTSCHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHH
Confidence            399999999999999998875

>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi}

Probab=97.34  E-value=3.2e-05  Score=57.60  Aligned_cols=33  Identities=18%  Similarity=0.120  Sum_probs=25.8

Q ss_pred             ceeecccCCCCcc----------ccCcCCCchhHHHHhhhhhh
Q 042811           78 TKLGDVRRNGNNW----------PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        78 ~ivG~~~~~~~l~----------I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++||+..++.+.          |+|+.|+|||||++.+.+..
T Consensus        13 ~~~gR~~el~~L~~~l~~~~~v~i~G~~G~GKT~Ll~~~~~~~   55 (350)
T 2qen_A           13 DIFDREEESRKLEESLENYPLTLLLGIRRVGKSSLLRAFLNER   55 (350)
T ss_dssp             GSCSCHHHHHHHHHHHHHCSEEEEECCTTSSHHHHHHHHHHHS
T ss_pred             hcCChHHHHHHHHHHHhcCCeEEEECCCcCCHHHHHHHHHHHc
Confidence            3588876544332          99999999999999998754

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}

Probab=97.25  E-value=3.9e-05  Score=57.77  Aligned_cols=20  Identities=20%  Similarity=0.458  Sum_probs=19.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+.+..
T Consensus        50 i~G~~G~GKTtl~~~l~~~~   69 (386)
T 2qby_A           50 IYGLTGTGKTAVVKFVLSKL   69 (386)
T ss_dssp             EEECTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            99999999999999999876

>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A*

Probab=97.16  E-value=0.00015  Score=49.73  Aligned_cols=21  Identities=24%  Similarity=0.224  Sum_probs=19.4

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+|||||++.+.+..
T Consensus        42 ~l~G~~G~GKTtL~~~i~~~~   62 (180)
T 3ec2_A           42 TFVGSPGVGKTHLAVATLKAI   62 (180)
T ss_dssp             EECCSSSSSHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHH
Confidence            399999999999999999876

>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A

Probab=97.06  E-value=0.00019  Score=48.03  Aligned_cols=16  Identities=25%  Similarity=0.175  Sum_probs=15.3

Q ss_pred             ccCcCCCchhHHHHhh
Q 042811           91 PFGVEGVGKITSLSKS  106 (130)
Q Consensus        91 I~GmGGvGKTTLak~v  106 (130)
                      |.|+.|+||||+++.+
T Consensus         6 l~G~~GsGKsT~a~~L   21 (179)
T 3lw7_A            6 ITGMPGSGKSEFAKLL   21 (179)
T ss_dssp             EECCTTSCHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHH
Confidence            8999999999999987

>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A*

Probab=97.06  E-value=0.0002  Score=48.68  Aligned_cols=22  Identities=14%  Similarity=-0.079  Sum_probs=18.6

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|.|+.|+||||+++.+....
T Consensus         6 i~l~G~~GsGKST~a~~La~~l   27 (178)
T 1qhx_A            6 IILNGGSSAGKSGIVRCLQSVL   27 (178)
T ss_dssp             EEEECCTTSSHHHHHHHHHHHS
T ss_pred             EEEECCCCCCHHHHHHHHHHhc
Confidence            3489999999999999987643

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A

Probab=97.05  E-value=0.00027  Score=49.69  Aligned_cols=34  Identities=6%  Similarity=-0.004  Sum_probs=24.9

Q ss_pred             cccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC
Q 042811           90 WPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR  126 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS  126 (130)
                      .|+|..|+||||||+.+.+.. .. ..+ .+.++..+
T Consensus        56 ll~G~~G~GKT~la~~l~~~~-~~-~~~-~~~~~~~~   89 (242)
T 3bos_A           56 YLWGPVKSGRTHLIHAACARA-NE-LER-RSFYIPLG   89 (242)
T ss_dssp             EEECSTTSSHHHHHHHHHHHH-HH-TTC-CEEEEEGG
T ss_pred             EEECCCCCCHHHHHHHHHHHH-HH-cCC-eEEEEEHH
Confidence            399999999999999999876 32 223 34555544

>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A*

Probab=97.03  E-value=0.00022  Score=54.38  Aligned_cols=20  Identities=25%  Similarity=0.265  Sum_probs=18.8

Q ss_pred             c--cCcCCCchhHHHHhhhhhh
Q 042811           91 P--FGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I--~GmGGvGKTTLak~v~~~~  110 (130)
                      |  +|++|+|||||++.+.+..
T Consensus        55 i~i~G~~G~GKT~L~~~~~~~~   76 (412)
T 1w5s_A           55 YGSIGRVGIGKTTLAKFTVKRV   76 (412)
T ss_dssp             EECTTCCSSSHHHHHHHHHHHH
T ss_pred             EeCcCcCCCCHHHHHHHHHHHH
Confidence            7  9999999999999999876

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*

Probab=96.99  E-value=0.00026  Score=49.32  Aligned_cols=20  Identities=25%  Similarity=0.204  Sum_probs=18.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+||||||+.+.+..
T Consensus        50 l~G~~G~GKT~l~~~~~~~~   69 (250)
T 1njg_A           50 FSGTRGVGKTSIARLLAKGL   69 (250)
T ss_dssp             EECSTTSCHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            99999999999999998866

>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A*

Probab=96.93  E-value=0.00033  Score=47.07  Aligned_cols=21  Identities=24%  Similarity=-0.084  Sum_probs=17.9

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|.|+.|+||||+++.+...
T Consensus         4 i~l~G~~GsGKsT~~~~L~~~   24 (173)
T 3kb2_A            4 IILEGPDCCFKSTVAAKLSKE   24 (173)
T ss_dssp             EEEECSSSSSHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            348899999999999998654

>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25

Probab=96.90  E-value=0.00027  Score=48.50  Aligned_cols=19  Identities=26%  Similarity=0.071  Sum_probs=17.5

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|+.|+|||||++.+...
T Consensus        14 l~G~~GsGKSTl~~~La~~   32 (191)
T 1zp6_A           14 LSGHPGSGKSTIAEALANL   32 (191)
T ss_dssp             EEECTTSCHHHHHHHHHTC
T ss_pred             EECCCCCCHHHHHHHHHhc
Confidence            9999999999999999764

>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron}

Probab=96.89  E-value=0.00035  Score=48.73  Aligned_cols=22  Identities=23%  Similarity=0.134  Sum_probs=19.0

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|+.|+|||||++.+....
T Consensus        28 i~l~G~~GsGKsTl~~~La~~l   49 (199)
T 3vaa_A           28 IFLTGYMGAGKTTLGKAFARKL   49 (199)
T ss_dssp             EEEECCTTSCHHHHHHHHHHHH
T ss_pred             EEEEcCCCCCHHHHHHHHHHHc
Confidence            4499999999999999987654

>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2

Probab=96.86  E-value=0.00038  Score=47.01  Aligned_cols=21  Identities=24%  Similarity=0.175  Sum_probs=18.2

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|.|+.|+|||||++.+...
T Consensus         7 i~l~G~~GsGKSTl~~~La~~   27 (173)
T 1kag_A            7 IFLVGPMGAGKSTIGRQLAQQ   27 (173)
T ss_dssp             EEEECCTTSCHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            349999999999999998764

>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20

Probab=96.86  E-value=0.0006  Score=50.64  Aligned_cols=30  Identities=17%  Similarity=0.142  Sum_probs=23.5

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR  126 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS  126 (130)
                      |+|+.|+|||||++.+.+.. .  .   ..+|+...
T Consensus        35 i~G~~G~GKT~L~~~~~~~~-~--~---~~~~~~~~   64 (357)
T 2fna_A           35 VLGLRRTGKSSIIKIGINEL-N--L---PYIYLDLR   64 (357)
T ss_dssp             EEESTTSSHHHHHHHHHHHH-T--C---CEEEEEGG
T ss_pred             EECCCCCCHHHHHHHHHHhc-C--C---CEEEEEch
Confidence            99999999999999999875 2  2   24666543

>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii}

Probab=96.82  E-value=0.00044  Score=47.26  Aligned_cols=22  Identities=23%  Similarity=0.187  Sum_probs=18.8

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|+.|+||||+++.+....
T Consensus         8 i~l~G~~GsGKst~a~~La~~l   29 (185)
T 3trf_A            8 IYLIGLMGAGKTSVGSQLAKLT   29 (185)
T ss_dssp             EEEECSTTSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            4489999999999999987653

>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1

Probab=96.80  E-value=0.00045  Score=46.70  Aligned_cols=19  Identities=26%  Similarity=0.281  Sum_probs=17.3

Q ss_pred             cccCcCCCchhHHHHhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~  108 (130)
                      .|.|+.|+||||+++.+..
T Consensus         6 ~i~G~~GsGKST~a~~L~~   24 (181)
T 1ly1_A            6 LTIGCPGSGKSTWAREFIA   24 (181)
T ss_dssp             EEECCTTSSHHHHHHHHHH
T ss_pred             EEecCCCCCHHHHHHHHHh
Confidence            3899999999999999876

>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum}

Probab=96.79  E-value=0.00034  Score=47.17  Aligned_cols=21  Identities=24%  Similarity=0.245  Sum_probs=19.2

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+||||||+.+.+..
T Consensus        47 ll~G~~G~GKT~la~~~~~~~   67 (187)
T 2p65_A           47 ILLGDPGVGKTAIVEGLAIKI   67 (187)
T ss_dssp             EEESCGGGCHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHH
Confidence            399999999999999998876

>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A

Probab=96.79  E-value=0.00049  Score=46.98  Aligned_cols=22  Identities=27%  Similarity=0.140  Sum_probs=18.9

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|.|+.|+||||+++.+....
T Consensus        14 i~i~G~~GsGKst~~~~l~~~~   35 (180)
T 3iij_A           14 ILLTGTPGVGKTTLGKELASKS   35 (180)
T ss_dssp             EEEECSTTSSHHHHHHHHHHHH
T ss_pred             EEEEeCCCCCHHHHHHHHHHHh
Confidence            4499999999999999987654

>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1

Probab=96.77  E-value=0.00049  Score=47.32  Aligned_cols=20  Identities=20%  Similarity=0.316  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+....
T Consensus        10 i~GpsGsGKSTL~~~L~~~~   29 (180)
T 1kgd_A           10 LLGAHGVGRRHIKNTLITKH   29 (180)
T ss_dssp             EECCTTSSHHHHHHHHHHHC
T ss_pred             EECCCCCCHHHHHHHHHhhC
Confidence            89999999999999997754

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}

Probab=96.77  E-value=0.00048  Score=51.81  Aligned_cols=20  Identities=20%  Similarity=0.393  Sum_probs=19.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+||||||+.+.+..
T Consensus        49 l~G~~G~GKT~l~~~~~~~~   68 (387)
T 2v1u_A           49 LYGLTGTGKTAVARLVLRRL   68 (387)
T ss_dssp             ECBCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            99999999999999999876

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}

Probab=96.77  E-value=0.00051  Score=47.32  Aligned_cols=22  Identities=18%  Similarity=0.123  Sum_probs=19.5

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+||||||+.+.+..
T Consensus        41 ~ll~G~~G~GKT~l~~~l~~~~   62 (226)
T 2chg_A           41 LLFSGPPGTGKTATAIALARDL   62 (226)
T ss_dssp             EEEECSTTSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
Confidence            3499999999999999998865

>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare}

Probab=96.76  E-value=0.00099  Score=43.22  Aligned_cols=22  Identities=9%  Similarity=0.092  Sum_probs=20.5

Q ss_pred             chHHHHHHHHHHHHHHHHHhhh
Q 042811            3 RLHKIQMGLTRVQALETEVDNL   24 (130)
Q Consensus         3 ~~~~v~~Wl~~v~~~~~e~edi   24 (130)
                      .+++|+.|+++|++++||+||+
T Consensus        53 ~d~~vk~W~~~vrdlaYD~ED~   74 (115)
T 3qfl_A           53 LDSQDKLWADEVRELSYVIEDV   74 (115)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHHHH
Confidence            3678999999999999999999

>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A*

Probab=96.75  E-value=0.00054  Score=47.23  Aligned_cols=19  Identities=32%  Similarity=0.296  Sum_probs=16.8

Q ss_pred             cccCcCCCchhHHHHhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~  108 (130)
                      .|.|+.|+||||+++.+.+
T Consensus         4 ~i~G~~GsGKsT~~~~L~~   22 (205)
T 2jaq_A            4 AIFGTVGAGKSTISAEISK   22 (205)
T ss_dssp             EEECCTTSCHHHHHHHHHH
T ss_pred             EEECCCccCHHHHHHHHHH
Confidence            3789999999999999866

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}

Probab=96.74  E-value=0.00046  Score=52.19  Aligned_cols=20  Identities=25%  Similarity=0.368  Sum_probs=19.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|.+|+||||||+.+.+..
T Consensus        50 l~G~~G~GKT~la~~l~~~~   69 (384)
T 2qby_B           50 FLGLTGTGKTFVSKYIFNEI   69 (384)
T ss_dssp             EEECTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            99999999999999999875

>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A

Probab=96.73  E-value=0.00056  Score=46.67  Aligned_cols=21  Identities=33%  Similarity=0.363  Sum_probs=18.7

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|+.|+||||+++.+.+..
T Consensus         7 ~i~G~~GsGKsT~~~~L~~~l   27 (192)
T 1kht_A            7 VVTGVPGVGSTTSSQLAMDNL   27 (192)
T ss_dssp             EEECCTTSCHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHH
Confidence            389999999999999998765

>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli}

Probab=96.73  E-value=0.00072  Score=44.90  Aligned_cols=21  Identities=24%  Similarity=0.436  Sum_probs=19.3

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|-.|+|||+||+.+++..
T Consensus        28 ll~G~~GtGKt~lA~~i~~~~   48 (145)
T 3n70_A           28 WLYGAPGTGRMTGARYLHQFG   48 (145)
T ss_dssp             EEESSTTSSHHHHHHHHHHSS
T ss_pred             EEECCCCCCHHHHHHHHHHhC
Confidence            499999999999999999865

>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti}

Probab=96.70  E-value=0.00061  Score=47.39  Aligned_cols=22  Identities=23%  Similarity=0.136  Sum_probs=18.9

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|.|..|+|||||++.+....
T Consensus        21 I~l~G~~GsGKSTla~~L~~~l   42 (202)
T 3t61_A           21 IVVMGVSGSGKSSVGEAIAEAC   42 (202)
T ss_dssp             EEEECSTTSCHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            3499999999999999987754

>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B}

Probab=96.69  E-value=0.00053  Score=46.17  Aligned_cols=20  Identities=30%  Similarity=0.360  Sum_probs=19.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+.+..
T Consensus        41 l~G~~G~GKTtL~~~i~~~~   60 (149)
T 2kjq_A           41 VWGEEGAGKSHLLQAWVAQA   60 (149)
T ss_dssp             EESSSTTTTCHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            99999999999999999977

>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A*

Probab=96.69  E-value=0.0006  Score=50.89  Aligned_cols=22  Identities=27%  Similarity=0.330  Sum_probs=20.0

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+||||||+.+.+..
T Consensus        40 lll~G~~GtGKT~la~~i~~~~   61 (324)
T 1l8q_A           40 IFIYGSVGTGKTHLLQAAGNEA   61 (324)
T ss_dssp             EEEECSSSSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCcHHHHHHHHHHHH
Confidence            3499999999999999999976

>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1

Probab=96.69  E-value=0.00056  Score=46.67  Aligned_cols=22  Identities=36%  Similarity=0.415  Sum_probs=18.6

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|.|+.|+||||+++.+.+..
T Consensus         4 I~i~G~~GsGKsT~~~~L~~~l   25 (194)
T 1nks_A            4 GIVTGIPGVGKSTVLAKVKEIL   25 (194)
T ss_dssp             EEEEECTTSCHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
Confidence            3488999999999999987654

>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax}

Probab=96.68  E-value=0.0006  Score=47.68  Aligned_cols=20  Identities=45%  Similarity=0.571  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|+.|+|||||++.+....
T Consensus        17 l~G~sGsGKsTl~~~L~~~~   36 (204)
T 2qor_A           17 VCGPSGVGKGTLIKKVLSEF   36 (204)
T ss_dssp             EECCTTSCHHHHHHHHHHHC
T ss_pred             EECCCCCCHHHHHHHHHHhC
Confidence            89999999999999997754

>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A*

Probab=96.68  E-value=0.00063  Score=46.13  Aligned_cols=20  Identities=30%  Similarity=0.330  Sum_probs=17.7

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|.|+.|+|||||++.+...
T Consensus        12 ~l~G~~GsGKSTl~~~l~~~   31 (175)
T 1knq_A           12 VLMGVSGSGKSAVASEVAHQ   31 (175)
T ss_dssp             EEECSTTSCHHHHHHHHHHH
T ss_pred             EEEcCCCCCHHHHHHHHHHh
Confidence            39999999999999998764

>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2

Probab=96.67  E-value=0.00066  Score=46.17  Aligned_cols=23  Identities=26%  Similarity=0.180  Sum_probs=19.2

Q ss_pred             CccccCcCCCchhHHHHhhhhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .+.|.|+.|+||||+++.+....
T Consensus         6 ~i~i~G~~GsGKsTla~~La~~l   28 (175)
T 1via_A            6 NIVFIGFMGSGKSTLARALAKDL   28 (175)
T ss_dssp             CEEEECCTTSCHHHHHHHHHHHH
T ss_pred             EEEEEcCCCCCHHHHHHHHHHHc
Confidence            34599999999999999987653

>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25

Probab=96.66  E-value=0.00062  Score=46.82  Aligned_cols=18  Identities=33%  Similarity=0.359  Sum_probs=16.5

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |.|..|+|||||++.+..
T Consensus         7 l~G~~GaGKSTl~~~L~~   24 (189)
T 2bdt_A            7 ITGPAGVGKSTTCKRLAA   24 (189)
T ss_dssp             EECSTTSSHHHHHHHHHH
T ss_pred             EECCCCCcHHHHHHHHhc
Confidence            899999999999999865

>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11

Probab=96.65  E-value=0.00068  Score=47.00  Aligned_cols=19  Identities=37%  Similarity=0.371  Sum_probs=16.5

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|+|||||++.+...
T Consensus         5 l~G~nGsGKTTLl~~l~g~   23 (178)
T 1ye8_A            5 ITGEPGVGKTTLVKKIVER   23 (178)
T ss_dssp             EECCTTSSHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHH
Confidence            7899999999999987543

>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii}

Probab=96.64  E-value=0.00067  Score=49.48  Aligned_cols=21  Identities=24%  Similarity=0.249  Sum_probs=19.1

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+||||||+.+.+..
T Consensus        55 ll~G~~GtGKT~la~~la~~~   75 (285)
T 3h4m_A           55 LLYGPPGTGKTLLAKAVATET   75 (285)
T ss_dssp             EEESSSSSSHHHHHHHHHHHT
T ss_pred             EEECCCCCcHHHHHHHHHHHh
Confidence            499999999999999998865

>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A*

Probab=96.64  E-value=0.00068  Score=47.28  Aligned_cols=21  Identities=29%  Similarity=0.439  Sum_probs=18.8

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|+.|+|||||++.+....
T Consensus        29 ~l~G~sGsGKSTl~~~La~~l   49 (200)
T 3uie_A           29 WVTGLSGSGKSTLACALNQML   49 (200)
T ss_dssp             EEECSTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHH
Confidence            399999999999999998765

>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus}

Probab=96.61  E-value=0.00067  Score=46.43  Aligned_cols=21  Identities=19%  Similarity=0.052  Sum_probs=18.2

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|+.|+||||+++.+....
T Consensus         9 ~l~G~~GsGKST~~~~L~~~l   29 (193)
T 2rhm_A            9 IVTGHPATGKTTLSQALATGL   29 (193)
T ss_dssp             EEEESTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHc
Confidence            389999999999999987653

>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP}

Probab=96.61  E-value=0.00076  Score=47.02  Aligned_cols=20  Identities=35%  Similarity=0.343  Sum_probs=17.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|+.|+|||||++.+....
T Consensus        34 l~G~~GsGKSTl~~~L~~~~   53 (200)
T 4eun_A           34 VMGVSGSGKTTIAHGVADET   53 (200)
T ss_dssp             EECCTTSCHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHhh
Confidence            99999999999999987643

>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix}

Probab=96.60  E-value=0.0008  Score=46.19  Aligned_cols=21  Identities=29%  Similarity=0.482  Sum_probs=19.0

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|+.|+||||+++.+....
T Consensus        17 ~l~G~~GsGKsT~~~~L~~~l   37 (186)
T 2yvu_A           17 WLTGLPGSGKTTIATRLADLL   37 (186)
T ss_dssp             EEECCTTSSHHHHHHHHHHHH
T ss_pred             EEEcCCCCCHHHHHHHHHHHH
Confidence            399999999999999998865

>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens}

Probab=96.59  E-value=0.00078  Score=48.31  Aligned_cols=22  Identities=23%  Similarity=0.185  Sum_probs=19.6

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+||||||+.+.+..
T Consensus        42 vll~G~~GtGKT~la~~la~~~   63 (262)
T 2qz4_A           42 ALLLGPPGCGKTLLAKAVATEA   63 (262)
T ss_dssp             EEEESCTTSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            3499999999999999999865

>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A*

Probab=96.55  E-value=0.00079  Score=45.99  Aligned_cols=17  Identities=35%  Similarity=0.487  Sum_probs=15.3

Q ss_pred             ccCcCCCchhHHHHhhh
Q 042811           91 PFGVEGVGKITSLSKSY  107 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~  107 (130)
                      |+|..|+|||||++.++
T Consensus        14 l~G~nGsGKSTl~~~~~   30 (171)
T 4gp7_A           14 LIGSSGSGKSTFAKKHF   30 (171)
T ss_dssp             EECCTTSCHHHHHHHHS
T ss_pred             EECCCCCCHHHHHHHHc
Confidence            89999999999999644

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20

Probab=96.54  E-value=0.0021  Score=48.38  Aligned_cols=22  Identities=27%  Similarity=0.427  Sum_probs=19.9

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+|||||++.+.+..
T Consensus        47 ~li~G~~G~GKTtl~~~l~~~~   68 (389)
T 1fnn_A           47 ATLLGRPGTGKTVTLRKLWELY   68 (389)
T ss_dssp             EEEECCTTSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
Confidence            3499999999999999999876

>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus}

Probab=96.54  E-value=0.00087  Score=46.38  Aligned_cols=20  Identities=30%  Similarity=0.318  Sum_probs=17.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+....
T Consensus        11 l~G~~GsGKSTl~~~L~~~~   30 (207)
T 2j41_A           11 LSGPSGVGKGTVRKRIFEDP   30 (207)
T ss_dssp             EECSTTSCHHHHHHHHHHCT
T ss_pred             EECCCCCCHHHHHHHHHHhh
Confidence            89999999999999987654

>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A*

Probab=96.54  E-value=0.00084  Score=50.68  Aligned_cols=23  Identities=26%  Similarity=0.212  Sum_probs=19.9

Q ss_pred             CccccCcCCCchhHHHHhhhhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .+.++|..|+||||||+.+.+..
T Consensus        53 ~~ll~Gp~G~GKTTLa~~ia~~l   75 (334)
T 1in4_A           53 HVLLAGPPGLGKTTLAHIIASEL   75 (334)
T ss_dssp             CEEEESSTTSSHHHHHHHHHHHH
T ss_pred             eEEEECCCCCcHHHHHHHHHHHh
Confidence            34499999999999999998865

>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A*

Probab=96.51  E-value=0.0013  Score=47.55  Aligned_cols=22  Identities=23%  Similarity=0.102  Sum_probs=19.8

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+||||||+.+.+..
T Consensus        47 vll~G~~GtGKT~la~~la~~~   68 (268)
T 2r62_A           47 VLLVGPPGTGKTLLAKAVAGEA   68 (268)
T ss_dssp             CCCBCSSCSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCcHHHHHHHHHHHh
Confidence            4599999999999999999865

>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A*

Probab=96.51  E-value=0.00091  Score=48.12  Aligned_cols=22  Identities=27%  Similarity=0.164  Sum_probs=19.5

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+|||||++.+.+..
T Consensus        52 ~ll~G~~G~GKTtl~~~i~~~~   73 (254)
T 1ixz_A           52 VLLVGPPGVGKTHLARAVAGEA   73 (254)
T ss_dssp             EEEECCTTSSHHHHHHHHHHHT
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            3499999999999999998865

>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP}

Probab=96.51  E-value=0.0009  Score=46.96  Aligned_cols=20  Identities=25%  Similarity=0.190  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+....
T Consensus        27 I~G~sGsGKSTl~~~l~~~~   46 (208)
T 3c8u_A           27 LSGAPGSGKSTLSNPLAAAL   46 (208)
T ss_dssp             EECCTTSCTHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            89999999999999998765

>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii}

Probab=96.51  E-value=0.00094  Score=46.20  Aligned_cols=19  Identities=16%  Similarity=0.111  Sum_probs=17.5

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|..|+|||||++.+...
T Consensus        12 l~Gp~GsGKSTl~~~L~~~   30 (205)
T 3tr0_A           12 ISAPSGAGKTSLVRALVKA   30 (205)
T ss_dssp             EECCTTSCHHHHHHHHHHH
T ss_pred             EECcCCCCHHHHHHHHHhh
Confidence            8999999999999998764

>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20

Probab=96.50  E-value=0.00092  Score=48.19  Aligned_cols=22  Identities=23%  Similarity=0.089  Sum_probs=19.6

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+||||||+.+.+..
T Consensus        48 vll~G~~GtGKT~la~~la~~~   69 (257)
T 1lv7_A           48 VLMVGPPGTGKTLLAKAIAGEA   69 (257)
T ss_dssp             EEEECCTTSCHHHHHHHHHHHH
T ss_pred             EEEECcCCCCHHHHHHHHHHHc
Confidence            3499999999999999999865

>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1

Probab=96.50  E-value=0.00091  Score=46.80  Aligned_cols=19  Identities=42%  Similarity=0.504  Sum_probs=17.4

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|+|||||++.+...
T Consensus         9 lvGpsGaGKSTLl~~L~~~   27 (198)
T 1lvg_A            9 LSGPSGAGKSTLLKKLFQE   27 (198)
T ss_dssp             EECCTTSSHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHhh
Confidence            8999999999999999764

>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A

Probab=96.49  E-value=0.00098  Score=48.51  Aligned_cols=20  Identities=20%  Similarity=0.156  Sum_probs=17.1

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|.|+.|+||||||+.+...
T Consensus         5 ~I~G~~GSGKSTla~~La~~   24 (253)
T 2ze6_A            5 LIYGPTCSGKTDMAIQIAQE   24 (253)
T ss_dssp             EEECCTTSSHHHHHHHHHHH
T ss_pred             EEECCCCcCHHHHHHHHHhc
Confidence            38999999999999987543

>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A*

Probab=96.48  E-value=0.0012  Score=48.50  Aligned_cols=22  Identities=27%  Similarity=0.057  Sum_probs=19.4

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+||||||+.+.+..
T Consensus        70 vll~G~~GtGKT~la~~la~~l   91 (309)
T 3syl_A           70 MSFTGNPGTGKTTVALKMAGLL   91 (309)
T ss_dssp             EEEEECTTSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
Confidence            3599999999999999888766

>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A*

Probab=96.45  E-value=0.001  Score=52.32  Aligned_cols=22  Identities=23%  Similarity=0.224  Sum_probs=19.9

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+||||||+.+.+..
T Consensus       133 lll~Gp~G~GKTtLa~aia~~l  154 (440)
T 2z4s_A          133 LFIYGGVGLGKTHLLQSIGNYV  154 (440)
T ss_dssp             EEEECSSSSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
Confidence            3399999999999999999976

>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A

Probab=96.45  E-value=0.001  Score=47.86  Aligned_cols=21  Identities=29%  Similarity=0.297  Sum_probs=18.2

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+|||||++.+.+..
T Consensus        31 ~l~G~~GsGKSTl~k~La~~l   51 (246)
T 2bbw_A           31 VILGPPGSGKGTVCQRIAQNF   51 (246)
T ss_dssp             EEECCTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHh
Confidence            399999999999999998543

>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A

Probab=96.44  E-value=0.0012  Score=49.02  Aligned_cols=21  Identities=19%  Similarity=0.243  Sum_probs=19.2

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++|..|+|||+||+.|.+..
T Consensus        40 Ll~GppGtGKT~la~aiA~~l   60 (293)
T 3t15_A           40 GIWGGKGQGKSFQCELVFRKM   60 (293)
T ss_dssp             EEEECTTSCHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHh
Confidence            489999999999999999876

>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus}

Probab=96.42  E-value=0.0012  Score=45.04  Aligned_cols=20  Identities=35%  Similarity=0.305  Sum_probs=17.5

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|.|+.|+||||+++.+.+.
T Consensus         8 ~l~G~~GsGKST~~~~La~~   27 (186)
T 3cm0_A            8 IFLGPPGAGKGTQASRLAQE   27 (186)
T ss_dssp             EEECCTTSCHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHH
Confidence            38999999999999998754

>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A*

Probab=96.41  E-value=0.0011  Score=48.25  Aligned_cols=21  Identities=29%  Similarity=0.200  Sum_probs=18.8

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|+.|+||||+++.+....
T Consensus         8 vl~G~pGSGKSTla~~La~~L   28 (260)
T 3a4m_A            8 ILTGLPGVGKSTFSKNLAKIL   28 (260)
T ss_dssp             EEECCTTSSHHHHHHHHHHHH
T ss_pred             EEEcCCCCCHHHHHHHHHHHH
Confidence            489999999999999998764

>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus}

Probab=96.40  E-value=0.0011  Score=46.10  Aligned_cols=18  Identities=28%  Similarity=0.045  Sum_probs=15.9

Q ss_pred             cccCcCCCchhHHHHhhh
Q 042811           90 WPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~  107 (130)
                      .|.|+.|+||||+++.+.
T Consensus         5 ~i~G~~GsGKSTl~~~L~   22 (204)
T 2if2_A            5 GLTGNIGCGKSTVAQMFR   22 (204)
T ss_dssp             EEEECTTSSHHHHHHHHH
T ss_pred             EEECCCCcCHHHHHHHHH
Confidence            389999999999999864

>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1

Probab=96.39  E-value=0.0012  Score=45.36  Aligned_cols=21  Identities=24%  Similarity=0.180  Sum_probs=18.3

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|.|+.|+||||+++.+.+.
T Consensus        13 I~l~G~~GsGKSTv~~~La~~   33 (184)
T 1y63_A           13 ILITGTPGTGKTSMAEMIAAE   33 (184)
T ss_dssp             EEEECSTTSSHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHh
Confidence            349999999999999998765

>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A*

Probab=96.39  E-value=0.0013  Score=44.92  Aligned_cols=21  Identities=24%  Similarity=0.166  Sum_probs=18.1

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|.|+.|+||||+++.+...
T Consensus         5 I~l~G~~GsGKsT~a~~La~~   25 (184)
T 2iyv_A            5 AVLVGLPGSGKSTIGRRLAKA   25 (184)
T ss_dssp             EEEECSTTSSHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            448999999999999998664

>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A*

Probab=96.39  E-value=0.0013  Score=44.22  Aligned_cols=21  Identities=19%  Similarity=0.156  Sum_probs=18.2

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|.|+.|+||||+++.+.+.
T Consensus         5 I~l~G~~GsGKsT~a~~La~~   25 (173)
T 1e6c_A            5 IFMVGARGCGMTTVGRELARA   25 (173)
T ss_dssp             EEEESCTTSSHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            448999999999999998664

>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1

Probab=96.38  E-value=0.0013  Score=44.84  Aligned_cols=19  Identities=26%  Similarity=0.314  Sum_probs=16.9

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|+.|+||||+++.+...
T Consensus         8 l~G~~GsGKsT~a~~L~~~   26 (196)
T 1tev_A            8 VLGGPGAGKGTQCARIVEK   26 (196)
T ss_dssp             EECCTTSSHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHH
Confidence            8999999999999988654

>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens}

Probab=96.38  E-value=0.0012  Score=48.64  Aligned_cols=22  Identities=23%  Similarity=0.069  Sum_probs=19.5

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+||||||+.+.+..
T Consensus        47 vlL~Gp~GtGKTtLakala~~~   68 (274)
T 2x8a_A           47 VLLAGPPGCGKTLLAKAVANES   68 (274)
T ss_dssp             EEEESSTTSCHHHHHHHHHHHT
T ss_pred             EEEECCCCCcHHHHHHHHHHHc
Confidence            4589999999999999998864

>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster}

Probab=96.37  E-value=0.0012  Score=48.38  Aligned_cols=22  Identities=27%  Similarity=0.205  Sum_probs=19.5

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+||||||+.+.+..
T Consensus        57 vll~Gp~GtGKT~la~~la~~~   78 (297)
T 3b9p_A           57 LLLFGPPGNGKTLLARAVATEC   78 (297)
T ss_dssp             EEEESSSSSCHHHHHHHHHHHT
T ss_pred             EEEECcCCCCHHHHHHHHHHHh
Confidence            3499999999999999998865

>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii}

Probab=96.37  E-value=0.0013  Score=45.47  Aligned_cols=21  Identities=19%  Similarity=0.104  Sum_probs=18.9

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|+.|+||||+++.+....
T Consensus         8 ~i~G~~GsGKsT~~~~L~~~l   28 (213)
T 2plr_A            8 AFEGIDGSGKSSQATLLKDWI   28 (213)
T ss_dssp             EEECCTTSSHHHHHHHHHHHH
T ss_pred             EEEcCCCCCHHHHHHHHHHHH
Confidence            389999999999999998865

>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A*

Probab=96.36  E-value=0.0013  Score=46.21  Aligned_cols=20  Identities=25%  Similarity=0.018  Sum_probs=17.6

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|.|..|+||||+++.+...
T Consensus         9 ~i~G~~GsGKSTl~~~L~~~   28 (227)
T 1cke_A            9 TIDGPSGAGKGTLCKAMAEA   28 (227)
T ss_dssp             EEECCTTSSHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHH
Confidence            39999999999999998654

>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20

Probab=96.36  E-value=0.00068  Score=50.64  Aligned_cols=21  Identities=24%  Similarity=0.398  Sum_probs=18.9

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+||||||+.+.+..
T Consensus        62 ll~G~~G~GKT~la~~la~~l   82 (353)
T 1sxj_D           62 LFYGPPGTGKTSTILALTKEL   82 (353)
T ss_dssp             EEECSTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHh
Confidence            399999999999999998864

>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans}

Probab=96.35  E-value=0.00096  Score=45.34  Aligned_cols=21  Identities=29%  Similarity=0.415  Sum_probs=14.2

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|+.|+||||+++.+.+..
T Consensus         9 ~l~G~~GsGKST~a~~La~~l   29 (183)
T 2vli_A            9 WINGPFGVGKTHTAHTLHERL   29 (183)
T ss_dssp             EEECCC----CHHHHHHHHHS
T ss_pred             EEECCCCCCHHHHHHHHHHhc
Confidence            389999999999999987653

>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus}

Probab=96.34  E-value=0.0014  Score=43.87  Aligned_cols=20  Identities=25%  Similarity=0.036  Sum_probs=17.0

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|.|+.|+||||+++.+.+
T Consensus         3 I~l~G~~GsGKsT~a~~L~~   22 (168)
T 2pt5_A            3 IYLIGFMCSGKSTVGSLLSR   22 (168)
T ss_dssp             EEEESCTTSCHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            34789999999999998765

>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A*

Probab=96.34  E-value=0.0013  Score=47.80  Aligned_cols=20  Identities=25%  Similarity=0.049  Sum_probs=18.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+||||||+.+.+..
T Consensus        69 l~G~~GtGKT~la~~ia~~~   88 (272)
T 1d2n_A           69 LEGPPHSGKTALAAKIAEES   88 (272)
T ss_dssp             EECSTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCcHHHHHHHHHHHh
Confidence            99999999999999998864

>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A

Probab=96.33  E-value=0.0014  Score=45.98  Aligned_cols=20  Identities=25%  Similarity=0.154  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        25 l~GpnGsGKSTLl~~l~gl~   44 (207)
T 1znw_A           25 LSGPSAVGKSTVVRCLRERI   44 (207)
T ss_dssp             EECSTTSSHHHHHHHHHHHS
T ss_pred             EECCCCCCHHHHHHHHHhhC
Confidence            99999999999999987754

>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus}

Probab=96.33  E-value=0.0013  Score=48.82  Aligned_cols=21  Identities=24%  Similarity=0.219  Sum_probs=19.2

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+||||||+.+.+..
T Consensus        53 LL~Gp~GtGKT~la~ala~~~   73 (301)
T 3cf0_A           53 LFYGPPGCGKTLLAKAIANEC   73 (301)
T ss_dssp             EEECSSSSSHHHHHHHHHHHT
T ss_pred             EEECCCCcCHHHHHHHHHHHh
Confidence            499999999999999999865

>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A*

Probab=96.33  E-value=0.0013  Score=47.28  Aligned_cols=20  Identities=25%  Similarity=0.169  Sum_probs=17.6

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|.||+|||||+..+....
T Consensus        19 ~~GkgGvGKTTl~~~La~~l   38 (262)
T 1yrb_A           19 FVGTAGSGKTTLTGEFGRYL   38 (262)
T ss_dssp             EECSTTSSHHHHHHHHHHHH
T ss_pred             EeCCCCCCHHHHHHHHHHHH
Confidence            89999999999999987544

>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C*

Probab=96.32  E-value=0.0013  Score=48.74  Aligned_cols=22  Identities=32%  Similarity=0.315  Sum_probs=19.6

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+||||||+.+.+..
T Consensus        41 vll~G~~GtGKT~la~~i~~~~   62 (324)
T 1hqc_A           41 LLLFGPPGLGKTTLAHVIAHEL   62 (324)
T ss_dssp             CEEECCTTCCCHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            3499999999999999998865

>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B*

Probab=96.31  E-value=0.0014  Score=48.72  Aligned_cols=21  Identities=29%  Similarity=0.230  Sum_probs=18.6

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +|.|+.|+|||||++.+.+..
T Consensus        37 vl~G~sGsGKSTla~~L~~~~   57 (287)
T 1gvn_B           37 LLGGQPGSGKTSLRSAIFEET   57 (287)
T ss_dssp             EEECCTTSCTHHHHHHHHHHT
T ss_pred             EEECCCCCCHHHHHHHHHHHh
Confidence            499999999999999997754

>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20

Probab=96.31  E-value=0.0014  Score=47.95  Aligned_cols=21  Identities=29%  Similarity=0.207  Sum_probs=19.0

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+|||||++.+.+..
T Consensus        77 ll~Gp~GtGKTtl~~~i~~~~   97 (278)
T 1iy2_A           77 LLVGPPGVGKTHLARAVAGEA   97 (278)
T ss_dssp             EEECCTTSSHHHHHHHHHHHT
T ss_pred             EEECCCcChHHHHHHHHHHHc
Confidence            399999999999999998865

>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A*

Probab=96.31  E-value=0.0016  Score=43.91  Aligned_cols=24  Identities=17%  Similarity=0.069  Sum_probs=19.9

Q ss_pred             CCccccCcCCCchhHHHHhhhhhh
Q 042811           87 GNNWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        87 ~~l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ..+.|.|+.|+||||+++.+.+..
T Consensus         8 ~~i~l~G~~GsGKSTva~~La~~l   31 (168)
T 1zuh_A            8 QHLVLIGFMGSGKSSLAQELGLAL   31 (168)
T ss_dssp             CEEEEESCTTSSHHHHHHHHHHHH
T ss_pred             ceEEEECCCCCCHHHHHHHHHHHh
Confidence            344589999999999999987754

>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae}

Probab=96.30  E-value=0.001  Score=44.11  Aligned_cols=22  Identities=14%  Similarity=-0.183  Sum_probs=19.4

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|-.|+|||+||+.+++..
T Consensus        30 vll~G~~GtGKt~lA~~i~~~~   51 (143)
T 3co5_A           30 VFLTGEAGSPFETVARYFHKNG   51 (143)
T ss_dssp             EEEEEETTCCHHHHHGGGCCTT
T ss_pred             EEEECCCCccHHHHHHHHHHhC
Confidence            3499999999999999999864

>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A*

Probab=96.30  E-value=0.0013  Score=45.88  Aligned_cols=20  Identities=20%  Similarity=0.047  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+....
T Consensus        11 i~G~~GsGKSTl~~~l~~~~   30 (211)
T 3asz_A           11 IAGGTASGKTTLAQALARTL   30 (211)
T ss_dssp             EEESTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            89999999999999987754

>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum}

Probab=96.28  E-value=0.0015  Score=46.36  Aligned_cols=20  Identities=45%  Similarity=0.517  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+....
T Consensus        28 lvGpsGsGKSTLl~~L~g~~   47 (218)
T 1z6g_A           28 ICGPSGVGKGTLIKKLLNEF   47 (218)
T ss_dssp             EECSTTSSHHHHHHHHHHHS
T ss_pred             EECCCCCCHHHHHHHHHhhC
Confidence            99999999999999987743

>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A

Probab=96.26  E-value=0.0016  Score=45.13  Aligned_cols=22  Identities=27%  Similarity=0.232  Sum_probs=18.9

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|.|+.|+||||+++.+....
T Consensus        23 I~l~G~~GsGKST~a~~La~~l   44 (201)
T 2cdn_A           23 VLLLGPPGAGKGTQAVKLAEKL   44 (201)
T ss_dssp             EEEECCTTSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            3499999999999999987754

>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A

Probab=96.26  E-value=0.0015  Score=44.81  Aligned_cols=20  Identities=30%  Similarity=0.331  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|+.|+||||+++.+.+..
T Consensus        14 l~G~~GsGKsT~~~~La~~l   33 (196)
T 2c95_A           14 VVGGPGSGKGTQCEKIVQKY   33 (196)
T ss_dssp             EEECTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            99999999999999987654

>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3}

Probab=96.24  E-value=0.0017  Score=48.74  Aligned_cols=22  Identities=27%  Similarity=0.379  Sum_probs=20.1

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+|||+||+.+.+..
T Consensus       155 lll~G~~GtGKT~La~aia~~~  176 (308)
T 2qgz_A          155 LYLYGDMGIGKSYLLAAMAHEL  176 (308)
T ss_dssp             EEEECSTTSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
Confidence            4499999999999999999977

>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11

Probab=96.22  E-value=0.0017  Score=45.45  Aligned_cols=20  Identities=35%  Similarity=0.401  Sum_probs=17.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+....
T Consensus         6 i~G~nG~GKTTll~~l~g~~   25 (189)
T 2i3b_A            6 LTGPPGVGKTTLIHKASEVL   25 (189)
T ss_dssp             EESCCSSCHHHHHHHHHHHH
T ss_pred             EECCCCChHHHHHHHHHhhc
Confidence            89999999999999987654

>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A*

Probab=96.21  E-value=0.0015  Score=45.47  Aligned_cols=19  Identities=26%  Similarity=0.163  Sum_probs=17.5

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|..|+|||||++.+...
T Consensus        26 i~G~~GsGKSTl~~~L~~~   44 (207)
T 2qt1_A           26 ISGVTNSGKTTLAKNLQKH   44 (207)
T ss_dssp             EEESTTSSHHHHHHHHHTT
T ss_pred             EECCCCCCHHHHHHHHHHh
Confidence            9999999999999998764

>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10

Probab=96.20  E-value=0.0035  Score=43.34  Aligned_cols=21  Identities=24%  Similarity=0.150  Sum_probs=18.8

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|..|+|||||+..+....
T Consensus         8 ~i~G~sGsGKTTl~~~L~~~l   28 (169)
T 1xjc_A            8 QVVGYKHSGKTTLMEKWVAAA   28 (169)
T ss_dssp             EEECCTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHhh
Confidence            389999999999999998865

>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens}

Probab=96.19  E-value=0.0018  Score=48.70  Aligned_cols=22  Identities=27%  Similarity=0.196  Sum_probs=19.6

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|+|..|+||||||+.+.+..
T Consensus        48 iLL~GppGtGKT~la~ala~~~   69 (322)
T 1xwi_A           48 ILLFGPPGTGKSYLAKAVATEA   69 (322)
T ss_dssp             EEEESSSSSCHHHHHHHHHHHT
T ss_pred             EEEECCCCccHHHHHHHHHHHc
Confidence            3499999999999999999865

>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes}

Probab=96.17  E-value=0.0018  Score=45.55  Aligned_cols=20  Identities=30%  Similarity=0.280  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+....
T Consensus        13 l~GpsGsGKsTl~~~L~~~~   32 (208)
T 3tau_A           13 LSGPSGVGKGTVREAVFKDP   32 (208)
T ss_dssp             EECCTTSCHHHHHHHHHHST
T ss_pred             EECcCCCCHHHHHHHHHhhC
Confidence            89999999999999997754

>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1

Probab=96.17  E-value=0.0018  Score=45.06  Aligned_cols=18  Identities=28%  Similarity=0.073  Sum_probs=16.2

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |.|+.|+||||+++.+..
T Consensus         7 l~G~~GsGKST~~~~La~   24 (206)
T 1jjv_A            7 LTGGIGSGKTTIANLFTD   24 (206)
T ss_dssp             EECSTTSCHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHH
Confidence            899999999999999854

>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A*

Probab=96.17  E-value=0.0019  Score=45.43  Aligned_cols=21  Identities=29%  Similarity=0.290  Sum_probs=18.2

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|+.|+||||+++.+.+..
T Consensus         8 ~l~G~~GsGKsT~a~~La~~l   28 (220)
T 1aky_A            8 VLIGPPGAGKGTQAPNLQERF   28 (220)
T ss_dssp             EEECCTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHc
Confidence            389999999999999987654

>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A*

Probab=96.16  E-value=0.002  Score=43.69  Aligned_cols=21  Identities=29%  Similarity=0.302  Sum_probs=18.5

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+|||||++.+.+.+
T Consensus        18 ~vvG~~~~GKssL~~~l~~~~   38 (198)
T 3t1o_A           18 VYYGPGLSGKTTNLKWIYSKV   38 (198)
T ss_dssp             EEECSTTSSHHHHHHHHHHTS
T ss_pred             EEECCCCCCHHHHHHHHHhhc
Confidence            399999999999998887755

>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana}

Probab=96.15  E-value=0.0019  Score=47.25  Aligned_cols=22  Identities=23%  Similarity=0.207  Sum_probs=18.7

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|+.|+|||||++.+....
T Consensus        51 i~l~G~~GsGKSTl~~~La~~l   72 (250)
T 3nwj_A           51 MYLVGMMGSGKTTVGKIMARSL   72 (250)
T ss_dssp             EEEECSTTSCHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHhc
Confidence            3499999999999999987643

>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis}

Probab=96.15  E-value=0.00065  Score=53.75  Aligned_cols=32  Identities=19%  Similarity=0.192  Sum_probs=25.0

Q ss_pred             eeecccCCCCc------------cccCcCCCchhHHHHhhhhhh
Q 042811           79 KLGDVRRNGNN------------WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        79 ivG~~~~~~~l------------~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|++..++.+            +|+|-.|+||||||+.+.+..
T Consensus       182 iiGr~~~i~~l~~~l~r~~~~~~LL~G~pG~GKT~la~~la~~l  225 (468)
T 3pxg_A          182 VIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQQI  225 (468)
T ss_dssp             CCCCHHHHHHHHHHHHCSSSCEEEEESCTTTTTHHHHHHHHHHH
T ss_pred             ccCcHHHHHHHHHHHhccCCCCeEEECCCCCCHHHHHHHHHHHH
Confidence            58877543332            299999999999999998865

>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp}

Probab=96.15  E-value=0.002  Score=48.16  Aligned_cols=22  Identities=27%  Similarity=0.134  Sum_probs=19.3

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+||||||+.+.+..
T Consensus        58 vll~G~~GtGKT~la~~ia~~~   79 (338)
T 3pfi_A           58 ILFSGPAGLGKTTLANIISYEM   79 (338)
T ss_dssp             EEEECSTTSSHHHHHHHHHHHT
T ss_pred             EEEECcCCCCHHHHHHHHHHHh
Confidence            3499999999999999998764

>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A*

Probab=96.15  E-value=0.002  Score=44.66  Aligned_cols=22  Identities=27%  Similarity=0.371  Sum_probs=18.6

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|.|+.|+||||+++.+.+..
T Consensus        18 I~l~G~~GsGKsT~~~~L~~~~   39 (203)
T 1ukz_A           18 IFVLGGPGAGKGTQCEKLVKDY   39 (203)
T ss_dssp             EEEECSTTSSHHHHHHHHHHHS
T ss_pred             EEEECCCCCCHHHHHHHHHHHc
Confidence            3489999999999999987643

>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus}

Probab=96.14  E-value=0.0021  Score=43.85  Aligned_cols=19  Identities=37%  Similarity=0.471  Sum_probs=16.9

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|+.|+||||+++.+.+.
T Consensus         5 l~G~~GsGKsT~~~~L~~~   23 (195)
T 2pbr_A            5 FEGIDGSGKTTQAKKLYEY   23 (195)
T ss_dssp             EECSTTSCHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHH
Confidence            6899999999999998763

>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A*

Probab=96.14  E-value=0.0017  Score=45.98  Aligned_cols=21  Identities=33%  Similarity=0.344  Sum_probs=18.2

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|+.|+||||+++.+....
T Consensus        11 ~l~G~~GsGKsT~a~~La~~l   31 (227)
T 1zd8_A           11 VIMGAPGSGKGTVSSRITTHF   31 (227)
T ss_dssp             EEEECTTSSHHHHHHHHHHHS
T ss_pred             EEECCCCCCHHHHHHHHHHHc
Confidence            399999999999999987643

>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens}

Probab=96.13  E-value=0.0018  Score=44.40  Aligned_cols=21  Identities=29%  Similarity=0.365  Sum_probs=18.5

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|+.|+||||+++.+....
T Consensus        16 ~l~G~~GsGKsT~a~~L~~~l   36 (199)
T 2bwj_A           16 FIIGGPGSGKGTQCEKLVEKY   36 (199)
T ss_dssp             EEEECTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHh
Confidence            389999999999999997754

>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A*

Probab=96.13  E-value=0.0021  Score=45.11  Aligned_cols=21  Identities=24%  Similarity=0.366  Sum_probs=18.7

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|+.|+||||+++.+....
T Consensus        29 ~~~G~~GsGKsT~~~~l~~~l   49 (211)
T 1m7g_A           29 WLTGLSASGKSTLAVELEHQL   49 (211)
T ss_dssp             EEECSTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHh
Confidence            389999999999999998765

>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A*

Probab=96.11  E-value=0.0021  Score=46.01  Aligned_cols=20  Identities=15%  Similarity=0.096  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+....
T Consensus        21 l~GpsGsGKSTLlk~L~g~~   40 (219)
T 1s96_A           21 VSAPSGAGKSSLIQALLKTQ   40 (219)
T ss_dssp             EECCTTSCHHHHHHHHHHHS
T ss_pred             EECCCCCCHHHHHHHHhccC
Confidence            99999999999999998754

>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20

Probab=96.10  E-value=0.0021  Score=47.22  Aligned_cols=22  Identities=32%  Similarity=0.318  Sum_probs=19.4

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+||||||+.+.+..
T Consensus        45 ~ll~G~~G~GKt~la~~l~~~l   66 (323)
T 1sxj_B           45 MIISGMPGIGKTTSVHCLAHEL   66 (323)
T ss_dssp             EEEECSTTSSHHHHHHHHHHHH
T ss_pred             EEEECcCCCCHHHHHHHHHHHh
Confidence            3499999999999999998865

>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1

Probab=96.10  E-value=0.0019  Score=45.49  Aligned_cols=22  Identities=18%  Similarity=0.066  Sum_probs=19.0

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|.|+.|+||||+++.+.+..
T Consensus         8 I~l~G~~GsGKsT~~~~La~~l   29 (222)
T 1zak_A            8 VMISGAPASGKGTQCELIKTKY   29 (222)
T ss_dssp             EEEEESTTSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            3489999999999999997765

>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20

Probab=96.10  E-value=0.0021  Score=47.27  Aligned_cols=21  Identities=33%  Similarity=0.271  Sum_probs=19.0

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++|..|+||||+|+.+.+..
T Consensus        50 ll~G~~G~GKT~la~~l~~~l   70 (327)
T 1iqp_A           50 LFAGPPGVGKTTAALALAREL   70 (327)
T ss_dssp             EEESCTTSSHHHHHHHHHHHH
T ss_pred             EEECcCCCCHHHHHHHHHHHh
Confidence            399999999999999998864

>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus}

Probab=96.09  E-value=0.0023  Score=44.78  Aligned_cols=20  Identities=25%  Similarity=0.235  Sum_probs=16.7

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|.|+.|+||||+++.+..
T Consensus         3 I~l~G~~GsGKsT~a~~L~~   22 (216)
T 3fb4_A            3 IVLMGLPGAGKGTQAEQIIE   22 (216)
T ss_dssp             EEEECSTTSSHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            34789999999999998843

>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C

Probab=96.09  E-value=0.0021  Score=48.11  Aligned_cols=22  Identities=23%  Similarity=0.167  Sum_probs=19.6

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.++|..|+|||+||+.+.+..
T Consensus        54 vLl~GppGtGKT~la~aia~~~   75 (322)
T 3eie_A           54 ILLYGPPGTGKSYLAKAVATEA   75 (322)
T ss_dssp             EEEECSSSSCHHHHHHHHHHHH
T ss_pred             EEEECCCCCcHHHHHHHHHHHH
Confidence            3499999999999999998865

>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D*

Probab=96.08  E-value=0.0021  Score=48.24  Aligned_cols=21  Identities=38%  Similarity=0.544  Sum_probs=18.8

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|.+|+|||||++.+..-.
T Consensus       106 ~lvG~nGsGKTTll~~Lagll  126 (304)
T 1rj9_A          106 LVVGVNGVGKTTTIAKLGRYY  126 (304)
T ss_dssp             EEECSTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCcHHHHHHHHHHHH
Confidence            399999999999999998765

>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A*

Probab=96.07  E-value=0.0023  Score=43.57  Aligned_cols=21  Identities=29%  Similarity=0.411  Sum_probs=18.4

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|+.|+||||+++.+....
T Consensus         9 ~l~G~~GsGKST~~~~L~~~l   29 (179)
T 2pez_A            9 WLTGLSGAGKTTVSMALEEYL   29 (179)
T ss_dssp             EEECCTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHH
Confidence            389999999999999997754

>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A*

Probab=96.07  E-value=0.0021  Score=46.38  Aligned_cols=20  Identities=30%  Similarity=0.091  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        36 iiG~nGsGKSTLl~~l~Gl~   55 (235)
T 3tif_A           36 IMGPSGSGKSTMLNIIGCLD   55 (235)
T ss_dssp             EECSTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCcHHHHHHHHhcCC
Confidence            99999999999999987643

>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis}

Probab=96.06  E-value=0.0021  Score=46.58  Aligned_cols=19  Identities=26%  Similarity=0.020  Sum_probs=17.2

Q ss_pred             cccCcCCCchhHHHHhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~  108 (130)
                      .|.|+.|+|||||++.+..
T Consensus        31 ~I~G~~GsGKSTl~k~La~   49 (252)
T 4e22_A           31 TVDGPSGAGKGTLCKALAE   49 (252)
T ss_dssp             EEECCTTSSHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHH
Confidence            3999999999999999874

>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A

Probab=96.05  E-value=0.002  Score=46.16  Aligned_cols=20  Identities=30%  Similarity=0.062  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        35 iiG~nGsGKSTLl~~l~Gl~   54 (224)
T 2pcj_A           35 IIGASGSGKSTLLYILGLLD   54 (224)
T ss_dssp             EEECTTSCHHHHHHHHTTSS
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999987643

>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A*

Probab=96.05  E-value=0.0022  Score=43.64  Aligned_cols=21  Identities=29%  Similarity=0.422  Sum_probs=18.2

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|+.|+||||+++.+....
T Consensus        10 ~l~G~~GsGKsT~~~~L~~~l   30 (194)
T 1qf9_A           10 FVLGGPGSGKGTQCANIVRDF   30 (194)
T ss_dssp             EEEESTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHh
Confidence            389999999999999987653

>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A*

Probab=96.04  E-value=0.002  Score=45.14  Aligned_cols=19  Identities=26%  Similarity=0.165  Sum_probs=17.5

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|+|||||++.+...
T Consensus        30 l~G~nGsGKSTll~~l~g~   48 (231)
T 4a74_A           30 VFGEFGSGKTQLAHTLAVM   48 (231)
T ss_dssp             EEESTTSSHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHH
Confidence            9999999999999999763

>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ...

Probab=96.04  E-value=0.0021  Score=42.01  Aligned_cols=21  Identities=24%  Similarity=0.183  Sum_probs=17.9

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.++|.+|+|||||+..+.+.
T Consensus         6 i~v~G~~~~GKssl~~~l~~~   26 (166)
T 2ce2_X            6 LVVVGAGGVGKSALTIQLIQN   26 (166)
T ss_dssp             EEEEESTTSSHHHHHHHHHHS
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            348999999999999998654

>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6

Probab=96.04  E-value=0.0021  Score=44.86  Aligned_cols=20  Identities=20%  Similarity=0.135  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+....
T Consensus        27 i~G~~GsGKstl~~~l~~~~   46 (201)
T 1rz3_A           27 IDGLSRSGKTTLANQLSQTL   46 (201)
T ss_dssp             EEECTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            89999999999999988754

>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A

Probab=96.04  E-value=0.0024  Score=44.80  Aligned_cols=21  Identities=38%  Similarity=0.498  Sum_probs=17.9

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|..|+|||||++.+....
T Consensus         5 Vi~GPSG~GK~Tl~~~L~~~~   25 (186)
T 1ex7_A            5 VISGPSGTGKSTLLKKLFAEY   25 (186)
T ss_dssp             EEECCTTSSHHHHHHHHHHHC
T ss_pred             EEECCCCCCHHHHHHHHHHhC
Confidence            389999999999999986553

>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A*

Probab=96.03  E-value=0.0024  Score=44.70  Aligned_cols=20  Identities=25%  Similarity=0.192  Sum_probs=16.7

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|.|+.|+||||+++.+..
T Consensus         3 I~l~G~~GsGKsT~a~~L~~   22 (216)
T 3dl0_A            3 LVLMGLPGAGKGTQGERIVE   22 (216)
T ss_dssp             EEEECSTTSSHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            34789999999999998743

>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B*

Probab=96.02  E-value=0.0023  Score=43.52  Aligned_cols=20  Identities=30%  Similarity=0.265  Sum_probs=17.5

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|.+|+|||||++.+.+
T Consensus         5 v~ivG~~gvGKStLl~~l~~   24 (184)
T 2zej_A            5 LMIVGNTGSGKTTLLQQLMK   24 (184)
T ss_dssp             EEEESCTTSSHHHHHHHHTC
T ss_pred             EEEECCCCCCHHHHHHHHhc
Confidence            34899999999999999876

>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A

Probab=96.02  E-value=0.0025  Score=43.37  Aligned_cols=20  Identities=25%  Similarity=0.132  Sum_probs=17.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+..-.
T Consensus        38 L~G~nGaGKTTLlr~l~g~l   57 (158)
T 1htw_A           38 LNGDLGAGKTTLTRGMLQGI   57 (158)
T ss_dssp             EECSTTSSHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHhC
Confidence            89999999999999987754

>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii}

Probab=96.00  E-value=0.0026  Score=43.00  Aligned_cols=20  Identities=30%  Similarity=0.202  Sum_probs=17.8

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus        11 ~lvG~~gvGKStL~~~l~~~   30 (188)
T 2wjg_A           11 ALIGNPNVGKSTIFNALTGE   30 (188)
T ss_dssp             EEECSTTSSHHHHHHHHHTT
T ss_pred             EEECCCCCCHHHHHHHHhCC
Confidence            39999999999999998763

>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B*

Probab=96.00  E-value=0.0023  Score=44.06  Aligned_cols=19  Identities=37%  Similarity=0.408  Sum_probs=17.4

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|+|||||++.+.+.
T Consensus        34 lvG~~g~GKSTLl~~l~~~   52 (191)
T 1oix_A           34 LIGDSGVGKSNLLSRFTRN   52 (191)
T ss_dssp             EEECTTSSHHHHHHHHHHS
T ss_pred             EECcCCCCHHHHHHHHhcC
Confidence            9999999999999998764

>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A*

Probab=96.00  E-value=0.0023  Score=44.88  Aligned_cols=21  Identities=24%  Similarity=0.218  Sum_probs=17.9

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|.+|+|||||+..+.+..
T Consensus        42 ~ivG~~gvGKTtl~~~l~~~~   62 (226)
T 2hf9_A           42 DFMGAIGSGKTLLIEKLIDNL   62 (226)
T ss_dssp             EEEESTTSSHHHHHHHHHHHH
T ss_pred             EEEcCCCCCHHHHHHHHHHHh
Confidence            488999999999999887653

>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens}

Probab=95.99  E-value=0.0025  Score=46.05  Aligned_cols=20  Identities=35%  Similarity=0.413  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        36 i~G~nGsGKSTLl~~l~Gl~   55 (237)
T 2cbz_A           36 VVGQVGCGKSSLLSALLAEM   55 (237)
T ss_dssp             EECSTTSSHHHHHHHHTTCS
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999997754

>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A*

Probab=95.99  E-value=0.0026  Score=41.90  Aligned_cols=20  Identities=20%  Similarity=0.222  Sum_probs=17.6

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|.+|+|||||+..+.+.
T Consensus         9 ~v~G~~~~GKssl~~~l~~~   28 (168)
T 1z2a_A            9 VVVGNGAVGKSSMIQRYCKG   28 (168)
T ss_dssp             EEECSTTSSHHHHHHHHHHC
T ss_pred             EEECcCCCCHHHHHHHHHcC
Confidence            48999999999999998664

>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A*

Probab=95.98  E-value=0.0026  Score=43.79  Aligned_cols=19  Identities=37%  Similarity=0.408  Sum_probs=17.4

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|+|||||++.+.+.
T Consensus        10 lvG~~g~GKSTLl~~l~~~   28 (199)
T 2f9l_A           10 LIGDSGVGKSNLLSRFTRN   28 (199)
T ss_dssp             EESSTTSSHHHHHHHHHHS
T ss_pred             EECcCCCCHHHHHHHHhcC
Confidence            8999999999999998765

>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12

Probab=95.97  E-value=0.0026  Score=46.15  Aligned_cols=20  Identities=25%  Similarity=0.172  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        29 liG~nGsGKSTLl~~l~Gl~   48 (240)
T 2onk_A           29 LLGPTGAGKSVFLELIAGIV   48 (240)
T ss_dssp             EECCTTSSHHHHHHHHHTSS
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999987643

>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus}

Probab=95.97  E-value=0.0027  Score=41.61  Aligned_cols=21  Identities=19%  Similarity=0.194  Sum_probs=17.9

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus         4 i~v~G~~~~GKSsli~~l~~~   24 (161)
T 2dyk_A            4 VVIVGRPNVGKSSLFNRLLKK   24 (161)
T ss_dssp             EEEECCTTSSHHHHHHHHHHC
T ss_pred             EEEECCCCCCHHHHHHHHhCC
Confidence            448999999999999998654

>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A*

Probab=95.97  E-value=0.0024  Score=44.27  Aligned_cols=28  Identities=14%  Similarity=0.031  Sum_probs=22.1

Q ss_pred             cccCcCCCchhHHHHhhhhhhhhccCCCCe
Q 042811           90 WPFGVEGVGKITSLSKSYPEFLEDEGIFLI  119 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~~~~~~~Fd~  119 (130)
                      .|.|+.|+||||+++.+.+.. .. ..++.
T Consensus        14 ~l~G~~GsGKST~~~~L~~~l-~~-~~~~~   41 (212)
T 2wwf_A           14 VFEGLDRSGKSTQSKLLVEYL-KN-NNVEV   41 (212)
T ss_dssp             EEEESTTSSHHHHHHHHHHHH-HH-TTCCE
T ss_pred             EEEcCCCCCHHHHHHHHHHHH-HH-cCCcE
Confidence            399999999999999998865 32 35554

>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A*

Probab=95.97  E-value=0.0026  Score=42.52  Aligned_cols=20  Identities=30%  Similarity=0.202  Sum_probs=17.5

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|.+|+|||||++.+.+.
T Consensus         7 ~lvG~~gvGKStL~~~l~~~   26 (165)
T 2wji_A            7 ALIGNPNVGKSTIFNALTGE   26 (165)
T ss_dssp             EEECSTTSSHHHHHHHHHCC
T ss_pred             EEECCCCCCHHHHHHHHhCC
Confidence            38999999999999998663

>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae}

Probab=95.97  E-value=0.0019  Score=46.81  Aligned_cols=22  Identities=32%  Similarity=0.231  Sum_probs=19.0

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|.|..|+||||+++.+....
T Consensus        35 i~l~G~~GsGKSTla~~L~~~l   56 (253)
T 2p5t_B           35 ILLGGQSGAGKTTIHRIKQKEF   56 (253)
T ss_dssp             EEEESCGGGTTHHHHHHHHHHT
T ss_pred             EEEECCCCCCHHHHHHHHHHhc
Confidence            3489999999999999997754

>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A*

Probab=95.97  E-value=0.0027  Score=43.09  Aligned_cols=21  Identities=24%  Similarity=0.183  Sum_probs=18.2

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|.+|+|||||+..+.+.
T Consensus        24 i~vvG~~~~GKSsli~~l~~~   44 (190)
T 3con_A           24 LVVVGAGGVGKSALTIQLIQN   44 (190)
T ss_dssp             EEEECSTTSSHHHHHHHHHHS
T ss_pred             EEEECcCCCCHHHHHHHHHcC
Confidence            449999999999999998654

>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A*

Probab=95.96  E-value=0.0025  Score=44.28  Aligned_cols=28  Identities=21%  Similarity=0.032  Sum_probs=22.0

Q ss_pred             cccCcCCCchhHHHHhhhhhhhhccCCCCe
Q 042811           90 WPFGVEGVGKITSLSKSYPEFLEDEGIFLI  119 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~~~~~~~Fd~  119 (130)
                      .|.|+.|+||||+++.+.+.. .. ..++.
T Consensus        13 ~l~G~~GsGKsT~~~~L~~~l-~~-~~~~v   40 (215)
T 1nn5_A           13 VLEGVDRAGKSTQSRKLVEAL-CA-AGHRA   40 (215)
T ss_dssp             EEEESTTSSHHHHHHHHHHHH-HH-TTCCE
T ss_pred             EEECCCCCCHHHHHHHHHHHH-HH-cCCcE
Confidence            399999999999999998865 32 34554

>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1

Probab=95.95  E-value=0.0023  Score=44.03  Aligned_cols=18  Identities=28%  Similarity=0.119  Sum_probs=16.5

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |.|+.|+||||+++.+-.
T Consensus        13 i~G~~GsGKST~~~~La~   30 (203)
T 1uf9_A           13 ITGNIGSGKSTVAALLRS   30 (203)
T ss_dssp             EEECTTSCHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHH
Confidence            999999999999998765

>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D*

Probab=95.95  E-value=0.0024  Score=48.08  Aligned_cols=20  Identities=20%  Similarity=0.149  Sum_probs=19.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+||||||+.+.+..
T Consensus        75 l~GppGtGKT~la~~la~~l   94 (368)
T 3uk6_A           75 IAGQPGTGKTAIAMGMAQAL   94 (368)
T ss_dssp             EEESTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            99999999999999999876

>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A*

Probab=95.94  E-value=0.0027  Score=46.39  Aligned_cols=20  Identities=25%  Similarity=0.217  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        38 liG~nGsGKSTLlk~l~Gl~   57 (257)
T 1g6h_A           38 IIGPNGSGKSTLINVITGFL   57 (257)
T ss_dssp             EECSTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999987644

>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A*

Probab=95.94  E-value=0.0028  Score=43.69  Aligned_cols=20  Identities=20%  Similarity=0.165  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|+.|+||||+++.+.+..
T Consensus         9 l~G~~GsGKsT~~~~L~~~l   28 (204)
T 2v54_A            9 FEGLDKSGKTTQCMNIMESI   28 (204)
T ss_dssp             EECCTTSSHHHHHHHHHHTS
T ss_pred             EEcCCCCCHHHHHHHHHHHH
Confidence            89999999999999997754

>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli}

Probab=95.93  E-value=0.00087  Score=53.76  Aligned_cols=21  Identities=19%  Similarity=0.262  Sum_probs=19.2

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+|||+||+.+.+..
T Consensus        45 LL~GpPGtGKT~LAraLa~~l   65 (500)
T 3nbx_X           45 FLLGPPGIAKSLIARRLKFAF   65 (500)
T ss_dssp             EEECCSSSSHHHHHHHGGGGB
T ss_pred             EeecCchHHHHHHHHHHHHHH
Confidence            399999999999999999865

>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032}

Probab=95.93  E-value=0.0025  Score=45.22  Aligned_cols=19  Identities=21%  Similarity=0.191  Sum_probs=17.6

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|+|||||++.+..-
T Consensus        27 liG~nGsGKSTLl~~l~Gl   45 (208)
T 3b85_A           27 GLGPAGSGKTYLAMAKAVQ   45 (208)
T ss_dssp             EECCTTSSTTHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHhcC
Confidence            8999999999999998765

>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12

Probab=95.93  E-value=0.0027  Score=46.54  Aligned_cols=20  Identities=30%  Similarity=0.082  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        37 liG~nGsGKSTLlk~l~Gl~   56 (262)
T 1b0u_A           37 IIGSSGSGKSTFLRCINFLE   56 (262)
T ss_dssp             EECCTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999987643

>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae}

Probab=95.92  E-value=0.0022  Score=48.64  Aligned_cols=21  Identities=10%  Similarity=0.153  Sum_probs=19.5

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+|||++++.|.+..
T Consensus        49 li~GpPGTGKT~~v~~v~~~L   69 (318)
T 3te6_A           49 YITNADDSTKFQLVNDVMDEL   69 (318)
T ss_dssp             EEECCCSHHHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHH
Confidence            389999999999999999987

>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A*

Probab=95.92  E-value=0.003  Score=45.68  Aligned_cols=21  Identities=24%  Similarity=0.067  Sum_probs=19.2

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|-.|+|||+||+.+.+..
T Consensus        33 ll~G~~GtGKt~la~~i~~~~   53 (265)
T 2bjv_A           33 LIIGERGTGKELIASRLHYLS   53 (265)
T ss_dssp             EEECCTTSCHHHHHHHHHHTS
T ss_pred             EEECCCCCcHHHHHHHHHHhc
Confidence            499999999999999999865

>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12

Probab=95.92  E-value=0.0028  Score=45.81  Aligned_cols=20  Identities=35%  Similarity=0.396  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        37 l~G~nGsGKSTLl~~l~Gl~   56 (240)
T 1ji0_A           37 LIGANGAGKTTTLSAIAGLV   56 (240)
T ss_dssp             EECSTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999987743

>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A*

Probab=95.91  E-value=0.0028  Score=47.75  Aligned_cols=20  Identities=25%  Similarity=0.137  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+..-.
T Consensus        95 I~G~sGsGKSTL~~~L~gll  114 (312)
T 3aez_A           95 VAGSVAVGKSTTARVLQALL  114 (312)
T ss_dssp             EECCTTSCHHHHHHHHHHHH
T ss_pred             EECCCCchHHHHHHHHHhhc
Confidence            89999999999999998865

>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana}

Probab=95.91  E-value=0.0028  Score=47.51  Aligned_cols=20  Identities=45%  Similarity=0.504  Sum_probs=18.6

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+....
T Consensus       105 lvG~nGsGKTTll~~Lag~l  124 (302)
T 3b9q_A          105 IVGVNGGGKTTSLGKLAHRL  124 (302)
T ss_dssp             EECCTTSCHHHHHHHHHHHH
T ss_pred             EEcCCCCCHHHHHHHHHHHH
Confidence            99999999999999998765

>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A*

Probab=95.91  E-value=0.0029  Score=46.03  Aligned_cols=19  Identities=26%  Similarity=0.186  Sum_probs=17.8

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|+|||||++.+..-
T Consensus        34 l~G~nGsGKSTLlk~l~Gl   52 (250)
T 2d2e_A           34 LMGPNGAGKSTLGKILAGD   52 (250)
T ss_dssp             EECSTTSSHHHHHHHHHTC
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            9999999999999999874

>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12

Probab=95.90  E-value=0.0029  Score=45.18  Aligned_cols=20  Identities=30%  Similarity=0.351  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        40 iiG~NGsGKSTLlk~l~Gl~   59 (214)
T 1sgw_A           40 FHGPNGIGKTTLLKTISTYL   59 (214)
T ss_dssp             EECCTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999997754

>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A*

Probab=95.90  E-value=0.0029  Score=46.26  Aligned_cols=22  Identities=23%  Similarity=0.129  Sum_probs=19.4

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.++|-.|+||||||+.+.+..
T Consensus        53 vll~G~~GtGKT~la~~la~~l   74 (310)
T 1ofh_A           53 ILMIGPTGVGKTEIARRLAKLA   74 (310)
T ss_dssp             EEEECCTTSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            3489999999999999998865

>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A

Probab=95.89  E-value=0.0029  Score=45.41  Aligned_cols=20  Identities=30%  Similarity=0.333  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+..-.
T Consensus        39 i~G~nGsGKSTLl~~l~Gl~   58 (229)
T 2pze_A           39 VAGSTGAGKTSLLMMIMGEL   58 (229)
T ss_dssp             EECCTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A*

Probab=95.88  E-value=0.0029  Score=43.99  Aligned_cols=18  Identities=22%  Similarity=0.148  Sum_probs=17.0

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |+|.+|+|||||+..+..
T Consensus        25 i~G~~GsGKTtl~~~l~~   42 (220)
T 2cvh_A           25 VYGPYASGKTTLALQTGL   42 (220)
T ss_dssp             EECSTTSSHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHH
Confidence            999999999999999876

>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A*

Probab=95.87  E-value=0.003  Score=48.08  Aligned_cols=21  Identities=24%  Similarity=0.219  Sum_probs=19.3

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +|+|..|+||||||+.+.+..
T Consensus        88 LL~GppGtGKT~la~ala~~~  108 (355)
T 2qp9_X           88 LLYGPPGTGKSYLAKAVATEA  108 (355)
T ss_dssp             EEECSTTSCHHHHHHHHHHHH
T ss_pred             EEECCCCCcHHHHHHHHHHHh
Confidence            399999999999999999865

>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12

Probab=95.87  E-value=0.003  Score=45.71  Aligned_cols=20  Identities=30%  Similarity=0.144  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        33 i~G~nGsGKSTLl~~l~Gl~   52 (243)
T 1mv5_A           33 FAGPSGGGKSTIFSLLERFY   52 (243)
T ss_dssp             EECCTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999987643

>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A*

Probab=95.87  E-value=0.0013  Score=45.78  Aligned_cols=19  Identities=37%  Similarity=0.358  Sum_probs=16.5

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|..|+|||||++.+...
T Consensus         5 i~G~~GsGKsTl~~~L~~~   23 (214)
T 1gtv_A            5 IEGVDGAGKRTLVEKLSGA   23 (214)
T ss_dssp             EEEEEEEEHHHHHHHHHHH
T ss_pred             EEcCCCCCHHHHHHHHHHH
Confidence            7899999999999998543

>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens}

Probab=95.87  E-value=0.003  Score=48.03  Aligned_cols=20  Identities=25%  Similarity=0.167  Sum_probs=18.6

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+||||||+.+.+..
T Consensus       122 l~GppGtGKT~la~aia~~~  141 (357)
T 3d8b_A          122 LFGPPGTGKTLIGKCIASQS  141 (357)
T ss_dssp             EESSTTSSHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHc
Confidence            99999999999999998864

>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A*

Probab=95.86  E-value=0.0033  Score=44.62  Aligned_cols=19  Identities=32%  Similarity=0.240  Sum_probs=16.5

Q ss_pred             cccCcCCCchhHHHHhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~  108 (130)
                      .|.|+.|+||||+++.+..
T Consensus         4 ~l~G~~GsGKsT~a~~La~   22 (223)
T 2xb4_A            4 LIFGPNGSGKGTQGNLVKD   22 (223)
T ss_dssp             EEECCTTSCHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHH
Confidence            3789999999999998854

>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J*

Probab=95.83  E-value=0.0032  Score=46.36  Aligned_cols=20  Identities=30%  Similarity=0.102  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        55 liG~NGsGKSTLlk~l~Gl~   74 (263)
T 2olj_A           55 VIGPSGSGKSTFLRCLNLLE   74 (263)
T ss_dssp             EECCTTSSHHHHHHHHTTSS
T ss_pred             EEcCCCCcHHHHHHHHHcCC
Confidence            99999999999999987643

>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A*

Probab=95.83  E-value=0.0027  Score=47.46  Aligned_cols=20  Identities=40%  Similarity=0.483  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|.+|+||||++.++....
T Consensus       110 lvG~~GsGKTTl~~~LA~~l  129 (296)
T 2px0_A          110 LFGSTGAGKTTTLAKLAAIS  129 (296)
T ss_dssp             EEESTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            99999999999999998766

>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A*

Probab=95.83  E-value=0.0027  Score=43.64  Aligned_cols=23  Identities=13%  Similarity=0.193  Sum_probs=19.1

Q ss_pred             CccccCcCCCchhHHHHhhhhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++.|+|.+|+|||||++.+.+.+
T Consensus        22 ki~~vG~~~vGKTsLi~~l~~~~   44 (196)
T 3llu_A           22 RILLMGLRRSGKSSIQKVVFHKM   44 (196)
T ss_dssp             EEEEEESTTSSHHHHHHHHHSCC
T ss_pred             EEEEECCCCCCHHHHHHHHHhcC
Confidence            34599999999999999877754

>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0

Probab=95.82  E-value=0.0034  Score=44.43  Aligned_cols=20  Identities=20%  Similarity=0.273  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+....
T Consensus        24 l~GPSGaGKsTL~~~L~~~~   43 (197)
T 3ney_A           24 LIGASGVGRSHIKNALLSQN   43 (197)
T ss_dssp             EECCTTSSHHHHHHHHHHHC
T ss_pred             EECcCCCCHHHHHHHHHhhC
Confidence            99999999999999998754

>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6

Probab=95.82  E-value=0.0032  Score=46.91  Aligned_cols=20  Identities=25%  Similarity=0.300  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+....
T Consensus        36 I~G~sGsGKSTla~~L~~~l   55 (290)
T 1odf_A           36 FSGPQGSGKSFTSIQIYNHL   55 (290)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            79999999999999987765

>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II}

Probab=95.82  E-value=0.0031  Score=44.46  Aligned_cols=21  Identities=29%  Similarity=0.260  Sum_probs=18.2

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|+.|+||||+++.+....
T Consensus         9 ~l~G~~GsGKsT~a~~La~~l   29 (217)
T 3be4_A            9 ILIGAPGSGKGTQCEFIKKEY   29 (217)
T ss_dssp             EEEECTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHh
Confidence            389999999999999987654

>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A*

Probab=95.82  E-value=0.0031  Score=44.24  Aligned_cols=19  Identities=21%  Similarity=0.039  Sum_probs=16.5

Q ss_pred             cccCcCCCchhHHHHhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~  108 (130)
                      .|.|+.|+||||+++.+.+
T Consensus         4 ~l~G~~GsGKsT~a~~L~~   22 (214)
T 1e4v_A            4 ILLGAPVAGKGTQAQFIME   22 (214)
T ss_dssp             EEEESTTSSHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHH
Confidence            4789999999999998754

>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens}

Probab=95.81  E-value=0.0029  Score=46.63  Aligned_cols=20  Identities=25%  Similarity=0.388  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+++-.
T Consensus         7 lvG~nGaGKSTLln~L~g~~   26 (270)
T 3sop_A            7 VVGQSGLGKSTLVNTLFKSQ   26 (270)
T ss_dssp             EEESSSSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            79999999999999998754

>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A*

Probab=95.81  E-value=0.0033  Score=46.37  Aligned_cols=20  Identities=25%  Similarity=0.235  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        50 i~G~nGsGKSTLlk~l~Gl~   69 (271)
T 2ixe_A           50 LVGPNGSGKSTVAALLQNLY   69 (271)
T ss_dssp             EECSTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999997744

>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A*

Probab=95.81  E-value=0.0033  Score=45.70  Aligned_cols=20  Identities=25%  Similarity=0.165  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        40 i~G~nGsGKSTLl~~l~Gl~   59 (247)
T 2ff7_A           40 IVGRSGSGKSTLTKLIQRFY   59 (247)
T ss_dssp             EECSTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999987643

>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A*

Probab=95.81  E-value=0.0035  Score=41.09  Aligned_cols=20  Identities=25%  Similarity=0.200  Sum_probs=17.4

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus         8 ~v~G~~~~GKssl~~~l~~~   27 (168)
T 1u8z_A            8 IMVGSGGVGKSALTLQFMYD   27 (168)
T ss_dssp             EEECSTTSSHHHHHHHHHHS
T ss_pred             EEECCCCCCHHHHHHHHHhC
Confidence            38999999999999998654

>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A

Probab=95.81  E-value=0.0033  Score=46.20  Aligned_cols=19  Identities=26%  Similarity=0.218  Sum_probs=17.8

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|+|||||++.+..-
T Consensus        51 l~G~NGsGKSTLlk~l~Gl   69 (267)
T 2zu0_C           51 IMGPNGSGKSTLSATLAGR   69 (267)
T ss_dssp             EECCTTSSHHHHHHHHHTC
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            9999999999999999874

>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C

Probab=95.80  E-value=0.0034  Score=45.83  Aligned_cols=20  Identities=30%  Similarity=0.285  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        31 liG~NGsGKSTLlk~l~Gl~   50 (249)
T 2qi9_C           31 LVGPNGAGKSTLLARMAGMT   50 (249)
T ss_dssp             EECCTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCcHHHHHHHHhCCC
Confidence            99999999999999987754

>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A*

Probab=95.80  E-value=0.0036  Score=44.60  Aligned_cols=22  Identities=32%  Similarity=0.323  Sum_probs=19.3

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|.|+.|+||||+++.+.+..
T Consensus        19 I~l~G~~GsGKsT~a~~La~~l   40 (233)
T 1ak2_A           19 AVLLGPPGAGKGTQAPKLAKNF   40 (233)
T ss_dssp             EEEECCTTSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            4599999999999999998765

>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str}

Probab=95.79  E-value=0.0034  Score=45.97  Aligned_cols=20  Identities=30%  Similarity=0.325  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        51 i~G~nGsGKSTLl~~l~Gl~   70 (260)
T 2ghi_A           51 LVGHTGSGKSTIAKLLYRFY   70 (260)
T ss_dssp             EECSTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCCHHHHHHHHhccC
Confidence            99999999999999997743

>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae}

Probab=95.79  E-value=0.0036  Score=42.58  Aligned_cols=21  Identities=19%  Similarity=0.117  Sum_probs=18.1

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        51 i~vvG~~g~GKSsll~~l~~~   71 (193)
T 2ged_A           51 IIIAGPQNSGKTSLLTLLTTD   71 (193)
T ss_dssp             EEEECCTTSSHHHHHHHHHHS
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            349999999999999998764

>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima}

Probab=95.77  E-value=0.0035  Score=46.05  Aligned_cols=20  Identities=30%  Similarity=0.164  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        38 liG~nGsGKSTLl~~i~Gl~   57 (266)
T 2yz2_A           38 VAGNTGSGKSTLLQIVAGLI   57 (266)
T ss_dssp             EECSTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCcHHHHHHHHhCCC
Confidence            99999999999999987743

>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124}

Probab=95.77  E-value=0.0035  Score=46.47  Aligned_cols=20  Identities=30%  Similarity=0.310  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        39 iiGpnGsGKSTLl~~l~Gl~   58 (275)
T 3gfo_A           39 ILGGNGVGKSTLFQNFNGIL   58 (275)
T ss_dssp             EECCTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCCHHHHHHHHHcCC
Confidence            99999999999999987643

>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20

Probab=95.76  E-value=0.0033  Score=47.09  Aligned_cols=21  Identities=24%  Similarity=0.251  Sum_probs=18.6

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||++.+.+.
T Consensus        39 ~ll~Gp~G~GKTtl~~~la~~   59 (354)
T 1sxj_E           39 LLLYGPNGTGKKTRCMALLES   59 (354)
T ss_dssp             EEEECSTTSSHHHHHHTHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            449999999999999998874

>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12

Probab=95.76  E-value=0.0035  Score=45.88  Aligned_cols=20  Identities=30%  Similarity=0.345  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        46 l~G~NGsGKSTLlk~l~Gl~   65 (256)
T 1vpl_A           46 LIGPNGAGKTTTLRIISTLI   65 (256)
T ss_dssp             EECCTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999987743

>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D*

Probab=95.75  E-value=0.0038  Score=41.06  Aligned_cols=20  Identities=25%  Similarity=0.222  Sum_probs=17.4

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus         7 ~v~G~~~~GKssli~~l~~~   26 (167)
T 1c1y_A            7 VVLGSGGVGKSALTVQFVQG   26 (167)
T ss_dssp             EEECSTTSSHHHHHHHHHHC
T ss_pred             EEECCCCCCHHHHHHHHHcC
Confidence            38999999999999998654

>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A*

Probab=95.75  E-value=0.0036  Score=45.94  Aligned_cols=22  Identities=23%  Similarity=0.199  Sum_probs=19.5

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.++|-.|+||||||+.+.+..
T Consensus        50 ~ll~G~~GtGKt~la~~la~~~   71 (311)
T 4fcw_A           50 FLFLGPTGVGKTELAKTLAATL   71 (311)
T ss_dssp             EEEESCSSSSHHHHHHHHHHHH
T ss_pred             EEEECCCCcCHHHHHHHHHHHH
Confidence            3489999999999999998865

>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus}

Probab=95.74  E-value=0.0036  Score=46.41  Aligned_cols=20  Identities=30%  Similarity=0.358  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        52 liG~NGsGKSTLlk~l~Gl~   71 (279)
T 2ihy_A           52 LYGLNGAGKTTLLNILNAYE   71 (279)
T ss_dssp             EECCTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCcHHHHHHHHhCCC
Confidence            99999999999999987754

>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis}

Probab=95.74  E-value=0.0035  Score=46.14  Aligned_cols=20  Identities=30%  Similarity=0.245  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+..-.
T Consensus        42 liG~nGsGKSTLl~~l~Gl~   61 (266)
T 4g1u_C           42 IIGPNGAGKSTLLRLLTGYL   61 (266)
T ss_dssp             EECCTTSCHHHHHHHHTSSS
T ss_pred             EECCCCCcHHHHHHHHhcCC
Confidence            99999999999999987643

>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli}

Probab=95.74  E-value=0.0035  Score=49.42  Aligned_cols=20  Identities=25%  Similarity=0.155  Sum_probs=18.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |||-.|+||||||+.+.+..
T Consensus        55 L~GppGtGKTtlAr~ia~~~   74 (447)
T 3pvs_A           55 LWGPPGTGKTTLAEVIARYA   74 (447)
T ss_dssp             EECSTTSSHHHHHHHHHHHT
T ss_pred             EECCCCCcHHHHHHHHHHHh
Confidence            99999999999999999865

>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A

Probab=95.73  E-value=0.0036  Score=43.89  Aligned_cols=18  Identities=28%  Similarity=0.091  Sum_probs=16.3

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |.|+.|+||||+++.+..
T Consensus         9 i~G~~GSGKST~~~~L~~   26 (218)
T 1vht_A            9 LTGGIGSGKSTVANAFAD   26 (218)
T ss_dssp             EECCTTSCHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHH
Confidence            899999999999998754

>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2}

Probab=95.73  E-value=0.0037  Score=43.63  Aligned_cols=20  Identities=20%  Similarity=0.024  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+....
T Consensus        28 i~G~~GsGKTtl~~~l~~~~   47 (235)
T 2w0m_A           28 LTGEPGTGKTIFSLHFIAKG   47 (235)
T ss_dssp             EECSTTSSHHHHHHHHHHHH
T ss_pred             EEcCCCCCHHHHHHHHHHHH
Confidence            99999999999999988655

>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A*

Probab=95.72  E-value=0.004  Score=41.17  Aligned_cols=21  Identities=19%  Similarity=0.148  Sum_probs=17.8

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus         9 i~v~G~~~~GKssli~~l~~~   29 (170)
T 1z08_A            9 VVLLGEGCVGKTSLVLRYCEN   29 (170)
T ss_dssp             EEEECCTTSCHHHHHHHHHHC
T ss_pred             EEEECcCCCCHHHHHHHHHcC
Confidence            348999999999999888654

>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A

Probab=95.71  E-value=0.0038  Score=45.86  Aligned_cols=20  Identities=25%  Similarity=0.287  Sum_probs=17.6

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|.|+.|+||||+++.+...
T Consensus         6 ~l~G~~GsGKST~a~~L~~~   25 (301)
T 1ltq_A            6 LTIGCPGSGKSTWAREFIAK   25 (301)
T ss_dssp             EEECCTTSSHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHh
Confidence            38999999999999998763

>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20

Probab=95.70  E-value=0.0038  Score=47.54  Aligned_cols=22  Identities=18%  Similarity=0.132  Sum_probs=19.5

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.++|..|+||||||+.+.+..
T Consensus        75 ill~Gp~GtGKT~la~~la~~l   96 (376)
T 1um8_A           75 ILLIGPTGSGKTLMAQTLAKHL   96 (376)
T ss_dssp             EEEECCTTSSHHHHHHHHHHHT
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            4599999999999999998865

>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens}

Probab=95.70  E-value=0.0038  Score=41.44  Aligned_cols=22  Identities=27%  Similarity=0.117  Sum_probs=17.9

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+|||||+..+.+..
T Consensus         7 i~i~G~~~vGKSsl~~~l~~~~   28 (175)
T 2nzj_A            7 VVLLGDPGVGKTSLASLFAGKQ   28 (175)
T ss_dssp             EEEECCTTSSHHHHHHHHHCC-
T ss_pred             EEEECCCCccHHHHHHHHhcCC
Confidence            3489999999999999986543

>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae}

Probab=95.70  E-value=0.0039  Score=45.54  Aligned_cols=20  Identities=30%  Similarity=0.287  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        36 l~G~nGsGKSTLl~~l~Gl~   55 (253)
T 2nq2_C           36 VLGQNGCGKSTLLDLLLGIH   55 (253)
T ss_dssp             EECCSSSSHHHHHHHHTTSS
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8

Probab=95.70  E-value=0.0041  Score=40.92  Aligned_cols=20  Identities=20%  Similarity=0.222  Sum_probs=17.1

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus         7 ~v~G~~~~GKssli~~l~~~   26 (170)
T 1ek0_A            7 VLLGEAAVGKSSIVLRFVSN   26 (170)
T ss_dssp             EEECSTTSSHHHHHHHHHHS
T ss_pred             EEECCCCCCHHHHHHHHhcC
Confidence            38999999999999887654

>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A*

Probab=95.69  E-value=0.0041  Score=41.00  Aligned_cols=20  Identities=25%  Similarity=0.343  Sum_probs=17.5

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus        10 ~v~G~~~~GKSsli~~l~~~   29 (170)
T 1z0j_A           10 CLLGDTGVGKSSIMWRFVED   29 (170)
T ss_dssp             EEECCTTSSHHHHHHHHHHS
T ss_pred             EEECcCCCCHHHHHHHHHcC
Confidence            38999999999999988664

>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A*

Probab=95.69  E-value=0.004  Score=44.72  Aligned_cols=20  Identities=25%  Similarity=0.106  Sum_probs=17.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+....
T Consensus        30 I~G~~GsGKSTl~k~L~~~l   49 (245)
T 2jeo_A           30 VSGGTASGKSTVCEKIMELL   49 (245)
T ss_dssp             EECSTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            89999999999999987743

>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X*

Probab=95.67  E-value=0.0036  Score=42.53  Aligned_cols=18  Identities=22%  Similarity=0.141  Sum_probs=16.6

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |+|..|+|||||+..|+-
T Consensus        31 i~G~NGsGKStll~ai~~   48 (182)
T 3kta_A           31 IVGANGSGKSNIGDAILF   48 (182)
T ss_dssp             EEECTTSSHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHH
Confidence            999999999999999854

>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum}

Probab=95.67  E-value=0.0026  Score=45.12  Aligned_cols=19  Identities=26%  Similarity=0.228  Sum_probs=12.4

Q ss_pred             ccCcCCCchhHHHHhhh-hh
Q 042811           91 PFGVEGVGKITSLSKSY-PE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~-~~  109 (130)
                      |.|..|+|||||++.+. ..
T Consensus        32 l~Gp~GsGKSTl~~~L~~~~   51 (231)
T 3lnc_A           32 LSSPSGCGKTTVANKLLEKQ   51 (231)
T ss_dssp             EECSCC----CHHHHHHC--
T ss_pred             EECCCCCCHHHHHHHHHhcC
Confidence            99999999999999998 53

>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8

Probab=95.67  E-value=0.0044  Score=40.89  Aligned_cols=20  Identities=30%  Similarity=0.368  Sum_probs=17.3

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus         7 ~v~G~~~~GKssli~~l~~~   26 (172)
T 2erx_A            7 AVFGAGGVGKSSLVLRFVKG   26 (172)
T ss_dssp             EEECCTTSSHHHHHHHHHTC
T ss_pred             EEECCCCCCHHHHHHHHHcC
Confidence            38999999999999988653

>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A

Probab=95.65  E-value=0.0044  Score=42.88  Aligned_cols=22  Identities=32%  Similarity=0.240  Sum_probs=19.1

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|.|..|+|||||++.+....
T Consensus         9 i~i~G~sGsGKTTl~~~l~~~l   30 (174)
T 1np6_A            9 LAFAAWSGTGKTTLLKKLIPAL   30 (174)
T ss_dssp             EEEECCTTSCHHHHHHHHHHHH
T ss_pred             EEEEeCCCCCHHHHHHHHHHhc
Confidence            3399999999999999998765

>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2}

Probab=95.64  E-value=0.004  Score=46.97  Aligned_cols=20  Identities=35%  Similarity=0.556  Sum_probs=16.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-|||||||.+-++---.
T Consensus        53 IaGKGGVGKTTtavNLA~aL   72 (314)
T 3fwy_A           53 VYGKGGIGKSTTSSNLSAAF   72 (314)
T ss_dssp             EECSTTSSHHHHHHHHHHHH
T ss_pred             EECCCccCHHHHHHHHHHHH
Confidence            99999999999988775543

>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8

Probab=95.64  E-value=0.0044  Score=43.09  Aligned_cols=23  Identities=17%  Similarity=0.079  Sum_probs=19.0

Q ss_pred             CccccCcCCCchhHHHHhhhhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++.|+|..|+|||||+..+.+..
T Consensus        14 ~i~~~G~~g~GKTsl~~~l~~~~   36 (218)
T 1nrj_B           14 SIIIAGPQNSGKTSLLTLLTTDS   36 (218)
T ss_dssp             EEEEECSTTSSHHHHHHHHHHSS
T ss_pred             EEEEECCCCCCHHHHHHHHhcCC
Confidence            34499999999999999887643

>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus}

Probab=95.63  E-value=0.0039  Score=43.49  Aligned_cols=20  Identities=20%  Similarity=0.288  Sum_probs=17.3

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|.+|+|||||+..+.+.
T Consensus        34 ~i~G~~g~GKTTl~~~l~~~   53 (221)
T 2wsm_A           34 NIMGAIGSGKTLLIERTIER   53 (221)
T ss_dssp             EEEECTTSCHHHHHHHHHHH
T ss_pred             EEEcCCCCCHHHHHHHHHHH
Confidence            38899999999999887665

>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A*

Probab=95.63  E-value=0.0045  Score=41.17  Aligned_cols=22  Identities=27%  Similarity=0.158  Sum_probs=18.4

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+|||||+..+.+..
T Consensus        18 i~v~G~~~~GKSsli~~l~~~~   39 (179)
T 1z0f_A           18 YIIIGDMGVGKSCLLHQFTEKK   39 (179)
T ss_dssp             EEEECSTTSSHHHHHHHHHHSC
T ss_pred             EEEECCCCCCHHHHHHHHHcCC
Confidence            3499999999999999986543

>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A*

Probab=95.63  E-value=0.0041  Score=44.32  Aligned_cols=19  Identities=32%  Similarity=0.130  Sum_probs=17.4

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|..|+|||||++.+...
T Consensus        25 i~G~~GsGKSTl~~~L~~~   43 (230)
T 2vp4_A           25 IEGNIGSGKTTYLNHFEKY   43 (230)
T ss_dssp             EECSTTSCHHHHHHTTGGG
T ss_pred             EECCCCCCHHHHHHHHHhc
Confidence            8999999999999998764

>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A*

Probab=95.62  E-value=0.0035  Score=41.35  Aligned_cols=20  Identities=25%  Similarity=0.134  Sum_probs=17.2

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus         6 ~~vG~~~~GKSsli~~l~~~   25 (166)
T 3q72_A            6 LLLGAPGVGKSALARIFGGV   25 (166)
T ss_dssp             EEEESTTSSHHHHHHHHCCC
T ss_pred             EEECCCCCCHHHHHHHHcCc
Confidence            38999999999999998653

>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A*

Probab=95.62  E-value=0.0044  Score=40.98  Aligned_cols=18  Identities=33%  Similarity=0.235  Sum_probs=16.2

Q ss_pred             cccCcCCCchhHHHHhhh
Q 042811           90 WPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~  107 (130)
                      .|+|..|+|||||+..+.
T Consensus         6 ~ivG~~~~GKSsli~~l~   23 (169)
T 3q85_A            6 MLVGESGVGKSTLAGTFG   23 (169)
T ss_dssp             EEECSTTSSHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            389999999999999874

>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A*

Probab=95.59  E-value=0.0046  Score=47.68  Aligned_cols=22  Identities=23%  Similarity=0.137  Sum_probs=18.6

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|+.|+|||||++.+.+..
T Consensus        27 i~l~G~~G~GKTTl~~~la~~l   48 (359)
T 2ga8_A           27 VILVGSPGSGKSTIAEELCQII   48 (359)
T ss_dssp             EEEECCTTSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCcHHHHHHHHHHHh
Confidence            3489999999999999887654

>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B*

Probab=95.57  E-value=0.0048  Score=46.31  Aligned_cols=20  Identities=25%  Similarity=0.204  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+||||||+.+.+..
T Consensus        43 l~G~~G~GKT~la~~la~~l   62 (373)
T 1jr3_A           43 FSGTRGVGKTSIARLLAKGL   62 (373)
T ss_dssp             EESCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            99999999999999998765

>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B*

Probab=95.56  E-value=0.0043  Score=42.05  Aligned_cols=20  Identities=20%  Similarity=0.094  Sum_probs=17.5

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus        11 ~v~G~~~vGKSsli~~l~~~   30 (184)
T 1m7b_A           11 VVVGDSQCGKTALLHVFAKD   30 (184)
T ss_dssp             EEEESTTSSHHHHHHHHHHS
T ss_pred             EEECCCCCCHHHHHHHHhcC
Confidence            48999999999999988654

>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana}

Probab=95.56  E-value=0.0046  Score=47.59  Aligned_cols=20  Identities=45%  Similarity=0.504  Sum_probs=18.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+....
T Consensus       162 lvG~nGsGKTTll~~Lag~l  181 (359)
T 2og2_A          162 IVGVNGGGKTTSLGKLAHRL  181 (359)
T ss_dssp             EECCTTSCHHHHHHHHHHHH
T ss_pred             EEcCCCChHHHHHHHHHhhc
Confidence            99999999999999998866

>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A*

Probab=95.55  E-value=0.0036  Score=46.73  Aligned_cols=20  Identities=25%  Similarity=0.391  Sum_probs=17.4

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|-.|+|||||++.++..
T Consensus        22 ~lvG~nG~GKSTLl~~L~g~   41 (301)
T 2qnr_A           22 MVVGESGLGKSTLINSLFLT   41 (301)
T ss_dssp             EEEEETTSSHHHHHHHHHC-
T ss_pred             EEECCCCCCHHHHHHHHhCC
Confidence            39999999999999998764

>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11

Probab=95.55  E-value=0.0046  Score=43.62  Aligned_cols=19  Identities=21%  Similarity=0.072  Sum_probs=17.6

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|+|||||++.+...
T Consensus        29 i~G~~GsGKTtl~~~l~~~   47 (243)
T 1n0w_A           29 MFGEFRTGKTQICHTLAVT   47 (243)
T ss_dssp             EECCTTSSHHHHHHHHHHH
T ss_pred             EECCCCCcHHHHHHHHHHH
Confidence            9999999999999998775

>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus}

Probab=95.55  E-value=0.0049  Score=45.17  Aligned_cols=20  Identities=25%  Similarity=0.298  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        30 i~Gp~GsGKSTll~~l~g~~   49 (261)
T 2eyu_A           30 VTGPTGSGKSTTIASMIDYI   49 (261)
T ss_dssp             EECSTTCSHHHHHHHHHHHH
T ss_pred             EECCCCccHHHHHHHHHHhC
Confidence            99999999999999987754

>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A*

Probab=95.55  E-value=0.005  Score=41.04  Aligned_cols=21  Identities=24%  Similarity=0.351  Sum_probs=17.6

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        11 i~v~G~~~~GKSsli~~l~~~   31 (182)
T 1ky3_A           11 VIILGDSGVGKTSLMHRYVND   31 (182)
T ss_dssp             EEEECCTTSSHHHHHHHHHHS
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            349999999999999887654

>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum}

Probab=95.54  E-value=0.0051  Score=44.33  Aligned_cols=21  Identities=24%  Similarity=0.131  Sum_probs=18.3

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|+.|+||||+++.+-+..
T Consensus        33 ~l~G~~GsGKsT~a~~L~~~~   53 (243)
T 3tlx_A           33 IFLGAPGSGKGTQSLNLKKSH   53 (243)
T ss_dssp             EEECCTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHh
Confidence            389999999999999997654

>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii}

Probab=95.54  E-value=0.0048  Score=45.37  Aligned_cols=23  Identities=30%  Similarity=0.310  Sum_probs=19.4

Q ss_pred             CCcc-ccCcCCCchhHHHHhhhhh
Q 042811           87 GNNW-PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        87 ~~l~-I~GmGGvGKTTLak~v~~~  109 (130)
                      .++. |+|..|+|||||++.+..-
T Consensus        30 Ge~~~i~G~NGsGKSTLlk~l~Gl   53 (263)
T 2pjz_A           30 GEKVIILGPNGSGKTTLLRAISGL   53 (263)
T ss_dssp             SSEEEEECCTTSSHHHHHHHHTTS
T ss_pred             CEEEEEECCCCCCHHHHHHHHhCC
Confidence            4444 9999999999999998763

>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV}

Probab=95.53  E-value=0.01  Score=43.04  Aligned_cols=27  Identities=15%  Similarity=0.021  Sum_probs=21.1

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCe
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLI  119 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~  119 (130)
                      +.|.||+||||++-.+.... . ...+++
T Consensus        11 ~~~kgGvGKTt~a~~la~~l-~-~~G~~V   37 (228)
T 2r8r_A           11 LGAAPGVGKTYAMLQAAHAQ-L-RQGVRV   37 (228)
T ss_dssp             EESSTTSSHHHHHHHHHHHH-H-HTTCCE
T ss_pred             EECCCCCcHHHHHHHHHHHH-H-HCCCCE
Confidence            78999999999988887766 2 345554

>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A

Probab=95.53  E-value=0.0047  Score=48.48  Aligned_cols=20  Identities=30%  Similarity=0.273  Sum_probs=18.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+||||||+.+.+..
T Consensus       172 L~GppGtGKT~lA~aia~~~  191 (444)
T 2zan_A          172 LFGPPGTGKSYLAKAVATEA  191 (444)
T ss_dssp             EECSTTSSHHHHHHHHHHHC
T ss_pred             EECCCCCCHHHHHHHHHHHc
Confidence            99999999999999999864

>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20

Probab=95.53  E-value=0.0048  Score=49.25  Aligned_cols=22  Identities=27%  Similarity=0.410  Sum_probs=19.4

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+||||||+.+.+..
T Consensus        80 lLL~GppGtGKTtla~~la~~l  101 (516)
T 1sxj_A           80 AMLYGPPGIGKTTAAHLVAQEL  101 (516)
T ss_dssp             EEEECSTTSSHHHHHHHHHHHT
T ss_pred             EEEECCCCCCHHHHHHHHHHHc
Confidence            3499999999999999998865

>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens}

Probab=95.53  E-value=0.0045  Score=42.70  Aligned_cols=19  Identities=32%  Similarity=0.184  Sum_probs=16.8

Q ss_pred             ccccCcCCCchhHHHHhhh
Q 042811           89 NWPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~  107 (130)
                      +.|+|.+|+|||||+..+.
T Consensus        26 i~vvG~~~vGKSsLi~~l~   44 (195)
T 3cbq_A           26 VMLVGESGVGKSTLAGTFG   44 (195)
T ss_dssp             EEEECSTTSSHHHHHHHTC
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            4499999999999999984

>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens}

Probab=95.53  E-value=0.0045  Score=41.23  Aligned_cols=20  Identities=30%  Similarity=0.315  Sum_probs=17.6

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus        13 ~v~G~~~~GKssl~~~l~~~   32 (181)
T 3tw8_B           13 LIIGDSGVGKSSLLLRFADN   32 (181)
T ss_dssp             EEECCTTSCHHHHHHHHCSC
T ss_pred             EEECCCCCCHHHHHHHHhcC
Confidence            49999999999999998654

>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A*

Probab=95.52  E-value=0.0055  Score=47.74  Aligned_cols=20  Identities=25%  Similarity=0.353  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|+.|+|||||++.+....
T Consensus       263 l~G~pGSGKSTla~~L~~~~  282 (416)
T 3zvl_A          263 AVGFPGAGKSTFIQEHLVSA  282 (416)
T ss_dssp             EESCTTSSHHHHHHHHTGGG
T ss_pred             EECCCCCCHHHHHHHHHHhc
Confidence            99999999999999987754

>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A*

Probab=95.52  E-value=0.0052  Score=41.32  Aligned_cols=20  Identities=25%  Similarity=0.282  Sum_probs=17.8

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus        22 ~v~G~~~~GKSsl~~~l~~~   41 (183)
T 3kkq_A           22 VVVGDGGVGKSALTIQFFQK   41 (183)
T ss_dssp             EEECSTTSSHHHHHHHHHHS
T ss_pred             EEECCCCCCHHHHHHHHHhC
Confidence            49999999999999998764

>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A*

Probab=95.52  E-value=0.0046  Score=41.21  Aligned_cols=21  Identities=24%  Similarity=0.107  Sum_probs=18.0

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        12 i~v~G~~~~GKssli~~l~~~   32 (181)
T 2fn4_A           12 LVVVGGGGVGKSALTIQFIQS   32 (181)
T ss_dssp             EEEEECTTSSHHHHHHHHHHS
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            349999999999999988664

>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A*

Probab=95.51  E-value=0.0059  Score=40.69  Aligned_cols=21  Identities=19%  Similarity=0.028  Sum_probs=17.6

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus         9 i~v~G~~~~GKssl~~~l~~~   29 (178)
T 2hxs_A            9 IVVLGDGASGKTSLTTCFAQE   29 (178)
T ss_dssp             EEEECCTTSSHHHHHHHHHGG
T ss_pred             EEEECcCCCCHHHHHHHHHhC
Confidence            348999999999999987653

>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A*

Probab=95.51  E-value=0.0053  Score=44.27  Aligned_cols=20  Identities=20%  Similarity=0.094  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|+.|+||||+++.+....
T Consensus        27 I~G~~GSGKST~a~~L~~~l   46 (252)
T 1uj2_A           27 VSGGTASGKSSVCAKIVQLL   46 (252)
T ss_dssp             EECSTTSSHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            99999999999999987754

>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A

Probab=95.51  E-value=0.0046  Score=41.73  Aligned_cols=21  Identities=19%  Similarity=0.023  Sum_probs=18.2

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus         7 i~ivG~~g~GKStLl~~l~~~   27 (172)
T 2gj8_A            7 VVIAGRPNAGKSSLLNALAGR   27 (172)
T ss_dssp             EEEEESTTSSHHHHHHHHHTS
T ss_pred             EEEECCCCCCHHHHHHHHhCC
Confidence            448999999999999998764

>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus}

Probab=95.50  E-value=0.002  Score=44.46  Aligned_cols=22  Identities=23%  Similarity=0.289  Sum_probs=18.5

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+|||||++.+..-.
T Consensus         5 v~IvG~SGsGKSTL~~~L~~~~   26 (171)
T 2f1r_A            5 LSIVGTSDSGKTTLITRMMPIL   26 (171)
T ss_dssp             EEEEESCHHHHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            3389999999999999987654

>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A*

Probab=95.50  E-value=0.0045  Score=42.03  Aligned_cols=21  Identities=19%  Similarity=0.078  Sum_probs=18.1

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        26 i~v~G~~~~GKSsli~~l~~~   46 (195)
T 1svi_A           26 IALAGRSNVGKSSFINSLINR   46 (195)
T ss_dssp             EEEEEBTTSSHHHHHHHHHTC
T ss_pred             EEEECCCCCCHHHHHHHHhCC
Confidence            349999999999999998664

>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R*

Probab=95.48  E-value=0.0055  Score=40.09  Aligned_cols=20  Identities=25%  Similarity=0.227  Sum_probs=16.9

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus         7 ~v~G~~~~GKSsli~~l~~~   26 (167)
T 1kao_A            7 VVLGSGGVGKSALTVQFVTG   26 (167)
T ss_dssp             EEECCTTSSHHHHHHHHHHS
T ss_pred             EEECCCCCCHHHHHHHHHcC
Confidence            38999999999999887643

>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis}

Probab=95.48  E-value=0.0018  Score=53.90  Aligned_cols=32  Identities=19%  Similarity=0.192  Sum_probs=25.0

Q ss_pred             eeecccCCCCc------------cccCcCCCchhHHHHhhhhhh
Q 042811           79 KLGDVRRNGNN------------WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        79 ivG~~~~~~~l------------~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|++..++.+            +++|-.|+||||||+.+.+..
T Consensus       182 iiG~~~~i~~l~~~l~~~~~~~vLL~G~pGtGKT~la~~la~~l  225 (758)
T 3pxi_A          182 VIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQQI  225 (758)
T ss_dssp             CCCCHHHHHHHHHHHHCSSSCEEEEESCTTTTTHHHHHHHHHHH
T ss_pred             ccCchHHHHHHHHHHhCCCCCCeEEECCCCCCHHHHHHHHHHHH
Confidence            58877543332            299999999999999998864

>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0

Probab=95.47  E-value=0.0054  Score=41.83  Aligned_cols=19  Identities=16%  Similarity=0.064  Sum_probs=16.0

Q ss_pred             cccCcCCCchhHHHHhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~  108 (130)
                      .|+|..|+|||||+..+.+
T Consensus        24 ~ivG~~~vGKSsL~~~~~~   42 (184)
T 3ihw_A           24 GIVGNLSSGKSALVHRYLT   42 (184)
T ss_dssp             EEECCTTSCHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHhc
Confidence            3999999999999976544

>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A*

Probab=95.47  E-value=0.0057  Score=42.16  Aligned_cols=20  Identities=15%  Similarity=0.016  Sum_probs=17.4

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|.|..|+||||+++.+...
T Consensus         6 ~i~G~~GsGKst~~~~la~~   25 (208)
T 3ake_A            6 TIDGPSASGKSSVARRVAAA   25 (208)
T ss_dssp             EEECSTTSSHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHh
Confidence            38999999999999998653

>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens}

Probab=95.46  E-value=0.0055  Score=41.78  Aligned_cols=21  Identities=24%  Similarity=0.167  Sum_probs=17.5

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        24 i~vvG~~~vGKTsLi~~l~~~   44 (187)
T 3c5c_A           24 LAILGRRGAGKSALTVKFLTK   44 (187)
T ss_dssp             EEEECCTTSSHHHHHHHHHHS
T ss_pred             EEEECCCCCcHHHHHHHHHhC
Confidence            449999999999999876543

>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8

Probab=95.46  E-value=0.0034  Score=43.34  Aligned_cols=20  Identities=20%  Similarity=0.135  Sum_probs=17.6

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||++.+.+.
T Consensus        30 ~lvG~~g~GKSTLl~~l~g~   49 (210)
T 1pui_A           30 AFAGRSNAGKSSALNTLTNQ   49 (210)
T ss_dssp             EEEECTTSSHHHHHTTTCCC
T ss_pred             EEECCCCCCHHHHHHHHhCC
Confidence            49999999999999998754

>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B*

Probab=95.46  E-value=0.0053  Score=46.62  Aligned_cols=20  Identities=30%  Similarity=0.373  Sum_probs=18.6

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+....
T Consensus       134 lvG~nGaGKTTll~~Lag~l  153 (328)
T 3e70_C          134 FVGFNGSGKTTTIAKLANWL  153 (328)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            99999999999999998766

>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ...

Probab=95.46  E-value=0.0059  Score=40.15  Aligned_cols=18  Identities=33%  Similarity=0.366  Sum_probs=16.0

Q ss_pred             cccCcCCCchhHHHHhhh
Q 042811           90 WPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~  107 (130)
                      .|+|..|+|||||+..+.
T Consensus         4 ~~~G~~~~GKssl~~~l~   21 (164)
T 1r8s_A            4 LMVGLDAAGKTTILYKLK   21 (164)
T ss_dssp             EEECSTTSSHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            378999999999999874

>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1

Probab=95.46  E-value=0.0045  Score=47.18  Aligned_cols=20  Identities=30%  Similarity=0.312  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus       175 IvG~nGsGKSTLlk~L~gl~  194 (365)
T 1lw7_A          175 ILGGESSGKSVLVNKLAAVF  194 (365)
T ss_dssp             EECCTTSHHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            99999999999999987654

>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A*

Probab=95.45  E-value=0.0057  Score=40.94  Aligned_cols=21  Identities=24%  Similarity=0.156  Sum_probs=17.9

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        21 i~v~G~~~~GKSsli~~l~~~   41 (187)
T 2a9k_A           21 VIMVGSGGVGKSALTLQFMYD   41 (187)
T ss_dssp             EEEECSTTSSHHHHHHHHHHS
T ss_pred             EEEECCCCCCHHHHHHHHhhC
Confidence            349999999999999998654

>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A*

Probab=95.44  E-value=0.0057  Score=40.71  Aligned_cols=21  Identities=24%  Similarity=0.325  Sum_probs=17.8

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        10 i~v~G~~~~GKSsli~~l~~~   30 (177)
T 1wms_A           10 VILLGDGGVGKSSLMNRYVTN   30 (177)
T ss_dssp             EEEECCTTSSHHHHHHHHHHS
T ss_pred             EEEECCCCCCHHHHHHHHHcC
Confidence            348999999999999998653

>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A*

Probab=95.44  E-value=0.0058  Score=40.17  Aligned_cols=20  Identities=20%  Similarity=0.175  Sum_probs=17.3

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus        10 ~v~G~~~~GKssli~~l~~~   29 (170)
T 1r2q_A           10 VLLGESAVGKSSLVLRFVKG   29 (170)
T ss_dssp             EEECSTTSSHHHHHHHHHHS
T ss_pred             EEECCCCCCHHHHHHHHHcC
Confidence            48999999999999988653

>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B*

Probab=95.43  E-value=0.0058  Score=40.85  Aligned_cols=21  Identities=19%  Similarity=0.170  Sum_probs=17.9

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        15 i~v~G~~~~GKSsli~~l~~~   35 (181)
T 2efe_B           15 LVLLGDVGAGKSSLVLRFVKD   35 (181)
T ss_dssp             EEEECCTTSCHHHHHHHHHHC
T ss_pred             EEEECcCCCCHHHHHHHHHcC
Confidence            349999999999999887654

>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A

Probab=95.42  E-value=0.0054  Score=49.29  Aligned_cols=20  Identities=45%  Similarity=0.695  Sum_probs=18.6

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+....
T Consensus       298 LVGpNGSGKTTLl~~LAgll  317 (503)
T 2yhs_A          298 MVGVNGVGKTTTIGKLARQF  317 (503)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EECCCcccHHHHHHHHHHHh
Confidence            99999999999999998765

>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A*

Probab=95.42  E-value=0.0059  Score=41.02  Aligned_cols=21  Identities=24%  Similarity=0.284  Sum_probs=18.0

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+|||||+..+.+..
T Consensus         8 ~v~G~~~~GKSsli~~l~~~~   28 (189)
T 4dsu_A            8 VVVGADGVGKSALTIQLIQNH   28 (189)
T ss_dssp             EEECCTTSSHHHHHHHHHHSS
T ss_pred             EEECCCCCCHHHHHHHHHhCC
Confidence            389999999999999987643

>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8

Probab=95.40  E-value=0.005  Score=41.51  Aligned_cols=21  Identities=24%  Similarity=0.090  Sum_probs=17.5

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus         4 i~v~G~~~~GKSsli~~l~~~   24 (190)
T 2cxx_A            4 IIFAGRSNVGKSTLIYRLTGK   24 (190)
T ss_dssp             EEEEEBTTSSHHHHHHHHHSC
T ss_pred             EEEECCCCCCHHHHHHHHhCc
Confidence            347899999999999987654

>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A

Probab=95.40  E-value=0.0056  Score=46.41  Aligned_cols=22  Identities=18%  Similarity=0.069  Sum_probs=19.5

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.++|..|+||||||+.+.+..
T Consensus        54 vll~GppGtGKT~la~~ia~~~   75 (363)
T 3hws_A           54 ILLIGPTGSGKTLLAETLARLL   75 (363)
T ss_dssp             EEEECCTTSSHHHHHHHHHHHT
T ss_pred             EEEECCCCCCHHHHHHHHHHHc
Confidence            3589999999999999998865

>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A*

Probab=95.40  E-value=0.0053  Score=41.30  Aligned_cols=20  Identities=25%  Similarity=0.292  Sum_probs=17.5

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus        14 ~v~G~~~~GKSsli~~l~~~   33 (186)
T 2bme_A           14 LVIGNAGTGKSCLLHQFIEK   33 (186)
T ss_dssp             EEEESTTSSHHHHHHHHHHS
T ss_pred             EEECCCCCCHHHHHHHHHcC
Confidence            39999999999999988654

>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A

Probab=95.40  E-value=0.0052  Score=41.51  Aligned_cols=22  Identities=23%  Similarity=0.220  Sum_probs=18.6

Q ss_pred             CccccCcCCCchhHHHHhhhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~~  109 (130)
                      ++.|+|..|+|||||+..+.+.
T Consensus        25 ~i~v~G~~~~GKSsli~~l~~~   46 (195)
T 3pqc_A           25 EVAFVGRSNVGKSSLLNALFNR   46 (195)
T ss_dssp             EEEEEEBTTSSHHHHHHHHHTS
T ss_pred             EEEEECCCCCCHHHHHHHHHcC
Confidence            3449999999999999988765

>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima}

Probab=95.40  E-value=0.0057  Score=42.85  Aligned_cols=19  Identities=26%  Similarity=0.125  Sum_probs=17.1

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|+.|+||||+++.+-..
T Consensus        17 ltG~~GSGKSTva~~L~~~   35 (192)
T 2grj_A           17 VTGKIGTGKSTVCEILKNK   35 (192)
T ss_dssp             EECSTTSSHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHh
Confidence            8999999999999988664

>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C

Probab=95.39  E-value=0.0062  Score=40.74  Aligned_cols=21  Identities=24%  Similarity=0.145  Sum_probs=17.6

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        11 i~v~G~~~~GKssl~~~~~~~   31 (182)
T 3bwd_D           11 CVTVGDGAVGKTCLLISYTSN   31 (182)
T ss_dssp             EEEECSTTSSHHHHHHHHHHS
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            349999999999999887653

>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A*

Probab=95.38  E-value=0.0047  Score=41.90  Aligned_cols=21  Identities=29%  Similarity=0.362  Sum_probs=18.1

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        19 i~ivG~~~vGKSsL~~~l~~~   39 (181)
T 1fzq_A           19 ILLLGLDNAGKTTLLKQLASE   39 (181)
T ss_dssp             EEEEESTTSSHHHHHHHHCCS
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            349999999999999998764

>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A

Probab=95.37  E-value=0.01  Score=42.52  Aligned_cols=20  Identities=35%  Similarity=0.501  Sum_probs=19.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+||||+++.+.+..
T Consensus        31 i~G~~GsGKsT~~~~l~~~l   50 (229)
T 4eaq_A           31 FEGPEGSGKTTVINEVYHRL   50 (229)
T ss_dssp             EECCTTSCHHHHHHHHHHHH
T ss_pred             EEcCCCCCHHHHHHHHHHHH
Confidence            99999999999999999877

>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1

Probab=95.37  E-value=0.0045  Score=46.45  Aligned_cols=19  Identities=37%  Similarity=0.370  Sum_probs=17.3

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|..|.|||||++.+...
T Consensus         9 i~G~~GaGKTTll~~l~~~   27 (318)
T 1nij_A            9 LTGFLGAGKTTLLRHILNE   27 (318)
T ss_dssp             EEESSSSSCHHHHHHHHHS
T ss_pred             EEecCCCCHHHHHHHHHhh
Confidence            8999999999999998854

>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A*

Probab=95.37  E-value=0.0063  Score=40.18  Aligned_cols=20  Identities=30%  Similarity=0.414  Sum_probs=17.4

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus        11 ~v~G~~~~GKssl~~~l~~~   30 (171)
T 1upt_A           11 LILGLDGAGKTTILYRLQVG   30 (171)
T ss_dssp             EEECSTTSSHHHHHHHHHHS
T ss_pred             EEECCCCCCHHHHHHHHhcC
Confidence            39999999999999998553

>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A*

Probab=95.36  E-value=0.0066  Score=40.44  Aligned_cols=20  Identities=25%  Similarity=0.054  Sum_probs=17.3

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|..|+|||||+..+.+
T Consensus        11 i~v~G~~~~GKssl~~~l~~   30 (178)
T 2lkc_A           11 VTIMGHVDHGKTTLLDAIRH   30 (178)
T ss_dssp             EEEESCTTTTHHHHHHHHHT
T ss_pred             EEEECCCCCCHHHHHHHHhC
Confidence            34999999999999998755

>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20

Probab=95.35  E-value=0.006  Score=45.78  Aligned_cols=22  Identities=23%  Similarity=0.327  Sum_probs=18.9

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.++|..|+||||||+.+.+..
T Consensus        49 ~ll~Gp~G~GKTtla~~la~~l   70 (340)
T 1sxj_C           49 LLFYGPPGTGKTSTIVALAREI   70 (340)
T ss_dssp             EEEECSSSSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
Confidence            3499999999999999987754

>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A*

Probab=95.35  E-value=0.0054  Score=45.81  Aligned_cols=20  Identities=25%  Similarity=0.124  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+....
T Consensus        85 I~G~~GsGKSTl~~~L~~~l  104 (308)
T 1sq5_A           85 IAGSVAVGKSTTARVLQALL  104 (308)
T ss_dssp             EEECTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            89999999999999998754

>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A

Probab=95.35  E-value=0.0052  Score=44.93  Aligned_cols=20  Identities=15%  Similarity=0.077  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||+..+....
T Consensus        35 i~G~~GsGKTtl~~~l~~~~   54 (279)
T 1nlf_A           35 LVSPGGAGKSMLALQLAAQI   54 (279)
T ss_dssp             EEESTTSSHHHHHHHHHHHH
T ss_pred             EEcCCCCCHHHHHHHHHHHH
Confidence            99999999999999987644

>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A

Probab=95.35  E-value=0.0063  Score=44.52  Aligned_cols=21  Identities=19%  Similarity=0.177  Sum_probs=18.9

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++|..|+||||+|+.+.+..
T Consensus        42 ll~G~~G~GKt~la~~l~~~l   62 (319)
T 2chq_A           42 LFSGPPGTGKTATAIALARDL   62 (319)
T ss_dssp             EEESSSSSSHHHHHHHHHHHH
T ss_pred             EEECcCCcCHHHHHHHHHHHh
Confidence            499999999999999998764

>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G

Probab=95.33  E-value=0.0041  Score=46.37  Aligned_cols=21  Identities=29%  Similarity=0.370  Sum_probs=19.2

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +|+|-.|+||||||+.+.+..
T Consensus        49 Ll~G~~GtGKT~la~~la~~~   69 (350)
T 1g8p_A           49 LVFGDRGTGKSTAVRALAALL   69 (350)
T ss_dssp             EEECCGGGCTTHHHHHHHHHS
T ss_pred             EEECCCCccHHHHHHHHHHhC
Confidence            399999999999999998865

>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A

Probab=95.33  E-value=0.0058  Score=40.26  Aligned_cols=20  Identities=30%  Similarity=0.356  Sum_probs=17.2

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus         7 ~v~G~~~~GKssli~~l~~~   26 (170)
T 1g16_A            7 LLIGDSGVGKSCLLVRFVED   26 (170)
T ss_dssp             EEEESTTSSHHHHHHHHHHC
T ss_pred             EEECcCCCCHHHHHHHHHhC
Confidence            38999999999999988654

>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens}

Probab=95.32  E-value=0.0066  Score=41.51  Aligned_cols=21  Identities=24%  Similarity=0.156  Sum_probs=17.7

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        17 i~v~G~~~~GKSsli~~l~~~   37 (206)
T 2bov_A           17 VIMVGSGGVGKSALTLQFMYD   37 (206)
T ss_dssp             EEEECSTTSSHHHHHHHHHHS
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            349999999999999988653

>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8

Probab=95.32  E-value=0.0066  Score=41.52  Aligned_cols=20  Identities=30%  Similarity=0.400  Sum_probs=17.6

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus        32 ~v~G~~~vGKSsli~~l~~~   51 (196)
T 2atv_A           32 AIFGRAGVGKSALVVRFLTK   51 (196)
T ss_dssp             EEECCTTSSHHHHHHHHHHS
T ss_pred             EEECCCCCCHHHHHHHHHhC
Confidence            39999999999999988654

>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ...

Probab=95.31  E-value=0.0067  Score=40.62  Aligned_cols=20  Identities=25%  Similarity=0.145  Sum_probs=17.0

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus         9 ~~~G~~~~GKssl~~~l~~~   28 (186)
T 1mh1_A            9 VVVGDGAVGKTCLLISYTTN   28 (186)
T ss_dssp             EEECSTTSSHHHHHHHHHHS
T ss_pred             EEECCCCCCHHHHHHHHHcC
Confidence            38999999999999887643

>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B*

Probab=95.31  E-value=0.0066  Score=41.58  Aligned_cols=21  Identities=24%  Similarity=0.325  Sum_probs=17.8

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        11 i~v~G~~~~GKSsli~~l~~~   31 (207)
T 1vg8_A           11 VIILGDSGVGKTSLMNQYVNK   31 (207)
T ss_dssp             EEEECCTTSSHHHHHHHHHHS
T ss_pred             EEEECcCCCCHHHHHHHHHcC
Confidence            349999999999999987654

>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens}

Probab=95.30  E-value=0.0068  Score=41.20  Aligned_cols=21  Identities=33%  Similarity=0.328  Sum_probs=17.9

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        28 i~v~G~~~~GKSsLi~~l~~~   48 (193)
T 2oil_A           28 VVLIGESGVGKTNLLSRFTRN   48 (193)
T ss_dssp             EEEESSTTSSHHHHHHHHHHS
T ss_pred             EEEECcCCCCHHHHHHHHhcC
Confidence            349999999999999987654

>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A*

Probab=95.28  E-value=0.0058  Score=45.59  Aligned_cols=20  Identities=30%  Similarity=0.333  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        69 i~G~NGsGKSTLlk~l~Gl~   88 (290)
T 2bbs_A           69 VAGSTGAGKTSLLMMIMGEL   88 (290)
T ss_dssp             EEESTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCcHHHHHHHHhcCC
Confidence            99999999999999998754

>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A*

Probab=95.28  E-value=0.0048  Score=42.60  Aligned_cols=20  Identities=25%  Similarity=0.190  Sum_probs=17.6

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|.+|+|||||++.+.+
T Consensus        28 i~lvG~~~vGKSsLi~~l~~   47 (198)
T 1f6b_A           28 LVFLGLDNAGKTTLLHMLKD   47 (198)
T ss_dssp             EEEEEETTSSHHHHHHHHSC
T ss_pred             EEEECCCCCCHHHHHHHHhc
Confidence            44999999999999999865

>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A*

Probab=95.28  E-value=0.007  Score=43.85  Aligned_cols=20  Identities=20%  Similarity=0.119  Sum_probs=17.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+....
T Consensus        14 i~G~~GsGKsTla~~la~~l   33 (233)
T 3r20_A           14 VDGPAGTGKSSVSRGLARAL   33 (233)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            99999999999999987543

>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus}

Probab=95.28  E-value=0.0056  Score=45.17  Aligned_cols=17  Identities=24%  Similarity=0.335  Sum_probs=16.1

Q ss_pred             ccCcCCCchhHHHHhhh
Q 042811           91 PFGVEGVGKITSLSKSY  107 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~  107 (130)
                      |.|+.|+||||+++.+-
T Consensus        80 I~G~~GSGKSTva~~La   96 (281)
T 2f6r_A           80 LTGISGSGKSSVAQRLK   96 (281)
T ss_dssp             EEECTTSCHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHH
Confidence            99999999999999876

>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius}

Probab=95.28  E-value=0.0062  Score=46.79  Aligned_cols=20  Identities=30%  Similarity=0.162  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.|..-.
T Consensus        46 llGpnGsGKSTLLr~iaGl~   65 (355)
T 1z47_A           46 LLGPSGSGKTTILRLIAGLE   65 (355)
T ss_dssp             EECSTTSSHHHHHHHHHTSS
T ss_pred             EECCCCCcHHHHHHHHhCCC
Confidence            99999999999999987643

>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10

Probab=95.27  E-value=0.0063  Score=45.75  Aligned_cols=20  Identities=45%  Similarity=0.532  Sum_probs=18.6

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|.+|+||||++.++....
T Consensus       109 ivG~~GsGKTTl~~~LA~~l  128 (306)
T 1vma_A          109 VVGVNGTGKTTSCGKLAKMF  128 (306)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EEcCCCChHHHHHHHHHHHH
Confidence            99999999999999998766

>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E*

Probab=95.27  E-value=0.0064  Score=48.45  Aligned_cols=22  Identities=23%  Similarity=0.089  Sum_probs=19.7

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+||||||+.+.+..
T Consensus        52 vLL~GppGtGKT~Laraia~~~   73 (476)
T 2ce7_A           52 ILLVGPPGTGKTLLARAVAGEA   73 (476)
T ss_dssp             EEEECCTTSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHc
Confidence            3499999999999999999865

>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}

Probab=95.27  E-value=0.0055  Score=48.34  Aligned_cols=20  Identities=20%  Similarity=0.257  Sum_probs=19.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      +||..|+|||+||+.|.+..
T Consensus       220 LyGPPGTGKTllAkAiA~e~  239 (434)
T 4b4t_M          220 MYGPPGTGKTLLARACAAQT  239 (434)
T ss_dssp             EESCTTSSHHHHHHHHHHHH
T ss_pred             EECcCCCCHHHHHHHHHHHh
Confidence            99999999999999999876

>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A*

Probab=95.27  E-value=0.007  Score=40.68  Aligned_cols=21  Identities=29%  Similarity=0.325  Sum_probs=17.9

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        14 i~v~G~~~~GKSsli~~l~~~   34 (195)
T 3bc1_A           14 FLALGDSGVGKTSVLYQYTDG   34 (195)
T ss_dssp             EEEECSTTSSHHHHHHHHHHS
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            349999999999999998753

>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens}

Probab=95.26  E-value=0.0071  Score=41.00  Aligned_cols=22  Identities=27%  Similarity=0.209  Sum_probs=18.5

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+|||||+..+.+..
T Consensus        19 i~v~G~~~~GKSsli~~l~~~~   40 (196)
T 3tkl_A           19 LLLIGDSGVGKSCLLLRFADDT   40 (196)
T ss_dssp             EEEECSTTSSHHHHHHHHHHSC
T ss_pred             EEEECcCCCCHHHHHHHHHcCC
Confidence            3499999999999999987643

>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A

Probab=95.24  E-value=0.0051  Score=41.16  Aligned_cols=20  Identities=15%  Similarity=0.120  Sum_probs=17.3

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus        11 ~~vG~~~vGKTsli~~l~~~   30 (178)
T 2iwr_A           11 GVLGDARSGKSSLIHRFLTG   30 (178)
T ss_dssp             EEECCGGGCHHHHHHHHHHS
T ss_pred             EEECCCCCCHHHHHHHHHhC
Confidence            39999999999999987653

>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A

Probab=95.23  E-value=0.0069  Score=46.03  Aligned_cols=21  Identities=14%  Similarity=0.150  Sum_probs=18.4

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+|||||++.+....
T Consensus         9 ~i~GptGsGKTtla~~La~~l   29 (323)
T 3crm_A            9 FLMGPTAAGKTDLAMALADAL   29 (323)
T ss_dssp             EEECCTTSCHHHHHHHHHHHS
T ss_pred             EEECCCCCCHHHHHHHHHHHc
Confidence            399999999999999987754

>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8

Probab=95.23  E-value=0.0074  Score=40.27  Aligned_cols=20  Identities=30%  Similarity=0.278  Sum_probs=17.4

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus        14 ~v~G~~~~GKssli~~l~~~   33 (180)
T 2g6b_A           14 MLVGDSGVGKTCLLVRFKDG   33 (180)
T ss_dssp             EEECSTTSSHHHHHHHHHHS
T ss_pred             EEECcCCCCHHHHHHHHHhC
Confidence            39999999999999987654

>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2

Probab=95.23  E-value=0.0073  Score=41.81  Aligned_cols=21  Identities=14%  Similarity=0.075  Sum_probs=17.7

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|.+|+|||||+..+.+.
T Consensus        10 i~vvG~~~~GKTsli~~l~~~   30 (214)
T 2fh5_B           10 VLFVGLCDSGKTLLFVRLLTG   30 (214)
T ss_dssp             EEEECSTTSSHHHHHHHHHHS
T ss_pred             EEEECCCCCCHHHHHHHHhCC
Confidence            349999999999999987653

>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A*

Probab=95.22  E-value=0.007  Score=45.57  Aligned_cols=19  Identities=16%  Similarity=-0.017  Sum_probs=17.4

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|.|||||++.+..-
T Consensus       131 IvGpsGsGKSTLl~lL~gl  149 (305)
T 2v9p_A          131 FIGPPNTGKSMLCNSLIHF  149 (305)
T ss_dssp             EECSSSSSHHHHHHHHHHH
T ss_pred             EECCCCCcHHHHHHHHhhh
Confidence            9999999999999998763

>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium}

Probab=95.22  E-value=0.0084  Score=44.68  Aligned_cols=21  Identities=19%  Similarity=0.007  Sum_probs=19.0

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +|+|-.|+|||+||+.+++..
T Consensus        29 Li~Ge~GtGKt~lAr~i~~~~   49 (304)
T 1ojl_A           29 LIHGDSGTGKELVARALHACS   49 (304)
T ss_dssp             EEESCTTSCHHHHHHHHHHHS
T ss_pred             EEECCCCchHHHHHHHHHHhC
Confidence            499999999999999999854

>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A*

Probab=95.21  E-value=0.0061  Score=44.82  Aligned_cols=20  Identities=20%  Similarity=0.223  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+....
T Consensus        40 i~G~~G~GKTTl~~~ia~~~   59 (296)
T 1cr0_A           40 VTSGSGMGKSTFVRQQALQW   59 (296)
T ss_dssp             EEESTTSSHHHHHHHHHHHH
T ss_pred             EEeCCCCCHHHHHHHHHHHH
Confidence            99999999999999988766

>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens}

Probab=95.20  E-value=0.0072  Score=41.35  Aligned_cols=21  Identities=19%  Similarity=0.112  Sum_probs=17.3

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        23 i~~~G~~~~GKssl~~~l~~~   43 (201)
T 2q3h_A           23 CVLVGDGAVGKTSLVVSYTTN   43 (201)
T ss_dssp             EEEECSTTSSHHHHHHHHHC-
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            349999999999999887654

>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8

Probab=95.20  E-value=0.0068  Score=41.26  Aligned_cols=22  Identities=23%  Similarity=0.163  Sum_probs=18.5

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+|||||+..+.+..
T Consensus        26 i~v~G~~~~GKSsli~~l~~~~   47 (191)
T 3dz8_A           26 LLIIGNSSVGKTSFLFRYADDT   47 (191)
T ss_dssp             EEEEESTTSSHHHHHHHHHHHT
T ss_pred             EEEECCCCcCHHHHHHHHhcCC
Confidence            3499999999999999887643

>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens}

Probab=95.20  E-value=0.0073  Score=46.31  Aligned_cols=20  Identities=30%  Similarity=0.273  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|+|||+||+.+.+..
T Consensus       153 L~GppGtGKT~la~aia~~~  172 (389)
T 3vfd_A          153 LFGPPGNGKTMLAKAVAAES  172 (389)
T ss_dssp             EESSTTSCHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHhh
Confidence            99999999999999997754

>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8

Probab=95.20  E-value=0.0075  Score=41.33  Aligned_cols=21  Identities=24%  Similarity=0.208  Sum_probs=17.9

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        11 i~v~G~~~~GKSsli~~l~~~   31 (203)
T 1zbd_A           11 ILIIGNSSVGKTSFLFRYADD   31 (203)
T ss_dssp             EEEECSTTSSHHHHHHHHHTC
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            349999999999999987654

>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927}

Probab=95.19  E-value=0.0067  Score=41.22  Aligned_cols=23  Identities=22%  Similarity=0.294  Sum_probs=19.0

Q ss_pred             CccccCcCCCchhHHHHhhhhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++.|+|..|+|||||+..+.+..
T Consensus        19 ki~v~G~~~~GKSsl~~~l~~~~   41 (199)
T 4bas_A           19 QVVMCGLDNSGKTTIINQVKPAQ   41 (199)
T ss_dssp             EEEEECCTTSCHHHHHHHHSCCC
T ss_pred             EEEEECCCCCCHHHHHHHHhcCC
Confidence            34599999999999999986643

>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A

Probab=95.19  E-value=0.0072  Score=46.67  Aligned_cols=20  Identities=30%  Similarity=0.245  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.|..-.
T Consensus        34 llGpnGsGKSTLLr~iaGl~   53 (372)
T 1g29_1           34 LLGPSGCGKTTTLRMIAGLE   53 (372)
T ss_dssp             EECSTTSSHHHHHHHHHTSS
T ss_pred             EECCCCcHHHHHHHHHHcCC
Confidence            99999999999999987643

>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae}

Probab=95.19  E-value=0.0061  Score=46.93  Aligned_cols=20  Identities=30%  Similarity=0.149  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.|..-.
T Consensus        35 llGpsGsGKSTLLr~iaGl~   54 (359)
T 3fvq_A           35 IIGASGCGKTTLLRCLAGFE   54 (359)
T ss_dssp             EEESTTSSHHHHHHHHHTSS
T ss_pred             EECCCCchHHHHHHHHhcCC
Confidence            99999999999999987743

>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}

Probab=95.19  E-value=0.0061  Score=48.00  Aligned_cols=20  Identities=20%  Similarity=0.262  Sum_probs=18.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      +||..|+|||+||+.|.+..
T Consensus       211 L~GPPGtGKT~lakAiA~~~  230 (428)
T 4b4t_K          211 LYGPPGTGKTMLVKAVANST  230 (428)
T ss_dssp             EESCTTTTHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            99999999999999999866

>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B*

Probab=95.18  E-value=0.0068  Score=41.50  Aligned_cols=21  Identities=24%  Similarity=0.251  Sum_probs=18.0

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        26 i~~vG~~~vGKSsli~~l~~~   46 (190)
T 1m2o_B           26 LLFLGLDNAGKTTLLHMLKND   46 (190)
T ss_dssp             EEEEESTTSSHHHHHHHHHHS
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            449999999999999988763

>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima}

Probab=95.17  E-value=0.007  Score=46.56  Aligned_cols=20  Identities=30%  Similarity=0.360  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.|..-.
T Consensus        34 llGpnGsGKSTLLr~iaGl~   53 (359)
T 2yyz_A           34 LLGPSGCGKTTTLLMLAGIY   53 (359)
T ss_dssp             EECSTTSSHHHHHHHHHTSS
T ss_pred             EEcCCCchHHHHHHHHHCCC
Confidence            99999999999999987643

>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A*

Probab=95.17  E-value=0.007  Score=46.17  Aligned_cols=19  Identities=16%  Similarity=0.025  Sum_probs=17.4

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|+.|+||||||..+...
T Consensus       128 I~GpPGsGKTtLAlqlA~~  146 (331)
T 2vhj_A          128 VTGKGNSGKTPLVHALGEA  146 (331)
T ss_dssp             EECSCSSSHHHHHHHHHHH
T ss_pred             EEcCCCCCHHHHHHHHHHh
Confidence            9999999999999998764

>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A*

Probab=95.17  E-value=0.0079  Score=40.93  Aligned_cols=21  Identities=29%  Similarity=0.215  Sum_probs=17.9

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        24 i~v~G~~~~GKSsli~~l~~~   44 (191)
T 2a5j_A           24 YIIIGDTGVGKSCLLLQFTDK   44 (191)
T ss_dssp             EEEESSTTSSHHHHHHHHHHS
T ss_pred             EEEECcCCCCHHHHHHHHhcC
Confidence            449999999999999988654

>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}

Probab=95.17  E-value=0.0062  Score=47.67  Aligned_cols=20  Identities=20%  Similarity=0.195  Sum_probs=18.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      +||..|+|||+||+.|.+..
T Consensus       187 L~GPPGTGKTllAkAiA~e~  206 (405)
T 4b4t_J          187 LYGPPGTGKTLLARAVAHHT  206 (405)
T ss_dssp             EESCSSSSHHHHHHHHHHHH
T ss_pred             EeCCCCCCHHHHHHHHHHhh
Confidence            99999999999999998866

>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum}

Probab=95.17  E-value=0.0078  Score=40.63  Aligned_cols=21  Identities=19%  Similarity=0.232  Sum_probs=18.1

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        10 i~v~G~~~~GKSsli~~l~~~   30 (208)
T 3clv_A           10 TVLLGESSVGKSSIVLRLTKD   30 (208)
T ss_dssp             EEEECCTTSSHHHHHHHHHHS
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            349999999999999998765

>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C

Probab=95.16  E-value=0.0072  Score=46.67  Aligned_cols=20  Identities=25%  Similarity=0.162  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+..-.
T Consensus        59 IiGpnGaGKSTLlr~i~GL~   78 (366)
T 3tui_C           59 VIGASGAGKSTLIRCVNLLE   78 (366)
T ss_dssp             EECCTTSSHHHHHHHHHTSS
T ss_pred             EEcCCCchHHHHHHHHhcCC
Confidence            99999999999999987643

>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A*

Probab=95.16  E-value=0.0079  Score=40.98  Aligned_cols=20  Identities=25%  Similarity=0.077  Sum_probs=17.8

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus        27 ~~vG~~~~GKSsl~~~l~~~   46 (194)
T 3reg_A           27 VVVGDGAVGKTCLLLAFSKG   46 (194)
T ss_dssp             EEECSTTSSHHHHHHHHHHS
T ss_pred             EEECcCCCCHHHHHHHHhcC
Confidence            39999999999999998764

>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii}

Probab=95.16  E-value=0.0071  Score=46.58  Aligned_cols=20  Identities=30%  Similarity=0.297  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.|..-.
T Consensus        34 llGpnGsGKSTLLr~iaGl~   53 (362)
T 2it1_A           34 LLGPSGSGKSTLLYTIAGIY   53 (362)
T ss_dssp             EECCTTSSHHHHHHHHHTSS
T ss_pred             EECCCCchHHHHHHHHhcCC
Confidence            99999999999999987643

>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A*

Probab=95.15  E-value=0.0071  Score=40.55  Aligned_cols=21  Identities=19%  Similarity=0.055  Sum_probs=17.6

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus         9 i~~~G~~~~GKSsli~~l~~~   29 (181)
T 3t5g_A            9 IAILGYRSVGKSSLTIQFVEG   29 (181)
T ss_dssp             EEEEESTTSSHHHHHHHHHHS
T ss_pred             EEEECcCCCCHHHHHHHHHcC
Confidence            348999999999999988743

>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A*

Probab=95.15  E-value=0.0071  Score=40.16  Aligned_cols=20  Identities=20%  Similarity=0.301  Sum_probs=17.3

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus        18 ~v~G~~~~GKssli~~l~~~   37 (179)
T 2y8e_A           18 VFLGEQSVGKTSLITRFMYD   37 (179)
T ss_dssp             EEEESTTSSHHHHHHHHHHS
T ss_pred             EEECCCCCCHHHHHHHHHcC
Confidence            39999999999999998643

>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A*

Probab=95.15  E-value=0.0072  Score=46.72  Aligned_cols=20  Identities=30%  Similarity=0.245  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.|..-.
T Consensus        42 llGpnGsGKSTLLr~iaGl~   61 (372)
T 1v43_A           42 LLGPSGCGKTTTLRMIAGLE   61 (372)
T ss_dssp             EECCTTSSHHHHHHHHHTSS
T ss_pred             EECCCCChHHHHHHHHHcCC
Confidence            99999999999999987643

>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8

Probab=95.15  E-value=0.007  Score=42.16  Aligned_cols=21  Identities=19%  Similarity=0.045  Sum_probs=18.2

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        31 i~vvG~~~vGKSsLi~~l~~~   51 (205)
T 1gwn_A           31 IVVVGDSQCGKTALLHVFAKD   51 (205)
T ss_dssp             EEEEESTTSSHHHHHHHHHHS
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            349999999999999998664

>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8

Probab=95.14  E-value=0.0081  Score=40.59  Aligned_cols=20  Identities=30%  Similarity=0.366  Sum_probs=17.7

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus        19 ~v~G~~~~GKssli~~l~~~   38 (195)
T 1x3s_A           19 LIIGESGVGKSSLLLRFTDD   38 (195)
T ss_dssp             EEECSTTSSHHHHHHHHHHS
T ss_pred             EEECCCCCCHHHHHHHHHcC
Confidence            39999999999999998664

>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}

Probab=95.13  E-value=0.0079  Score=47.48  Aligned_cols=20  Identities=20%  Similarity=0.268  Sum_probs=19.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      +||..|+|||+||+.|.+..
T Consensus       220 L~GPPGtGKTllAkAiA~e~  239 (437)
T 4b4t_L          220 LYGPPGTGKTLLAKAVAATI  239 (437)
T ss_dssp             EESCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCcHHHHHHHHHHHh
Confidence            99999999999999999876

>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A*

Probab=95.12  E-value=0.0075  Score=44.92  Aligned_cols=20  Identities=30%  Similarity=0.428  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|.+|+||||++..+....
T Consensus       103 i~g~~G~GKTT~~~~la~~~  122 (295)
T 1ls1_A          103 LVGLQGSGKTTTAAKLALYY  122 (295)
T ss_dssp             EECCTTTTHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            78999999999999998766

>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A

Probab=95.12  E-value=0.0076  Score=45.53  Aligned_cols=20  Identities=45%  Similarity=0.591  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|.+|+||||++.++....
T Consensus       110 ivG~~G~GKTT~~~~LA~~l  129 (320)
T 1zu4_A          110 LVGVNGTGKTTSLAKMANYY  129 (320)
T ss_dssp             EESSTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            89999999999999988765

>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A*

Probab=95.12  E-value=0.0083  Score=40.79  Aligned_cols=21  Identities=19%  Similarity=0.033  Sum_probs=18.0

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        25 i~v~G~~~~GKSsli~~l~~~   45 (188)
T 1zd9_A           25 LTLVGLQYSGKTTFVNVIASG   45 (188)
T ss_dssp             EEEECSTTSSHHHHHHHHHHS
T ss_pred             EEEECCCCCCHHHHHHHHHcC
Confidence            349999999999999998754

>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A*

Probab=95.11  E-value=0.0052  Score=46.27  Aligned_cols=19  Identities=32%  Similarity=0.319  Sum_probs=17.5

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|.|||||++.+..-
T Consensus        85 ivG~sGsGKSTLl~ll~gl  103 (306)
T 3nh6_A           85 LVGPSGAGKSTILRLLFRF  103 (306)
T ss_dssp             EESSSCHHHHHHHHHHTTS
T ss_pred             EECCCCchHHHHHHHHHcC
Confidence            9999999999999998764

>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406}

Probab=95.11  E-value=0.0052  Score=45.81  Aligned_cols=22  Identities=23%  Similarity=0.178  Sum_probs=19.3

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.++|-.|+||||||+.+.+..
T Consensus        49 vll~G~pGtGKT~la~~la~~~   70 (331)
T 2r44_A           49 ILLEGVPGLAKTLSVNTLAKTM   70 (331)
T ss_dssp             EEEESCCCHHHHHHHHHHHHHT
T ss_pred             EEEECCCCCcHHHHHHHHHHHh
Confidence            3499999999999999998855

>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X*

Probab=95.10  E-value=0.0029  Score=52.54  Aligned_cols=20  Identities=25%  Similarity=0.180  Sum_probs=18.6

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|+||||||+.+.+..
T Consensus       212 L~G~~GtGKT~la~~la~~l  231 (758)
T 1r6b_X          212 LVGESGVGKTAIAEGLAWRI  231 (758)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EEcCCCCCHHHHHHHHHHHH
Confidence            99999999999999998765

>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens}

Probab=95.10  E-value=0.0074  Score=41.49  Aligned_cols=21  Identities=19%  Similarity=0.061  Sum_probs=18.1

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+|||||+..+.+..
T Consensus        28 ~vvG~~~~GKSsli~~l~~~~   48 (201)
T 3oes_A           28 VILGYRCVGKTSLAHQFVEGE   48 (201)
T ss_dssp             EEEESTTSSHHHHHHHHHHSC
T ss_pred             EEECCCCcCHHHHHHHHHhCC
Confidence            399999999999999987643

>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20

Probab=95.09  E-value=0.0026  Score=53.73  Aligned_cols=20  Identities=25%  Similarity=0.313  Sum_probs=18.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|-.|+||||||+.+.+..
T Consensus       196 L~G~pG~GKT~la~~la~~l  215 (854)
T 1qvr_A          196 LIGEPGVGKTAIVEGLAQRI  215 (854)
T ss_dssp             EEECTTSCHHHHHHHHHHHH
T ss_pred             EEcCCCCCHHHHHHHHHHHH
Confidence            99999999999999998865

>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus}

Probab=95.09  E-value=0.0078  Score=48.23  Aligned_cols=21  Identities=29%  Similarity=0.207  Sum_probs=19.1

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+||||||+.|.+..
T Consensus        68 LL~GppGtGKTtLaraIa~~~   88 (499)
T 2dhr_A           68 LLVGPPGVGKTHLARAVAGEA   88 (499)
T ss_dssp             EEECSSSSSHHHHHHHHHHHT
T ss_pred             EEECCCCCCHHHHHHHHHHHh
Confidence            499999999999999998865

>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228}

Probab=95.08  E-value=0.0084  Score=45.86  Aligned_cols=21  Identities=19%  Similarity=0.126  Sum_probs=18.5

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|..|+||||||+.+....
T Consensus        11 ~I~GptgSGKTtla~~La~~l   31 (340)
T 3d3q_A           11 VIVGPTASGKTELSIEVAKKF   31 (340)
T ss_dssp             EEECSTTSSHHHHHHHHHHHT
T ss_pred             EEECCCcCcHHHHHHHHHHHc
Confidence            399999999999999987764

>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens}

Probab=95.07  E-value=0.0084  Score=42.63  Aligned_cols=21  Identities=19%  Similarity=0.115  Sum_probs=18.2

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+|||||+..+.+..
T Consensus        33 ~lvG~~g~GKStlin~l~g~~   53 (239)
T 3lxx_A           33 VLVGKTGAGKSATGNSILGRK   53 (239)
T ss_dssp             EEECCTTSSHHHHHHHHHTSC
T ss_pred             EEECCCCCCHHHHHHHHcCCC
Confidence            399999999999999887643

>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B*

Probab=95.07  E-value=0.0087  Score=40.58  Aligned_cols=21  Identities=19%  Similarity=0.075  Sum_probs=17.8

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        23 i~v~G~~~~GKSsli~~l~~~   43 (189)
T 1z06_A           23 IIVIGDSNVGKTCLTYRFCAG   43 (189)
T ss_dssp             EEEECCTTSSHHHHHHHHHHS
T ss_pred             EEEECCCCCCHHHHHHHHHcC
Confidence            449999999999999988643

>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A

Probab=95.06  E-value=0.0078  Score=46.71  Aligned_cols=20  Identities=30%  Similarity=0.109  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.|..-.
T Consensus        34 llGpsGsGKSTLLr~iaGl~   53 (381)
T 3rlf_A           34 FVGPSGCGKSTLLRMIAGLE   53 (381)
T ss_dssp             EECCTTSSHHHHHHHHHTSS
T ss_pred             EEcCCCchHHHHHHHHHcCC
Confidence            99999999999999987644

>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8

Probab=95.06  E-value=0.0077  Score=41.11  Aligned_cols=20  Identities=25%  Similarity=0.388  Sum_probs=17.5

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus        27 ~vvG~~~~GKSsli~~l~~~   46 (192)
T 2fg5_A           27 CLLGDTGVGKSSIVCRFVQD   46 (192)
T ss_dssp             EEEECTTSSHHHHHHHHHHC
T ss_pred             EEECcCCCCHHHHHHHHhcC
Confidence            39999999999999998654

>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii}

Probab=95.04  E-value=0.0085  Score=45.41  Aligned_cols=20  Identities=25%  Similarity=0.102  Sum_probs=17.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+..-.
T Consensus        97 I~GpsGSGKSTl~~~L~~ll  116 (321)
T 3tqc_A           97 IAGSVAVGKSTTSRVLKALL  116 (321)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            89999999999999987654

>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens}

Probab=95.03  E-value=0.0081  Score=41.04  Aligned_cols=21  Identities=24%  Similarity=0.351  Sum_probs=17.7

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        29 i~vvG~~~~GKSsLi~~l~~~   49 (192)
T 2il1_A           29 VIIIGSRGVGKTSLMERFTDD   49 (192)
T ss_dssp             EEEECSTTSSHHHHHHHHCC-
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            449999999999999998754

>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A*

Probab=95.01  E-value=0.0093  Score=40.44  Aligned_cols=21  Identities=24%  Similarity=0.210  Sum_probs=18.1

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        25 i~vvG~~~~GKSsli~~l~~~   45 (189)
T 2gf9_A           25 LLLIGNSSVGKTSFLFRYADD   45 (189)
T ss_dssp             EEEECSTTSSHHHHHHHHHHS
T ss_pred             EEEECCCCCCHHHHHHHHHcC
Confidence            449999999999999988654

>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A*

Probab=95.00  E-value=0.0092  Score=40.21  Aligned_cols=20  Identities=35%  Similarity=0.426  Sum_probs=17.6

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus        22 ~v~G~~~~GKssl~~~l~~~   41 (186)
T 1ksh_A           22 LMLGLDNAGKTTILKKFNGE   41 (186)
T ss_dssp             EEECSTTSSHHHHHHHHTTC
T ss_pred             EEECCCCCCHHHHHHHHhcC
Confidence            49999999999999998754

>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum}

Probab=94.99  E-value=0.0095  Score=41.94  Aligned_cols=21  Identities=19%  Similarity=0.078  Sum_probs=18.2

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        32 I~vvG~~~vGKSsLin~l~~~   52 (228)
T 2qu8_A           32 IILSGAPNVGKSSFMNIVSRA   52 (228)
T ss_dssp             EEEECSTTSSHHHHHHHHTTT
T ss_pred             EEEECCCCCCHHHHHHHHhCC
Confidence            449999999999999988664

>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8

Probab=94.98  E-value=0.0062  Score=40.85  Aligned_cols=20  Identities=30%  Similarity=0.368  Sum_probs=17.2

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|..|+|||||+..+.+
T Consensus        21 i~v~G~~~~GKssli~~l~~   40 (183)
T 1moz_A           21 ILILGLDGAGKTTILYRLQI   40 (183)
T ss_dssp             EEEEEETTSSHHHHHHHTCC
T ss_pred             EEEECCCCCCHHHHHHHHhc
Confidence            34999999999999998864

>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens}

Probab=94.98  E-value=0.0095  Score=40.85  Aligned_cols=21  Identities=24%  Similarity=0.118  Sum_probs=17.9

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        31 i~v~G~~~~GKSsli~~l~~~   51 (199)
T 2p5s_A           31 IVLAGDAAVGKSSFLMRLCKN   51 (199)
T ss_dssp             EEEESSTTSSHHHHHHHHHHC
T ss_pred             EEEECcCCCCHHHHHHHHHhC
Confidence            349999999999999988653

>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1

Probab=94.96  E-value=0.01  Score=42.28  Aligned_cols=19  Identities=21%  Similarity=0.029  Sum_probs=17.2

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|+.|+||||+++.+...
T Consensus        21 i~G~~gsGKst~~~~l~~~   39 (236)
T 1q3t_A           21 IDGPASSGKSTVAKIIAKD   39 (236)
T ss_dssp             EECSSCSSHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHH
Confidence            8999999999999988764

>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8

Probab=94.96  E-value=0.0087  Score=40.66  Aligned_cols=21  Identities=29%  Similarity=0.332  Sum_probs=17.8

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        11 i~vvG~~~~GKSsli~~l~~~   31 (199)
T 2gf0_A           11 VVVFGAGGVGKSSLVLRFVKG   31 (199)
T ss_dssp             EEEEECTTSSHHHHHHHHHHS
T ss_pred             EEEECCCCCcHHHHHHHHHcC
Confidence            349999999999999998653

>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens}

Probab=94.95  E-value=0.0082  Score=41.34  Aligned_cols=21  Identities=24%  Similarity=0.243  Sum_probs=17.4

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        28 i~v~G~~~~GKSsLi~~l~~~   48 (200)
T 2o52_A           28 FLVIGSAGTGKSCLLHQFIEN   48 (200)
T ss_dssp             EEEEESTTSSHHHHHHHHHC-
T ss_pred             EEEECcCCCCHHHHHHHHHhC
Confidence            339999999999999987653

>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A*

Probab=94.93  E-value=0.0094  Score=46.79  Aligned_cols=20  Identities=25%  Similarity=0.197  Sum_probs=19.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+||||||+.+.+..
T Consensus        68 l~GppGtGKT~la~ala~~l   87 (456)
T 2c9o_A           68 LAGPPGTGKTALALAIAQEL   87 (456)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EECCCcCCHHHHHHHHHHHh
Confidence            99999999999999999876

>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A*

Probab=94.93  E-value=0.0084  Score=45.81  Aligned_cols=20  Identities=35%  Similarity=0.283  Sum_probs=18.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|+|||||++.+.+..
T Consensus        76 IiG~nGaGKTTLl~~I~g~~   95 (347)
T 2obl_A           76 IFAGSGVGKSTLLGMICNGA   95 (347)
T ss_dssp             EEECTTSSHHHHHHHHHHHS
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999998865

>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens}

Probab=94.93  E-value=0.0079  Score=40.84  Aligned_cols=22  Identities=27%  Similarity=0.362  Sum_probs=18.6

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+|||||+..+.+..
T Consensus        24 i~v~G~~~~GKSsli~~l~~~~   45 (190)
T 2h57_A           24 VLCLGLDNSGKTTIINKLKPSN   45 (190)
T ss_dssp             EEEEECTTSSHHHHHHHTSCGG
T ss_pred             EEEECCCCCCHHHHHHHHhcCC
Confidence            4499999999999999987653

>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A

Probab=94.91  E-value=0.0094  Score=48.02  Aligned_cols=20  Identities=25%  Similarity=0.250  Sum_probs=18.6

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+||||||+.+.+..
T Consensus       113 l~Gp~GtGKTtlar~ia~~l  132 (543)
T 3m6a_A          113 LAGPPGVGKTSLAKSIAKSL  132 (543)
T ss_dssp             EESSSSSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHhc
Confidence            99999999999999998765

>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A

Probab=94.91  E-value=0.0096  Score=46.06  Aligned_cols=20  Identities=20%  Similarity=-0.047  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+.+..
T Consensus       174 l~G~~GsGKSTl~~~l~~~~  193 (377)
T 1svm_A          174 FKGPIDSGKTTLAAALLELC  193 (377)
T ss_dssp             EECSTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHhhc
Confidence            99999999999999998743

>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10

Probab=94.90  E-value=0.0084  Score=43.20  Aligned_cols=20  Identities=25%  Similarity=0.428  Sum_probs=16.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-||+||||++-.+-.-.
T Consensus         6 vs~KGGvGKTT~a~nLA~~l   25 (269)
T 1cp2_A            6 IYGKGGIGKSTTTQNLTSGL   25 (269)
T ss_dssp             EEECTTSSHHHHHHHHHHHH
T ss_pred             EecCCCCcHHHHHHHHHHHH
Confidence            46889999999998875443

>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A*

Probab=94.89  E-value=0.0099  Score=40.83  Aligned_cols=20  Identities=30%  Similarity=0.164  Sum_probs=17.0

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|-+|+|||||+..+.+
T Consensus         9 v~lvG~~~vGKSsL~~~~~~   28 (192)
T 2cjw_A            9 VVLIGEQGVGKSTLANIFAG   28 (192)
T ss_dssp             EEEECSTTSSHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHhc
Confidence            34999999999999988753

>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A*

Probab=94.87  E-value=0.0063  Score=43.00  Aligned_cols=18  Identities=33%  Similarity=0.300  Sum_probs=14.9

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |.|-||+||||++-.+-.
T Consensus         5 vs~kGGvGKTt~a~~LA~   22 (254)
T 3kjh_A            5 VAGKGGVGKTTVAAGLIK   22 (254)
T ss_dssp             EECSSSHHHHHHHHHHHH
T ss_pred             EecCCCCCHHHHHHHHHH
Confidence            468999999999988643

>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12

Probab=94.86  E-value=0.0062  Score=46.65  Aligned_cols=20  Identities=25%  Similarity=0.142  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.|..-.
T Consensus        31 llGpnGsGKSTLLr~iaGl~   50 (348)
T 3d31_A           31 ILGPTGAGKTLFLELIAGFH   50 (348)
T ss_dssp             EECCCTHHHHHHHHHHHTSS
T ss_pred             EECCCCccHHHHHHHHHcCC
Confidence            99999999999999997743

>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens}

Probab=94.86  E-value=0.0089  Score=41.66  Aligned_cols=20  Identities=25%  Similarity=0.131  Sum_probs=17.1

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus        38 ~vvG~~~vGKSsli~~l~~~   57 (214)
T 2j1l_A           38 VLVGDGGCGKTSLLMVFADG   57 (214)
T ss_dssp             EEEECTTSSHHHHHHHHHC-
T ss_pred             EEECcCCCCHHHHHHHHHcC
Confidence            39999999999999988653

>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1

Probab=94.85  E-value=0.0092  Score=42.58  Aligned_cols=20  Identities=25%  Similarity=0.119  Sum_probs=17.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|.-|+||||+++.+.+..
T Consensus         7 ~~G~~g~GKtt~~~~l~~~l   26 (241)
T 2ocp_A            7 IEGNIAVGKSTFVKLLTKTY   26 (241)
T ss_dssp             EEECTTSSHHHHHHHHHHHC
T ss_pred             EEcCCCCCHHHHHHHHHHHc
Confidence            78999999999999987764

>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B

Probab=94.84  E-value=0.0088  Score=47.04  Aligned_cols=22  Identities=27%  Similarity=0.315  Sum_probs=19.0

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|.+|+|||||+.++....
T Consensus       102 I~ivG~~GvGKTTla~~La~~l  123 (432)
T 2v3c_C          102 ILLVGIQGSGKTTTAAKLARYI  123 (432)
T ss_dssp             EEEECCSSSSTTHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
Confidence            3499999999999999987765

>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8

Probab=94.84  E-value=0.0096  Score=40.46  Aligned_cols=21  Identities=24%  Similarity=0.124  Sum_probs=18.0

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        21 i~v~G~~~~GKssli~~l~~~   41 (194)
T 2atx_A           21 CVVVGDGAVGKTCLLMSYAND   41 (194)
T ss_dssp             EEEEECTTSSHHHHHHHHHHS
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            349999999999999988754

>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus}

Probab=94.83  E-value=0.011  Score=45.33  Aligned_cols=21  Identities=24%  Similarity=0.249  Sum_probs=18.7

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|+.|+|||||+..+...+
T Consensus        44 vI~GPTgsGKTtLa~~LA~~l   64 (339)
T 3a8t_A           44 VLMGATGTGKSRLSIDLAAHF   64 (339)
T ss_dssp             EEECSTTSSHHHHHHHHHTTS
T ss_pred             EEECCCCCCHHHHHHHHHHHC
Confidence            399999999999999987755

>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis}

Probab=94.83  E-value=0.0092  Score=45.64  Aligned_cols=20  Identities=30%  Similarity=0.340  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+..-.
T Consensus       180 ivG~sGsGKSTll~~l~~~~  199 (361)
T 2gza_A          180 VAGETGSGKTTLMKALMQEI  199 (361)
T ss_dssp             EEESSSSCHHHHHHHHHTTS
T ss_pred             EECCCCCCHHHHHHHHHhcC
Confidence            99999999999999987754

>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A*

Probab=94.83  E-value=0.011  Score=41.32  Aligned_cols=20  Identities=20%  Similarity=0.081  Sum_probs=17.4

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus        31 ~vvG~~~vGKSsL~~~l~~~   50 (214)
T 3q3j_B           31 VLVGDVQCGKTAMLQVLAKD   50 (214)
T ss_dssp             EEECSTTSSHHHHHHHHHHS
T ss_pred             EEECcCCCCHHHHHHHHhcC
Confidence            39999999999999987654

>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8

Probab=94.83  E-value=0.0097  Score=41.35  Aligned_cols=21  Identities=24%  Similarity=0.207  Sum_probs=17.6

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        29 i~lvG~~~vGKSsLi~~l~~~   49 (201)
T 2ew1_A           29 IVLIGNAGVGKTCLVRRFTQG   49 (201)
T ss_dssp             EEEEESTTSSHHHHHHHHHHS
T ss_pred             EEEECcCCCCHHHHHHHHHhC
Confidence            349999999999999987543

>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A*

Probab=94.82  E-value=0.0065  Score=40.80  Aligned_cols=21  Identities=29%  Similarity=0.287  Sum_probs=7.6

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        11 i~v~G~~~~GKssl~~~l~~~   31 (183)
T 2fu5_C           11 LLLIGDSGVGKTCVLFRFSED   31 (183)
T ss_dssp             EEEECCCCC------------
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            349999999999999887543

>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A*

Probab=94.80  E-value=0.011  Score=41.02  Aligned_cols=21  Identities=33%  Similarity=0.360  Sum_probs=17.8

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        28 i~vvG~~~~GKSsLi~~l~~~   48 (217)
T 2f7s_A           28 LLALGDSGVGKTTFLYRYTDN   48 (217)
T ss_dssp             EEEESCTTSSHHHHHHHHHCS
T ss_pred             EEEECcCCCCHHHHHHHHhcC
Confidence            349999999999999987653

>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8

Probab=94.80  E-value=0.01  Score=40.13  Aligned_cols=19  Identities=26%  Similarity=0.242  Sum_probs=17.0

Q ss_pred             cccCcCCCchhHHHHhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~  108 (130)
                      .|+|..|+|||||+..+.+
T Consensus        20 ~v~G~~~~GKssl~~~l~~   38 (187)
T 1zj6_A           20 IIVGLDNAGKTTILYQFSM   38 (187)
T ss_dssp             EEEESTTSSHHHHHHHHHT
T ss_pred             EEECCCCCCHHHHHHHHhc
Confidence            4999999999999998874

>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F

Probab=94.80  E-value=0.0096  Score=44.47  Aligned_cols=20  Identities=35%  Similarity=0.426  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|.+|+||||++.++....
T Consensus       103 i~G~~G~GKTT~~~~la~~~  122 (297)
T 1j8m_F          103 LVGVQGTGKTTTAGKLAYFY  122 (297)
T ss_dssp             EECSSCSSTTHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            88999999999999988765

>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}

Probab=94.80  E-value=0.0092  Score=47.51  Aligned_cols=20  Identities=20%  Similarity=0.235  Sum_probs=18.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+|||+||+.|.+..
T Consensus       248 LyGPPGTGKTlLAkAiA~e~  267 (467)
T 4b4t_H          248 LYGPPGTGKTLCARAVANRT  267 (467)
T ss_dssp             ECSCTTSSHHHHHHHHHHHH
T ss_pred             eeCCCCCcHHHHHHHHHhcc
Confidence            99999999999999999866

>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A*

Probab=94.79  E-value=0.01  Score=40.84  Aligned_cols=21  Identities=29%  Similarity=0.270  Sum_probs=17.8

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        11 i~v~G~~~~GKSsli~~l~~~   31 (206)
T 2bcg_Y           11 LLLIGNSGVGKSCLLLRFSDD   31 (206)
T ss_dssp             EEEEESTTSSHHHHHHHHHHC
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            349999999999999998654

>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus}

Probab=94.79  E-value=0.01  Score=44.20  Aligned_cols=19  Identities=37%  Similarity=0.323  Sum_probs=17.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+. ..
T Consensus       170 l~G~sG~GKSTLln~l~-~~  188 (302)
T 2yv5_A          170 LAGPSGVGKSSILSRLT-GE  188 (302)
T ss_dssp             EECSTTSSHHHHHHHHH-SC
T ss_pred             EECCCCCCHHHHHHHHH-Hh
Confidence            99999999999999997 44

>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8

Probab=94.79  E-value=0.01  Score=41.06  Aligned_cols=22  Identities=18%  Similarity=0.024  Sum_probs=18.5

Q ss_pred             CccccCcCCCchhHHHHhhhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~~  109 (130)
                      ++.|+|..|+|||||+..+.+.
T Consensus        27 ki~vvG~~~~GKSsli~~l~~~   48 (207)
T 2fv8_A           27 KLVVVGDGACGKTCLLIVFSKD   48 (207)
T ss_dssp             EEEEEECTTSSHHHHHHHHHHS
T ss_pred             EEEEECcCCCCHHHHHHHHhcC
Confidence            3449999999999999988664

>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A*

Probab=94.78  E-value=0.0095  Score=40.17  Aligned_cols=21  Identities=24%  Similarity=0.199  Sum_probs=18.0

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        24 i~v~G~~~~GKSsli~~l~~~   44 (181)
T 2h17_A           24 VIIVGLDNAGKTTILYQFSMN   44 (181)
T ss_dssp             EEEEEETTSSHHHHHHHHHTT
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            449999999999999998653

>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1}

Probab=94.77  E-value=0.024  Score=42.43  Aligned_cols=32  Identities=9%  Similarity=-0.059  Sum_probs=24.0

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEe
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVV  125 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~V  125 (130)
                      |.|..|+|||||+..+...... . . ..++|++.
T Consensus        73 i~G~pG~GKTtl~l~ia~~~a~-~-g-~~vl~~sl  104 (315)
T 3bh0_A           73 IAARPSMGKTAFALKQAKNMSD-N-D-DVVNLHSL  104 (315)
T ss_dssp             EECCTTSSHHHHHHHHHHHHHT-T-T-CEEEEEES
T ss_pred             EEeCCCCCHHHHHHHHHHHHHH-c-C-CeEEEEEC
Confidence            9999999999999998765522 2 2 56777653

>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ...

Probab=94.77  E-value=0.01  Score=43.00  Aligned_cols=20  Identities=20%  Similarity=-0.062  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|.-|+||||+++.+.+..
T Consensus        29 ieG~~GsGKST~~~~L~~~l   48 (263)
T 1p5z_B           29 IEGNIAAGKSTFVNILKQLC   48 (263)
T ss_dssp             EECSTTSSHHHHHTTTGGGC
T ss_pred             EECCCCCCHHHHHHHHHHhc
Confidence            99999999999999998765

>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A

Probab=94.76  E-value=0.0096  Score=43.59  Aligned_cols=20  Identities=25%  Similarity=0.453  Sum_probs=16.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-||+||||++-.+-.-.
T Consensus         7 vs~KGGvGKTT~a~nLA~~L   26 (289)
T 2afh_E            7 IYGKGGIGKSTTTQNLVAAL   26 (289)
T ss_dssp             EEECTTSSHHHHHHHHHHHH
T ss_pred             EeCCCcCcHHHHHHHHHHHH
Confidence            56899999999999886654

>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A

Probab=94.74  E-value=0.011  Score=44.80  Aligned_cols=20  Identities=25%  Similarity=0.228  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+..-.
T Consensus       176 i~G~~GsGKTTll~~l~g~~  195 (330)
T 2pt7_A          176 VCGGTGSGKTTYIKSIMEFI  195 (330)
T ss_dssp             EEESTTSCHHHHHHHGGGGS
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens}

Probab=94.73  E-value=0.0097  Score=46.27  Aligned_cols=19  Identities=37%  Similarity=0.309  Sum_probs=17.5

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|+|||||++.|..-
T Consensus        52 llGpsGsGKSTLLr~iaGl   70 (390)
T 3gd7_A           52 LLGRTGSGKSTLLSAFLRL   70 (390)
T ss_dssp             EEESTTSSHHHHHHHHHTC
T ss_pred             EECCCCChHHHHHHHHhCC
Confidence            9999999999999998763

>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana}

Probab=94.71  E-value=0.011  Score=40.86  Aligned_cols=20  Identities=25%  Similarity=0.145  Sum_probs=17.2

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus        13 ~i~G~~~~GKTsli~~l~~~   32 (212)
T 2j0v_A           13 VTVGDGAVGKTCMLICYTSN   32 (212)
T ss_dssp             EEEESTTSSHHHHHHHHHHS
T ss_pred             EEECCCCCCHHHHHHHHhcC
Confidence            39999999999999887653

>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8

Probab=94.70  E-value=0.012  Score=40.38  Aligned_cols=21  Identities=29%  Similarity=0.295  Sum_probs=17.8

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        23 i~v~G~~~~GKSsli~~l~~~   43 (213)
T 3cph_A           23 ILLIGDSGVGKSCLLVRFVED   43 (213)
T ss_dssp             EEEECSTTSSHHHHHHHHHHC
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            349999999999999987653

>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ...

Probab=94.69  E-value=0.011  Score=40.66  Aligned_cols=22  Identities=18%  Similarity=0.012  Sum_probs=18.6

Q ss_pred             CccccCcCCCchhHHHHhhhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~~  109 (130)
                      ++.|+|..|+|||||+..+.+.
T Consensus        27 ki~vvG~~~~GKSsli~~l~~~   48 (201)
T 2gco_A           27 KLVIVGDGACGKTCLLIVFSKD   48 (201)
T ss_dssp             EEEEEESTTSSHHHHHHHHHHS
T ss_pred             EEEEECCCCCCHHHHHHHHHhC
Confidence            3459999999999999988764

>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A*

Probab=94.69  E-value=0.0099  Score=40.72  Aligned_cols=19  Identities=32%  Similarity=0.307  Sum_probs=16.9

Q ss_pred             cccCcCCCchhHHHHhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~  108 (130)
                      .|+|..|+|||||+..+.+
T Consensus        33 ~v~G~~~vGKSsLi~~l~~   51 (192)
T 2b6h_A           33 LMVGLDAAGKTTILYKLKL   51 (192)
T ss_dssp             EEEESTTSSHHHHHHHHCS
T ss_pred             EEECCCCCCHHHHHHHHHh
Confidence            3999999999999999854

>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A*

Probab=94.68  E-value=0.011  Score=40.87  Aligned_cols=19  Identities=26%  Similarity=0.198  Sum_probs=16.6

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|+|||||+..+.+.
T Consensus        35 vvG~~~~GKSsLi~~l~~~   53 (204)
T 4gzl_A           35 VVGDGAVGKTCLLISYTTN   53 (204)
T ss_dssp             EEESTTSSHHHHHHHHHHS
T ss_pred             EECcCCCCHHHHHHHHHhC
Confidence            9999999999999777643

>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens}

Probab=94.67  E-value=0.012  Score=46.17  Aligned_cols=21  Identities=24%  Similarity=0.302  Sum_probs=18.5

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|-.|+|||||++.+.+..
T Consensus        35 ~lvG~sGaGKSTLln~L~g~~   55 (418)
T 2qag_C           35 MVVGESGLGKSTLINSLFLTD   55 (418)
T ss_dssp             EEECCTTSSHHHHHHHHTTCC
T ss_pred             EEECCCCCcHHHHHHHHhCCC
Confidence            499999999999999988753

>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A*

Probab=94.67  E-value=0.0057  Score=46.89  Aligned_cols=20  Identities=25%  Similarity=0.129  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.|..-.
T Consensus        36 llGpnGsGKSTLLr~iaGl~   55 (353)
T 1oxx_K           36 ILGPSGAGKTTFMRIIAGLD   55 (353)
T ss_dssp             EECSCHHHHHHHHHHHHTSS
T ss_pred             EECCCCCcHHHHHHHHhCCC
Confidence            99999999999999987643

>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ...

Probab=94.67  E-value=0.0099  Score=41.45  Aligned_cols=22  Identities=32%  Similarity=0.308  Sum_probs=17.8

Q ss_pred             ccccCcCCCchhHHHHh-hhhhh
Q 042811           89 NWPFGVEGVGKITSLSK-SYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~-v~~~~  110 (130)
                      +.|+|..|+|||||+.. +.+.+
T Consensus        18 i~v~G~~~~GKSsli~~~~~~~~   40 (221)
T 3gj0_A           18 LVLVGDGGTGKTTFVKRHLTGEF   40 (221)
T ss_dssp             EEEEECTTSSHHHHHTTBHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHcCCC
Confidence            34999999999999998 54443

>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9

Probab=94.66  E-value=0.011  Score=46.40  Aligned_cols=20  Identities=35%  Similarity=0.381  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|.||+||||++-++-...
T Consensus       105 ivG~~GvGKTT~a~~LA~~l  124 (433)
T 2xxa_A          105 MAGLQGAGKTTSVGKLGKFL  124 (433)
T ss_dssp             EECSTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            88999999999999987766

>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii}

Probab=94.64  E-value=0.011  Score=41.69  Aligned_cols=20  Identities=20%  Similarity=-0.037  Sum_probs=16.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||+..+....
T Consensus        28 i~G~~GsGKTtl~~~~~~~~   47 (247)
T 2dr3_A           28 LSGGPGTGKTIFSQQFLWNG   47 (247)
T ss_dssp             EEECTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            99999999999987765544

>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A*

Probab=94.64  E-value=0.017  Score=40.92  Aligned_cols=19  Identities=21%  Similarity=0.272  Sum_probs=16.4

Q ss_pred             ccccCcCCCchhHHHHhhh
Q 042811           89 NWPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~  107 (130)
                      +.|+|-+|||||+|+...-
T Consensus        16 ivlvGd~~VGKTsLi~r~~   34 (216)
T 4dkx_A           16 LVFLGEQSVGKTSLITRFM   34 (216)
T ss_dssp             EEEECSTTSSHHHHHHHHH
T ss_pred             EEEECcCCcCHHHHHHHHH
Confidence            4599999999999998753

>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens}

Probab=94.63  E-value=0.013  Score=44.89  Aligned_cols=19  Identities=26%  Similarity=0.429  Sum_probs=17.4

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|+|||||+..++..
T Consensus        42 vvG~~g~GKSTLln~L~~~   60 (361)
T 2qag_A           42 VVGESGLGKSTLINSLFLT   60 (361)
T ss_dssp             ECCCTTSCHHHHHHHHTTC
T ss_pred             EEcCCCCCHHHHHHHHhCC
Confidence            9999999999999998764

>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans}

Probab=94.63  E-value=0.0073  Score=48.99  Aligned_cols=20  Identities=25%  Similarity=0.240  Sum_probs=18.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|+.|+|||||++.+....
T Consensus       374 LiG~sGSGKSTLar~La~~L  393 (552)
T 3cr8_A          374 FTGLSGAGKSTLARALAARL  393 (552)
T ss_dssp             EEESSCHHHHHHHHHHHHHH
T ss_pred             EECCCCChHHHHHHHHHHhh
Confidence            99999999999999998865

>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens}

Probab=94.63  E-value=0.012  Score=40.66  Aligned_cols=21  Identities=19%  Similarity=0.105  Sum_probs=17.8

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        32 i~vvG~~~vGKSsli~~l~~~   52 (201)
T 2hup_A           32 LVLVGDASVGKTCVVQRFKTG   52 (201)
T ss_dssp             EEEEECTTSSHHHHHHHHHHS
T ss_pred             EEEECcCCCCHHHHHHHHhhC
Confidence            349999999999999988653

>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae}

Probab=94.63  E-value=0.011  Score=46.85  Aligned_cols=20  Identities=15%  Similarity=-0.011  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+.+-.
T Consensus       143 IvGpnGsGKSTLlr~L~Gl~  162 (460)
T 2npi_A          143 IVGGSQTGKTSLSRTLCSYA  162 (460)
T ss_dssp             EEESTTSSHHHHHHHHHHTT
T ss_pred             EECCCCCCHHHHHHHHhCcc
Confidence            99999999999999998755

>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A

Probab=94.61  E-value=0.023  Score=43.58  Aligned_cols=33  Identities=15%  Similarity=-0.045  Sum_probs=24.6

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR  126 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS  126 (130)
                      |+|-+|+||||||..+-....+  .. ..++|+...
T Consensus        68 I~G~pGsGKTtLal~la~~~~~--~g-~~vlyid~E  100 (356)
T 1u94_A           68 IYGPESSGKTTLTLQVIAAAQR--EG-KTCAFIDAE  100 (356)
T ss_dssp             EECSTTSSHHHHHHHHHHHHHH--TT-CCEEEEESS
T ss_pred             EECCCCCCHHHHHHHHHHHHHH--CC-CeEEEEeCC
Confidence            9999999999999988766522  12 257777664

>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A*

Probab=94.60  E-value=0.013  Score=45.08  Aligned_cols=20  Identities=25%  Similarity=0.298  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+....
T Consensus       141 ivG~~GsGKTTll~~l~~~~  160 (372)
T 2ewv_A          141 VTGPTGSGKSTTIASMIDYI  160 (372)
T ss_dssp             EECSSSSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHhhc
Confidence            99999999999999987754

>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus}

Probab=94.59  E-value=0.013  Score=40.90  Aligned_cols=19  Identities=26%  Similarity=0.172  Sum_probs=16.8

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|+.|+||||+++.+...
T Consensus         8 i~G~~gsGkst~~~~l~~~   26 (219)
T 2h92_A            8 LDGPAAAGKSTIAKRVASE   26 (219)
T ss_dssp             EECCTTSSHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHh
Confidence            8999999999999987553

>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens}

Probab=94.59  E-value=0.012  Score=46.35  Aligned_cols=20  Identities=25%  Similarity=0.386  Sum_probs=18.0

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||++.+...
T Consensus        46 aLvG~nGaGKSTLln~L~G~   65 (427)
T 2qag_B           46 LCVGETGLGKSTLMDTLFNT   65 (427)
T ss_dssp             EEECSTTSSSHHHHHHHHTS
T ss_pred             EEECCCCCCHHHHHHHHhCc
Confidence            39999999999999999774

>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A*

Probab=94.58  E-value=0.014  Score=39.03  Aligned_cols=17  Identities=29%  Similarity=0.388  Sum_probs=16.0

Q ss_pred             ccCcCCCchhHHHHhhh
Q 042811           91 PFGVEGVGKITSLSKSY  107 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~  107 (130)
                      |+|..|.|||||+..|+
T Consensus        28 I~G~NGsGKStil~Ai~   44 (149)
T 1f2t_A           28 IIGQNGSGKSSLLDAIL   44 (149)
T ss_dssp             EECCTTSSHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHH
Confidence            99999999999999975

>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ...

Probab=94.57  E-value=0.021  Score=43.57  Aligned_cols=33  Identities=18%  Similarity=0.041  Sum_probs=24.2

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR  126 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS  126 (130)
                      |+|-.|+|||||+..+-....+  .. ..++|+...
T Consensus        66 I~G~pGsGKTtLal~la~~~~~--~g-~~vlyi~~E   98 (349)
T 2zr9_A           66 IYGPESSGKTTVALHAVANAQA--AG-GIAAFIDAE   98 (349)
T ss_dssp             EEESTTSSHHHHHHHHHHHHHH--TT-CCEEEEESS
T ss_pred             EECCCCCCHHHHHHHHHHHHHh--CC-CeEEEEECC
Confidence            9999999999999988765522  12 356777655

>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A

Probab=94.54  E-value=0.014  Score=46.06  Aligned_cols=22  Identities=18%  Similarity=-0.000  Sum_probs=19.1

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++++|+.|+||||+++.+....
T Consensus        42 IvlvGlpGsGKSTia~~La~~l   63 (469)
T 1bif_A           42 IVMVGLPARGKTYISKKLTRYL   63 (469)
T ss_dssp             EEEECCTTSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
Confidence            4499999999999999987654

>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A*

Probab=94.53  E-value=0.013  Score=44.56  Aligned_cols=19  Identities=37%  Similarity=0.366  Sum_probs=16.9

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|.+|+|||||+..+...
T Consensus        84 i~G~~G~GKSTl~~~L~~~  102 (355)
T 3p32_A           84 ITGVPGVGKSTAIEALGMH  102 (355)
T ss_dssp             EECCTTSSHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHH
Confidence            8999999999999988654

>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8

Probab=94.52  E-value=0.013  Score=43.53  Aligned_cols=20  Identities=35%  Similarity=0.524  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+....
T Consensus       174 l~G~sG~GKSTll~~l~g~~  193 (301)
T 1u0l_A          174 MAGLSGVGKSSLLNAINPGL  193 (301)
T ss_dssp             EECSTTSSHHHHHHHHSTTC
T ss_pred             EECCCCCcHHHHHHHhcccc
Confidence            99999999999999997654

>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A*

Probab=94.50  E-value=0.014  Score=46.61  Aligned_cols=20  Identities=25%  Similarity=0.257  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|+|||+||+.+.+..
T Consensus       243 L~GppGtGKT~lAraia~~~  262 (489)
T 3hu3_A          243 LYGPPGTGKTLIARAVANET  262 (489)
T ss_dssp             EECSTTSSHHHHHHHHHHHC
T ss_pred             EECcCCCCHHHHHHHHHHHh
Confidence            99999999999999998854

>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A*

Probab=94.49  E-value=0.014  Score=44.72  Aligned_cols=20  Identities=30%  Similarity=0.338  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+.+..
T Consensus       128 I~GptGSGKTTlL~~l~g~~  147 (356)
T 3jvv_A          128 VTGPTGSGKSTTLAAMLDYL  147 (356)
T ss_dssp             EECSTTSCHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHhcc
Confidence            99999999999999987654

>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A*

Probab=94.47  E-value=0.016  Score=41.03  Aligned_cols=20  Identities=30%  Similarity=0.250  Sum_probs=16.9

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|.|..|+||||+|+.+-++
T Consensus         4 il~GpPGsGKgTqa~~La~~   23 (206)
T 3sr0_A            4 VFLGPPGAGKGTQAKRLAKE   23 (206)
T ss_dssp             EEECSTTSSHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHH
Confidence            36899999999999988654

>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}

Probab=94.45  E-value=0.012  Score=46.41  Aligned_cols=20  Identities=20%  Similarity=0.257  Sum_probs=19.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      +||..|+|||+||+.|.+..
T Consensus       221 LyGPPGTGKTlLAkAiA~e~  240 (437)
T 4b4t_I          221 LYGAPGTGKTLLAKAVANQT  240 (437)
T ss_dssp             EESSTTTTHHHHHHHHHHHH
T ss_pred             eECCCCchHHHHHHHHHHHh
Confidence            99999999999999999876

>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20

Probab=94.44  E-value=0.011  Score=42.37  Aligned_cols=22  Identities=14%  Similarity=-0.222  Sum_probs=18.6

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|+|..|+||||+|..+.+..
T Consensus        61 ili~GPPGtGKTt~a~ala~~l   82 (212)
T 1tue_A           61 LVFCGPANTGKSYFGMSFIHFI   82 (212)
T ss_dssp             EEEESCGGGCHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            4599999999999988877754

>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A*

Probab=94.44  E-value=0.015  Score=39.92  Aligned_cols=18  Identities=22%  Similarity=0.246  Sum_probs=15.1

Q ss_pred             CcCCCchhHHHHhhhhhh
Q 042811           93 GVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        93 GmGGvGKTTLak~v~~~~  110 (130)
                      +-||+||||++-.+-...
T Consensus         9 ~kgG~GKTt~a~~la~~l   26 (206)
T 4dzz_A            9 PKGGSGKTTAVINIATAL   26 (206)
T ss_dssp             SSTTSSHHHHHHHHHHHH
T ss_pred             CCCCccHHHHHHHHHHHH
Confidence            679999999998876554

>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus}

Probab=94.41  E-value=0.014  Score=47.39  Aligned_cols=20  Identities=20%  Similarity=0.091  Sum_probs=18.6

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+||||||+.+.+..
T Consensus        65 l~Gp~GtGKTtlar~ia~~l   84 (604)
T 3k1j_A           65 LIGEPGTGKSMLGQAMAELL   84 (604)
T ss_dssp             EECCTTSSHHHHHHHHHHTS
T ss_pred             EEeCCCCCHHHHHHHHhccC
Confidence            99999999999999998855

>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8

Probab=94.40  E-value=0.015  Score=41.01  Aligned_cols=20  Identities=30%  Similarity=0.164  Sum_probs=17.1

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|-+|+|||||+..+.+
T Consensus        40 VvlvG~~~vGKSSLl~r~~~   59 (211)
T 2g3y_A           40 VVLIGEQGVGKSTLANIFAG   59 (211)
T ss_dssp             EEEECCTTSSHHHHHHHHHC
T ss_pred             EEEECCCCCCHHHHHHHHHh
Confidence            44999999999999988753

>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E*

Probab=94.39  E-value=0.016  Score=45.90  Aligned_cols=22  Identities=23%  Similarity=0.129  Sum_probs=19.5

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.++|..|+||||||+.+.+..
T Consensus        53 iLl~GppGtGKT~lar~lA~~l   74 (444)
T 1g41_A           53 ILMIGPTGVGKTEIARRLAKLA   74 (444)
T ss_dssp             EEEECCTTSSHHHHHHHHHHHT
T ss_pred             EEEEcCCCCCHHHHHHHHHHHc
Confidence            4599999999999999998865

>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni}

Probab=94.38  E-value=0.017  Score=41.31  Aligned_cols=20  Identities=35%  Similarity=0.390  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+||||+|+.+-+.+
T Consensus        34 llGpPGsGKgTqa~~L~~~~   53 (217)
T 3umf_A           34 VLGGPGSGKGTQCEKLVQKF   53 (217)
T ss_dssp             EECCTTCCHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            89999999999999998765

>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana}

Probab=94.37  E-value=0.011  Score=45.37  Aligned_cols=21  Identities=19%  Similarity=0.134  Sum_probs=17.7

Q ss_pred             CCccccCcCCCchhHHHHhhh
Q 042811           87 GNNWPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        87 ~~l~I~GmGGvGKTTLak~v~  107 (130)
                      -++++.|.||+||||++|.+-
T Consensus        10 ~k~lllG~~~sGKsT~~kq~~   30 (354)
T 2xtz_A           10 RKLLLLGAGESGKSTIFKQIK   30 (354)
T ss_dssp             EEEEEECSTTSSHHHHHHHHH
T ss_pred             eeEEEECCCCCcHHHHHHHHH
Confidence            345699999999999999863

>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V

Probab=94.36  E-value=0.015  Score=44.74  Aligned_cols=20  Identities=30%  Similarity=0.202  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+....
T Consensus       220 lvG~sG~GKSTLln~L~g~~  239 (358)
T 2rcn_A          220 FAGQSGVGKSSLLNALLGLQ  239 (358)
T ss_dssp             EECCTTSSHHHHHHHHHCCS
T ss_pred             EECCCCccHHHHHHHHhccc
Confidence            99999999999999998754

>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium}

Probab=94.36  E-value=0.014  Score=45.99  Aligned_cols=20  Identities=30%  Similarity=0.195  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|+|||||++.|.+-.
T Consensus       162 IvG~sGsGKSTLl~~Iag~~  181 (438)
T 2dpy_A          162 LFAGSGVGKSVLLGMMARYT  181 (438)
T ss_dssp             EEECTTSSHHHHHHHHHHHS
T ss_pred             EECCCCCCHHHHHHHHhccc
Confidence            99999999999999998854

>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B*

Probab=94.36  E-value=0.017  Score=42.75  Aligned_cols=20  Identities=20%  Similarity=0.134  Sum_probs=17.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|..|+||||||+.+.+..
T Consensus        53 ~~G~~G~GKT~la~~la~~l   72 (324)
T 3u61_B           53 HSPSPGTGKTTVAKALCHDV   72 (324)
T ss_dssp             ECSSTTSSHHHHHHHHHHHT
T ss_pred             eeCcCCCCHHHHHHHHHHHh
Confidence            77889999999999998764

>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP}

Probab=94.35  E-value=0.016  Score=40.66  Aligned_cols=17  Identities=29%  Similarity=0.149  Sum_probs=14.1

Q ss_pred             CcCCCchhHHHHhhhhh
Q 042811           93 GVEGVGKITSLSKSYPE  109 (130)
Q Consensus        93 GmGGvGKTTLak~v~~~  109 (130)
                      +-||+||||++-.+-.-
T Consensus         8 ~KGGvGKTT~a~~LA~~   24 (209)
T 3cwq_A            8 FKGGVGKTTTAVHLSAY   24 (209)
T ss_dssp             SSTTSSHHHHHHHHHHH
T ss_pred             CCCCCcHHHHHHHHHHH
Confidence            67999999999887543

>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi}

Probab=94.35  E-value=0.01  Score=41.14  Aligned_cols=19  Identities=32%  Similarity=0.441  Sum_probs=16.9

Q ss_pred             cccCcCCCchhHHHHhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~  108 (130)
                      .|+|..|+|||||+..+.+
T Consensus        15 ~vvG~~~~GKSsli~~l~~   33 (218)
T 4djt_A           15 CLIGDGGVGKTTYINRVLD   33 (218)
T ss_dssp             EEECCTTSSHHHHHCBCTT
T ss_pred             EEECCCCCCHHHHHHHHhc
Confidence            4999999999999998774

>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A*

Probab=94.33  E-value=0.013  Score=42.71  Aligned_cols=21  Identities=24%  Similarity=0.325  Sum_probs=17.7

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..++..
T Consensus        11 I~vvG~~g~GKSTLin~L~~~   31 (274)
T 3t5d_A           11 LMVVGESGLGKSTLINSLFLT   31 (274)
T ss_dssp             EEEEECTTSSHHHHHHHHSSS
T ss_pred             EEEECCCCCCHHHHHHHHhCC
Confidence            349999999999999987654

>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major}

Probab=94.31  E-value=0.011  Score=39.95  Aligned_cols=20  Identities=20%  Similarity=0.258  Sum_probs=17.2

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|..|+|||||+..+.+
T Consensus        25 i~v~G~~~~GKssli~~l~~   44 (189)
T 2x77_A           25 VLMLGLDNAGKTSILYRLHL   44 (189)
T ss_dssp             EEEEEETTSSHHHHHHHTCC
T ss_pred             EEEECCCCCCHHHHHHHHHc
Confidence            34999999999999999854

>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A

Probab=94.31  E-value=0.024  Score=44.52  Aligned_cols=34  Identities=9%  Similarity=-0.019  Sum_probs=23.5

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEe
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVV  125 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~V  125 (130)
                      |+|-.|+|||||++.+-+........++++ .+-|
T Consensus       179 IvG~sG~GKTtLl~~Iar~i~~~~~~v~~I-~~lI  212 (422)
T 3ice_A          179 IVAPPKAGKTMLLQNIAQSIAYNHPDCVLM-VLLI  212 (422)
T ss_dssp             EECCSSSSHHHHHHHHHHHHHHHCTTSEEE-EEEE
T ss_pred             EecCCCCChhHHHHHHHHHHhhcCCCeeEE-EEEe
Confidence            999999999999999877552212345543 3433

>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C

Probab=94.27  E-value=0.008  Score=41.05  Aligned_cols=21  Identities=24%  Similarity=0.105  Sum_probs=2.7

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        23 i~v~G~~~~GKssli~~l~~~   43 (208)
T 2yc2_C           23 VAVVGEATVGKSALISMFTSK   43 (208)
T ss_dssp             EEEC-----------------
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            349999999999999987665

>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A

Probab=94.26  E-value=0.015  Score=41.73  Aligned_cols=21  Identities=19%  Similarity=0.151  Sum_probs=17.8

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        25 I~lvG~~g~GKStl~n~l~~~   45 (260)
T 2xtp_A           25 IILVGKTGTGKSAAGNSILRK   45 (260)
T ss_dssp             EEEEECTTSCHHHHHHHHHTS
T ss_pred             EEEECCCCCCHHHHHHHHhCC
Confidence            349999999999999998653

>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A*

Probab=94.24  E-value=0.016  Score=43.86  Aligned_cols=19  Identities=37%  Similarity=0.371  Sum_probs=17.1

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|+|||||++.+..-
T Consensus        60 i~G~~GaGKSTLl~~l~g~   78 (337)
T 2qm8_A           60 ITGVPGVGKSTTIDALGSL   78 (337)
T ss_dssp             EECCTTSCHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHh
Confidence            8999999999999998753

>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X

Probab=94.23  E-value=0.018  Score=42.86  Aligned_cols=19  Identities=37%  Similarity=0.351  Sum_probs=17.3

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|+|||||+..+...
T Consensus        13 IvG~~nvGKSTLln~L~g~   31 (301)
T 1ega_A           13 IVGRPNVGKSTLLNKLLGQ   31 (301)
T ss_dssp             EECSSSSSHHHHHHHHHTC
T ss_pred             EECCCCCCHHHHHHHHHCC
Confidence            9999999999999998664

>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae}

Probab=94.22  E-value=0.018  Score=40.23  Aligned_cols=21  Identities=33%  Similarity=0.289  Sum_probs=17.9

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        16 i~v~G~~~vGKSsli~~l~~~   36 (223)
T 3cpj_B           16 IVLIGDSGVGKSNLLSRFTKN   36 (223)
T ss_dssp             EEEESCTTSSHHHHHHHHHHC
T ss_pred             EEEECcCCCCHHHHHHHHhcC
Confidence            349999999999999987654

>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A*

Probab=94.21  E-value=0.018  Score=46.27  Aligned_cols=22  Identities=18%  Similarity=-0.000  Sum_probs=18.8

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++++|+.|.||||+++.+....
T Consensus        38 IvlvGlpGSGKSTia~~La~~L   59 (520)
T 2axn_A           38 IVMVGLPARGKTYISKKLTRYL   59 (520)
T ss_dssp             EEEECCTTSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
Confidence            3499999999999999986654

>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A*

Probab=94.19  E-value=0.038  Score=39.22  Aligned_cols=27  Identities=26%  Similarity=0.174  Sum_probs=22.1

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCe
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLI  119 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~  119 (130)
                      |-|..|+||||+++.+.+.. . ...+++
T Consensus        11 ~eG~~gsGKsT~~~~l~~~l-~-~~~~~v   37 (213)
T 4edh_A           11 LEGPEGAGKSTNRDYLAERL-R-ERGIEV   37 (213)
T ss_dssp             EECSTTSSHHHHHHHHHHHH-H-TTTCCE
T ss_pred             EEcCCCCCHHHHHHHHHHHH-H-HcCCCc
Confidence            78999999999999999877 4 245654

>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A

Probab=94.17  E-value=0.017  Score=45.46  Aligned_cols=20  Identities=35%  Similarity=0.409  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|.+|+||||++.++....
T Consensus       102 lvG~~GsGKTTt~~kLA~~l  121 (433)
T 3kl4_A          102 LVGVQGSGKTTTAGKLAYFY  121 (433)
T ss_dssp             ECCCTTSCHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            88999999999999988765

>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus}

Probab=94.16  E-value=0.017  Score=42.01  Aligned_cols=19  Identities=26%  Similarity=0.169  Sum_probs=17.1

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|+|||||...+.+.
T Consensus         8 lvG~~g~GKTTL~n~l~g~   26 (271)
T 3k53_A            8 LVGNPNVGKTTIFNALTGL   26 (271)
T ss_dssp             EEECSSSSHHHHHHHHHTT
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            8999999999999998664

>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A*

Probab=94.16  E-value=0.017  Score=44.30  Aligned_cols=19  Identities=26%  Similarity=0.230  Sum_probs=16.6

Q ss_pred             CccccCcCCCchhHHHHhh
Q 042811           88 NNWPFGVEGVGKITSLSKS  106 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v  106 (130)
                      +++|.|.||+||||++|.+
T Consensus        35 killlG~~~SGKST~~kq~   53 (362)
T 1zcb_A           35 KILLLGAGESGKSTFLKQM   53 (362)
T ss_dssp             EEEEECSTTSSHHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHHHH
Confidence            3459999999999999985

>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus}

Probab=94.15  E-value=0.018  Score=46.47  Aligned_cols=20  Identities=25%  Similarity=0.318  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+....
T Consensus        52 LvG~NGaGKSTLlk~l~Gl~   71 (538)
T 1yqt_A           52 IVGPNGTGKSTAVKILAGQL   71 (538)
T ss_dssp             EECCTTSSHHHHHHHHHTSS
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999988743

>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A

Probab=94.11  E-value=0.018  Score=45.28  Aligned_cols=20  Identities=30%  Similarity=0.428  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|.+|+||||++..+....
T Consensus       103 i~G~~GsGKTT~~~~LA~~l  122 (425)
T 2ffh_A          103 LVGLQGSGKTTTAAKLALYY  122 (425)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            88999999999999998766

>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B}

Probab=94.09  E-value=0.021  Score=41.35  Aligned_cols=20  Identities=30%  Similarity=0.348  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|+.|+||||+++.+.+..
T Consensus        13 ~~G~pGsGKsT~a~~L~~~~   32 (230)
T 3gmt_A           13 LLGAPGAGKGTQANFIKEKF   32 (230)
T ss_dssp             EECCTTSCHHHHHHHHHHHH
T ss_pred             eECCCCCCHHHHHHHHHHHh
Confidence            89999999999999987755

>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11

Probab=94.03  E-value=0.017  Score=43.97  Aligned_cols=20  Identities=25%  Similarity=0.159  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+....
T Consensus       136 I~G~~GsGKTTL~~~l~~~~  155 (349)
T 1pzn_A          136 VFGEFGSGKTQLAHTLAVMV  155 (349)
T ss_dssp             EEESTTSSHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            99999999999999987654

>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus}

Probab=93.98  E-value=0.02  Score=46.12  Aligned_cols=20  Identities=25%  Similarity=0.179  Sum_probs=18.6

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+....
T Consensus       317 i~G~NGsGKSTLlk~l~Gl~  336 (538)
T 1yqt_A          317 IVGPNGIGKTTFVKMLAGVE  336 (538)
T ss_dssp             EECCTTSSHHHHHHHHHTSS
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998854

>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6

Probab=93.97  E-value=0.013  Score=43.43  Aligned_cols=20  Identities=25%  Similarity=0.189  Sum_probs=14.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+||||+++.+.+.+
T Consensus        10 ItG~sGSGKSTva~~L~~~l   29 (290)
T 1a7j_A           10 VTGSSGAGTSTVKHTFDQIF   29 (290)
T ss_dssp             EESCC---CCTHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            88999999999999987754

>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1

Probab=93.95  E-value=0.021  Score=42.51  Aligned_cols=20  Identities=30%  Similarity=0.179  Sum_probs=17.5

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|.+|+|||||+..+.+.
T Consensus        11 ~ivG~~nvGKSTLln~l~g~   30 (301)
T 1wf3_A           11 AIVGKPNVGKSTLLNNLLGV   30 (301)
T ss_dssp             EEECSTTSSHHHHHHHHHTS
T ss_pred             EEECCCCCCHHHHHHHHhCC
Confidence            39999999999999997654

>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens}

Probab=93.01  E-value=0.01  Score=40.84  Aligned_cols=19  Identities=26%  Similarity=0.137  Sum_probs=16.3

Q ss_pred             cccCcCCCchhHHHHhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~  108 (130)
                      .|+|..|+|||||+..+.+
T Consensus        34 ~v~G~~~~GKSsli~~l~~   52 (204)
T 3th5_A           34 VVVGDGAVGKTCLLISYTT   52 (204)
Confidence            3999999999999977654

>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A

Probab=93.94  E-value=0.023  Score=43.21  Aligned_cols=20  Identities=20%  Similarity=0.167  Sum_probs=17.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||+..+...+
T Consensus         8 i~GptgsGKt~la~~La~~~   27 (322)
T 3exa_A            8 IVGPTAVGKTKTSVMLAKRL   27 (322)
T ss_dssp             EECCTTSCHHHHHHHHHHTT
T ss_pred             EECCCcCCHHHHHHHHHHhC
Confidence            89999999999999987654

>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus}

Probab=93.93  E-value=0.021  Score=46.12  Aligned_cols=20  Identities=30%  Similarity=0.335  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus       299 i~G~nGsGKSTLl~~l~Gl~  318 (538)
T 3ozx_A          299 ILGPNGIGKTTFARILVGEI  318 (538)
T ss_dssp             EECCTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            99999999999999998754

>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A*

Probab=93.92  E-value=0.022  Score=45.77  Aligned_cols=22  Identities=9%  Similarity=-0.221  Sum_probs=19.8

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      |++.|+.|+||||+++.+....
T Consensus       398 I~l~GlsGsGKSTIa~~La~~L  419 (511)
T 1g8f_A          398 IVLGNSLTVSREQLSIALLSTF  419 (511)
T ss_dssp             EEECTTCCSCHHHHHHHHHHHH
T ss_pred             EEecccCCCCHHHHHHHHHHHH
Confidence            3399999999999999998876

>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A*

Probab=93.92  E-value=0.055  Score=40.47  Aligned_cols=36  Identities=17%  Similarity=-0.008  Sum_probs=24.7

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhcc--C-CCCeEEEEEeC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDE--G-IFLIKMHDVVR  126 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~--~-~Fd~~~wv~VS  126 (130)
                      |+|..|+|||||+..+........  . .=..++|++..
T Consensus       112 i~G~~GsGKT~la~~la~~~~~~~~~gg~~~~vlyi~~e  150 (324)
T 2z43_A          112 FFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGKAVYIDTE  150 (324)
T ss_dssp             EEESTTSSHHHHHHHHHHHTTSCGGGTCCSCEEEEEESS
T ss_pred             EECCCCCCHhHHHHHHHHHHhcccccCCCCCeEEEEECC
Confidence            999999999999998876541110  0 02367787655

>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens}

Probab=93.91  E-value=0.021  Score=43.45  Aligned_cols=19  Identities=26%  Similarity=0.092  Sum_probs=17.2

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|+|||||+..+-..
T Consensus        79 lvG~pgaGKSTLln~L~~~   97 (349)
T 2www_A           79 LSGPPGAGKSTFIEYFGKM   97 (349)
T ss_dssp             EECCTTSSHHHHHHHHHHH
T ss_pred             EEcCCCCCHHHHHHHHHHH
Confidence            8999999999999998763

>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid}

Probab=93.89  E-value=0.019  Score=43.09  Aligned_cols=20  Identities=30%  Similarity=0.154  Sum_probs=17.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      .-|-||+||||+|..+--..
T Consensus        19 ~sgKGGvGKTTvA~~LA~~l   38 (324)
T 3zq6_A           19 IGGKGGVGKTTISAATALWM   38 (324)
T ss_dssp             EEESTTSSHHHHHHHHHHHH
T ss_pred             EeCCCCchHHHHHHHHHHHH
Confidence            77999999999999887655

>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A

Probab=93.88  E-value=0.023  Score=43.10  Aligned_cols=20  Identities=15%  Similarity=0.072  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||+..+....
T Consensus        15 i~GptgsGKt~la~~La~~~   34 (316)
T 3foz_A           15 LMGPTASGKTALAIELRKIL   34 (316)
T ss_dssp             EECCTTSCHHHHHHHHHHHS
T ss_pred             EECCCccCHHHHHHHHHHhC
Confidence            89999999999999998754

>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A

Probab=93.87  E-value=0.022  Score=41.02  Aligned_cols=20  Identities=30%  Similarity=0.054  Sum_probs=17.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      .-+-||+||||++-.+-.-.
T Consensus        33 ~s~kGGvGKTT~a~~LA~~l   52 (267)
T 3k9g_A           33 ASIKGGVGKSTSAIILATLL   52 (267)
T ss_dssp             CCSSSSSCHHHHHHHHHHHH
T ss_pred             EeCCCCchHHHHHHHHHHHH
Confidence            56899999999999887655

>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis}

Probab=93.85  E-value=0.0095  Score=41.41  Aligned_cols=21  Identities=19%  Similarity=0.075  Sum_probs=18.4

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus        32 i~v~G~~~~GKSslin~l~~~   52 (223)
T 4dhe_A           32 IAFAGRSNAGKSTAINVLCNQ   52 (223)
T ss_dssp             EEEEESCHHHHHHHHHHHTTC
T ss_pred             EEEEcCCCCCHHHHHHHHhCC
Confidence            449999999999999998765

>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A*

Probab=93.82  E-value=0.023  Score=42.29  Aligned_cols=19  Identities=32%  Similarity=0.282  Sum_probs=17.0

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|+|||||+..+.+.
T Consensus        15 ivG~~nvGKSTLin~l~g~   33 (308)
T 3iev_A           15 IVGKPNVGKSTLLNNLLGT   33 (308)
T ss_dssp             EECSTTSSHHHHHHHHHTS
T ss_pred             EECCCCCcHHHHHHHHhCC
Confidence            8999999999999987664

>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A*

Probab=93.78  E-value=0.023  Score=39.25  Aligned_cols=19  Identities=26%  Similarity=-0.001  Sum_probs=15.2

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|.-|+||||++..+...
T Consensus         8 i~G~~gsGKTT~ll~~~~~   26 (184)
T 2orw_A            8 ITGPMYSGKTTELLSFVEI   26 (184)
T ss_dssp             EEESTTSSHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHH
Confidence            8999999999998554443

>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A*

Probab=93.78  E-value=0.024  Score=40.90  Aligned_cols=20  Identities=30%  Similarity=0.260  Sum_probs=16.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      .-+-||+||||++-.+-.-.
T Consensus        24 ~s~kGGvGKTT~a~nLA~~l   43 (262)
T 2ph1_A           24 MSGKGGVGKSTVTALLAVHY   43 (262)
T ss_dssp             ECSSSCTTHHHHHHHHHHHH
T ss_pred             EcCCCCCCHHHHHHHHHHHH
Confidence            45789999999999987665

>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus}

Probab=93.77  E-value=0.023  Score=45.85  Aligned_cols=20  Identities=40%  Similarity=0.458  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+....
T Consensus        30 LiGpNGaGKSTLlkiL~Gl~   49 (538)
T 3ozx_A           30 VLGKNGVGKTTVLKILAGEI   49 (538)
T ss_dssp             EECCTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCcHHHHHHHHhcCC
Confidence            89999999999999988753

>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10

Probab=93.76  E-value=0.02  Score=43.25  Aligned_cols=19  Identities=32%  Similarity=0.148  Sum_probs=16.8

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|.+|+|||||+..+...
T Consensus        61 i~G~~g~GKSTl~~~l~~~   79 (341)
T 2p67_A           61 VTGTPGAGKSTFLEAFGML   79 (341)
T ss_dssp             EEECTTSCHHHHHHHHHHH
T ss_pred             EEcCCCCCHHHHHHHHHHH
Confidence            8999999999999998543

>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A*

Probab=93.67  E-value=0.026  Score=45.92  Aligned_cols=21  Identities=14%  Similarity=0.023  Sum_probs=18.9

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +|.|+.|+||||+|+.+....
T Consensus       400 ~l~GlsGSGKSTiA~~La~~L  420 (573)
T 1m8p_A          400 FLTGYMNSGKDAIARALQVTL  420 (573)
T ss_dssp             EEECSTTSSHHHHHHHHHHHH
T ss_pred             EeecCCCCCHHHHHHHHHHHh
Confidence            399999999999999998765

>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A*

Probab=93.65  E-value=0.025  Score=47.82  Aligned_cols=20  Identities=25%  Similarity=0.257  Sum_probs=18.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+|||+||+.|.+..
T Consensus       243 L~GPPGTGKT~LAraiA~el  262 (806)
T 3cf2_A          243 LYGPPGTGKTLIARAVANET  262 (806)
T ss_dssp             EECCTTSCHHHHHHHHHTTT
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            99999999999999999865

>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A*

Probab=93.65  E-value=0.025  Score=42.99  Aligned_cols=20  Identities=30%  Similarity=0.152  Sum_probs=17.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      +-|-||+||||+|..+--..
T Consensus        31 ~sgKGGvGKTTvA~~LA~~l   50 (349)
T 3ug7_A           31 FGGKGGVGKTTMSAATGVYL   50 (349)
T ss_dssp             EECSSSTTHHHHHHHHHHHH
T ss_pred             EeCCCCccHHHHHHHHHHHH
Confidence            77999999999998886655

>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A*

Probab=93.64  E-value=0.026  Score=46.50  Aligned_cols=22  Identities=27%  Similarity=0.359  Sum_probs=19.3

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|.|+.|+||||+|+.+....
T Consensus        55 IvLtGlsGSGKSTlAr~La~~L   76 (630)
T 1x6v_B           55 VWLTGLSGAGKTTVSMALEEYL   76 (630)
T ss_dssp             EEEECSTTSSHHHHHHHHHHHH
T ss_pred             EEEEeCCCCCHHHHHHHHHHHH
Confidence            4499999999999999997764

>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A*

Probab=93.64  E-value=0.026  Score=44.21  Aligned_cols=20  Identities=35%  Similarity=0.431  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+.+..
T Consensus       172 I~GpnGSGKTTlL~allg~l  191 (418)
T 1p9r_A          172 VTGPTGSGKSTTLYAGLQEL  191 (418)
T ss_dssp             EECSTTSCHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHhhc
Confidence            99999999999999987754

>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A*

Probab=93.64  E-value=0.048  Score=39.41  Aligned_cols=30  Identities=20%  Similarity=0.184  Sum_probs=23.9

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEE
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMH  122 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~w  122 (130)
                      |-|..|+||||+++.+.+.. . ...+..+..
T Consensus        32 ~eG~~GsGKsT~~~~l~~~l-~-~~~~~~~~~   61 (236)
T 3lv8_A           32 IEGLEGAGKSTAIQVVVETL-Q-QNGIDHITR   61 (236)
T ss_dssp             EEESTTSCHHHHHHHHHHHH-H-HTTCCCEEE
T ss_pred             EECCCCCCHHHHHHHHHHHH-H-hcCCCeeee
Confidence            99999999999999999877 4 346664443

>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae}

Probab=93.62  E-value=0.025  Score=45.82  Aligned_cols=20  Identities=25%  Similarity=0.170  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+..-.
T Consensus       374 ivG~sGsGKSTll~~l~g~~  393 (582)
T 3b5x_A          374 LVGRSGSGKSTIANLFTRFY  393 (582)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999987643

>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A*

Probab=93.61  E-value=0.024  Score=41.17  Aligned_cols=21  Identities=29%  Similarity=0.371  Sum_probs=18.2

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++|..|+|||||+..+.+..
T Consensus        43 ~vvG~~g~GKSSLin~l~~~~   63 (270)
T 1h65_A           43 LVMGKGGVGKSSTVNSIIGER   63 (270)
T ss_dssp             EEEESTTSSHHHHHHHHHTSC
T ss_pred             EEECCCCCCHHHHHHHHhCCC
Confidence            489999999999999987653

>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus}

Probab=93.61  E-value=0.025  Score=44.72  Aligned_cols=21  Identities=33%  Similarity=0.515  Sum_probs=18.5

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++|.+|+||||++.++....
T Consensus       104 livG~~G~GKTTt~~kLA~~l  124 (443)
T 3dm5_A          104 LMVGIQGSGKTTTVAKLARYF  124 (443)
T ss_dssp             EEECCTTSSHHHHHHHHHHHH
T ss_pred             EEECcCCCCHHHHHHHHHHHH
Confidence            389999999999999987765

>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A*

Probab=93.60  E-value=0.024  Score=44.42  Aligned_cols=19  Identities=21%  Similarity=0.151  Sum_probs=17.6

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|+|||||++.+..-
T Consensus        74 lvG~nGaGKSTLln~L~Gl   92 (413)
T 1tq4_A           74 VTGETGSGKSSFINTLRGI   92 (413)
T ss_dssp             EEECTTSSHHHHHHHHHTC
T ss_pred             EECCCCCcHHHHHHHHhCC
Confidence            8999999999999999873

>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B*

Probab=93.60  E-value=0.026  Score=46.23  Aligned_cols=20  Identities=25%  Similarity=0.179  Sum_probs=18.6

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+....
T Consensus       387 i~G~NGsGKSTLlk~l~Gl~  406 (607)
T 3bk7_A          387 IVGPNGIGKTTFVKMLAGVE  406 (607)
T ss_dssp             EECCTTSSHHHHHHHHHTSS
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999998854

>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A*

Probab=93.60  E-value=0.026  Score=45.12  Aligned_cols=20  Identities=25%  Similarity=0.315  Sum_probs=17.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        34 liG~nGsGKSTLl~~l~Gl~   53 (483)
T 3euj_A           34 LSGGNGAGKSTTMAGFVTAL   53 (483)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCcHHHHHHHHhcCC
Confidence            99999999999999987643

>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12

Probab=93.60  E-value=0.015  Score=41.87  Aligned_cols=20  Identities=25%  Similarity=0.326  Sum_probs=17.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.|..-.
T Consensus        32 i~GpnGsGKSTll~~i~g~~   51 (227)
T 1qhl_A           32 LSGGNGAGKSTTMAAFVTAL   51 (227)
T ss_dssp             HHSCCSHHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHhccc
Confidence            99999999999999986643

>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B*

Probab=93.57  E-value=0.026  Score=46.22  Aligned_cols=20  Identities=25%  Similarity=0.338  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+....
T Consensus       122 LiG~NGsGKSTLlkiL~Gll  141 (607)
T 3bk7_A          122 IVGPNGTGKTTAVKILAGQL  141 (607)
T ss_dssp             EECCTTSSHHHHHHHHTTSS
T ss_pred             EECCCCChHHHHHHHHhCCC
Confidence            99999999999999987744

>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum}

Probab=93.56  E-value=0.028  Score=39.68  Aligned_cols=18  Identities=11%  Similarity=-0.053  Sum_probs=15.7

Q ss_pred             CcCCCchhHHHHhhhhhh
Q 042811           93 GVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        93 GmGGvGKTTLak~v~~~~  110 (130)
                      +-||+||||++-.+-.-.
T Consensus        12 ~kGGvGKTt~a~~LA~~l   29 (245)
T 3ea0_A           12 AKGGDGGSCIAANFAFAL   29 (245)
T ss_dssp             SSTTSSHHHHHHHHHHHH
T ss_pred             CCCCcchHHHHHHHHHHH
Confidence            679999999999987765

>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A

Probab=93.54  E-value=0.024  Score=45.93  Aligned_cols=20  Identities=30%  Similarity=0.209  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+..-.
T Consensus       374 ivG~sGsGKSTLl~~l~g~~  393 (582)
T 3b60_A          374 LVGRSGSGKSTIASLITRFY  393 (582)
T ss_dssp             EEECTTSSHHHHHHHHTTTT
T ss_pred             EECCCCCCHHHHHHHHhhcc
Confidence            99999999999999987643

>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae}

Probab=93.51  E-value=0.027  Score=46.12  Aligned_cols=20  Identities=30%  Similarity=0.356  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus       108 LvGpNGaGKSTLLkiL~Gll  127 (608)
T 3j16_B          108 LVGTNGIGKSTALKILAGKQ  127 (608)
T ss_dssp             EECCTTSSHHHHHHHHHTSS
T ss_pred             EECCCCChHHHHHHHHhcCC
Confidence            99999999999999987754

>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A*

Probab=93.51  E-value=0.029  Score=39.27  Aligned_cols=18  Identities=28%  Similarity=0.333  Sum_probs=16.3

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |+|..|.|||||+..|+-
T Consensus        28 I~G~NgsGKStil~ai~~   45 (203)
T 3qks_A           28 IIGQNGSGKSSLLDAILV   45 (203)
T ss_dssp             EECCTTSSHHHHHHHHHH
T ss_pred             EEcCCCCCHHHHHHHHHH
Confidence            999999999999998753

>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A*

Probab=93.51  E-value=0.027  Score=41.85  Aligned_cols=21  Identities=24%  Similarity=0.265  Sum_probs=17.8

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.++|.+|+|||||...+.+.
T Consensus         6 I~lvG~~~vGKSSLi~~l~~~   26 (307)
T 3r7w_A            6 LLLMGRSGSGKSSMRSIIFSN   26 (307)
T ss_dssp             EEEECCTTSSHHHHHHHHHSC
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            348999999999999997654

>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8

Probab=93.47  E-value=0.0093  Score=44.92  Aligned_cols=20  Identities=40%  Similarity=0.511  Sum_probs=17.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+....
T Consensus       178 lvG~sG~GKSTLln~L~g~~  197 (307)
T 1t9h_A          178 FAGQSGVGKSSLLNAISPEL  197 (307)
T ss_dssp             EEESHHHHHHHHHHHHCC--
T ss_pred             EECCCCCCHHHHHHHhcccc
Confidence            99999999999999987643

>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii}

Probab=93.47  E-value=0.028  Score=42.94  Aligned_cols=20  Identities=35%  Similarity=0.321  Sum_probs=17.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      +-|.||+||||+|..+.-..
T Consensus        23 ~~gkGGvGKTt~a~~lA~~l   42 (348)
T 3io3_A           23 VGGKGGVGKTTTSSSVAVQL   42 (348)
T ss_dssp             EECSTTSSHHHHHHHHHHHH
T ss_pred             EeCCCCCcHHHHHHHHHHHH
Confidence            88999999999999887655

>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima}

Probab=93.41  E-value=0.047  Score=41.87  Aligned_cols=33  Identities=21%  Similarity=0.072  Sum_probs=23.9

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR  126 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS  126 (130)
                      |+|-.|+|||||+..+.... .. .. ..++|+...
T Consensus        66 I~GppGsGKSTLal~la~~~-~~-~g-g~VlyId~E   98 (356)
T 3hr8_A           66 IFGQESSGKTTLALHAIAEA-QK-MG-GVAAFIDAE   98 (356)
T ss_dssp             EEESTTSSHHHHHHHHHHHH-HH-TT-CCEEEEESS
T ss_pred             EECCCCCCHHHHHHHHHHHH-Hh-cC-CeEEEEecc
Confidence            99999999999999988765 21 12 245666543

>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A

Probab=93.38  E-value=0.029  Score=45.04  Aligned_cols=21  Identities=33%  Similarity=0.368  Sum_probs=17.9

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|.+|+|||||+.++-...
T Consensus       105 ~ivG~~GvGKTTl~~kLA~~l  125 (504)
T 2j37_W          105 MFVGLQGSGKTTTCSKLAYYY  125 (504)
T ss_dssp             EEECSTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHH
Confidence            389999999999999987544

>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1

Probab=93.37  E-value=0.029  Score=45.03  Aligned_cols=20  Identities=25%  Similarity=0.215  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+..-.
T Consensus       265 I~GptGSGKTTlL~aL~~~i  284 (511)
T 2oap_1          265 VVGETASGKTTTLNAIMMFI  284 (511)
T ss_dssp             EEESTTSSHHHHHHHHGGGS
T ss_pred             EECCCCCCHHHHHHHHHhhC
Confidence            99999999999999987654

>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis}

Probab=93.34  E-value=0.034  Score=39.91  Aligned_cols=20  Identities=25%  Similarity=0.207  Sum_probs=18.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |-|..|+||||+++.+.+..
T Consensus        26 ~~G~~g~GKst~~~~l~~~l   45 (223)
T 3ld9_A           26 FEGIDGSGKTTQSHLLAEYL   45 (223)
T ss_dssp             EECSTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            88999999999999998876

>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis}

Probab=93.34  E-value=0.027  Score=40.53  Aligned_cols=20  Identities=30%  Similarity=0.368  Sum_probs=15.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |-|..|+||||+++.+.+..
T Consensus        30 ~eG~~GsGKsT~~~~l~~~l   49 (227)
T 3v9p_A           30 FEGIDGAGKTTHLQWFCDRL   49 (227)
T ss_dssp             EECCC---CHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            88999999999999999877

>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12

Probab=93.33  E-value=0.027  Score=42.10  Aligned_cols=17  Identities=24%  Similarity=0.286  Sum_probs=16.6

Q ss_pred             ccCcCCCchhHHHHhhh
Q 042811           91 PFGVEGVGKITSLSKSY  107 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~  107 (130)
                      |+|..|.|||||+..|+
T Consensus        29 i~G~NGsGKS~ll~ai~   45 (322)
T 1e69_A           29 IVGPNGSGKSNIIDAIK   45 (322)
T ss_dssp             EECCTTTCSTHHHHHHH
T ss_pred             EECCCCCcHHHHHHHHH
Confidence            99999999999999998

>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens}

Probab=93.33  E-value=0.011  Score=40.48  Aligned_cols=20  Identities=30%  Similarity=0.317  Sum_probs=17.1

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||+..+.+.
T Consensus        37 ~vvG~~~~GKSsli~~l~~~   56 (199)
T 3l0i_B           37 LLIGDSGVGKSCLLLRFADD   56 (199)
T ss_dssp             EEECCTTSCCTTTTTSSBCC
T ss_pred             EEECCCCCCHHHHHHHHhcC
Confidence            39999999999999887653

>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A*

Probab=93.33  E-value=0.029  Score=40.60  Aligned_cols=21  Identities=29%  Similarity=0.382  Sum_probs=17.9

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+|||||+..+.+..
T Consensus        40 ~lvG~~g~GKSSLin~l~~~~   60 (262)
T 3def_A           40 LVLGKGGVGKSSTVNSLIGEQ   60 (262)
T ss_dssp             EEEECTTSSHHHHHHHHHTSC
T ss_pred             EEECCCCCCHHHHHHHHhCCC
Confidence            389999999999999987643

>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae}

Probab=93.32  E-value=0.03  Score=45.87  Aligned_cols=20  Identities=25%  Similarity=0.300  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus       383 iiG~NGsGKSTLlk~l~Gl~  402 (608)
T 3j16_B          383 MMGENGTGKTTLIKLLAGAL  402 (608)
T ss_dssp             EESCTTSSHHHHHHHHHTSS
T ss_pred             EECCCCCcHHHHHHHHhcCC
Confidence            99999999999999998754

>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1

Probab=93.30  E-value=0.051  Score=41.79  Aligned_cols=33  Identities=15%  Similarity=-0.083  Sum_probs=24.7

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR  126 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS  126 (130)
                      |+|-.|+||||||..+-....+  .. ..++|+...
T Consensus        79 I~G~pGsGKTtlal~la~~~~~--~g-~~vlyi~~E  111 (366)
T 1xp8_A           79 IYGPESGGKTTLALAIVAQAQK--AG-GTCAFIDAE  111 (366)
T ss_dssp             EEESTTSSHHHHHHHHHHHHHH--TT-CCEEEEESS
T ss_pred             EEcCCCCChHHHHHHHHHHHHH--CC-CeEEEEECC
Confidence            9999999999999887765522  22 357887765

>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis}

Probab=93.26  E-value=0.033  Score=46.32  Aligned_cols=22  Identities=23%  Similarity=0.148  Sum_probs=19.6

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.++|..|+|||+||+.+.+..
T Consensus       524 ~Ll~Gp~GtGKT~lA~ala~~l  545 (758)
T 3pxi_A          524 FIFLGPTGVGKTELARALAESI  545 (758)
T ss_dssp             EEEESCTTSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            3499999999999999998875

>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A*

Probab=93.25  E-value=0.033  Score=39.63  Aligned_cols=19  Identities=37%  Similarity=0.371  Sum_probs=15.9

Q ss_pred             cCcCCCchhHHHHhhhhhh
Q 042811           92 FGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        92 ~GmGGvGKTTLak~v~~~~  110 (130)
                      -+-||+||||++-.+-.-.
T Consensus         9 s~kgGvGKTt~a~~LA~~l   27 (260)
T 3q9l_A            9 SGKGGVGKTTSSAAIATGL   27 (260)
T ss_dssp             CSSTTSSHHHHHHHHHHHH
T ss_pred             CCCCCCcHHHHHHHHHHHH
Confidence            4679999999999887665

>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A

Probab=93.21  E-value=0.025  Score=45.76  Aligned_cols=20  Identities=25%  Similarity=0.225  Sum_probs=17.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+..-.
T Consensus       372 ivG~sGsGKSTll~~l~g~~  391 (578)
T 4a82_A          372 FVGMSGGGKSTLINLIPRFY  391 (578)
T ss_dssp             EECSTTSSHHHHHTTTTTSS
T ss_pred             EECCCCChHHHHHHHHhcCC
Confidence            99999999999999987643

>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A

Probab=93.19  E-value=0.1  Score=39.46  Aligned_cols=36  Identities=11%  Similarity=-0.187  Sum_probs=24.8

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccC---CCCeEEEEEeC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEG---IFLIKMHDVVR  126 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~---~Fd~~~wv~VS  126 (130)
                      |+|-.|+|||||+..+.........   .=..++|+...
T Consensus       127 I~G~~GsGKTtla~~la~~~~~~~~~gg~~~~vlyi~~E  165 (343)
T 1v5w_A          127 AFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTE  165 (343)
T ss_dssp             EECCTTCTHHHHHHHHHHHTTSCBTTTBCCCEEEEEESS
T ss_pred             EECCCCCCHHHHHHHHHHHHhcccccCCCCCeEEEEECC
Confidence            9999999999999988765311000   12367777665

>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima}

Probab=93.19  E-value=0.029  Score=45.64  Aligned_cols=20  Identities=25%  Similarity=0.278  Sum_probs=17.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+..-.
T Consensus       386 ivG~sGsGKSTll~~l~g~~  405 (598)
T 3qf4_B          386 LVGPTGSGKTTIVNLLMRFY  405 (598)
T ss_dssp             EECCTTSSTTHHHHHHTTSS
T ss_pred             EECCCCCcHHHHHHHHhcCc
Confidence            99999999999999987643

>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A*

Probab=93.16  E-value=0.034  Score=40.85  Aligned_cols=20  Identities=15%  Similarity=0.051  Sum_probs=17.6

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .++|-+|+|||||...+.+.
T Consensus         7 ~lvG~~nvGKSTL~n~L~g~   26 (272)
T 3b1v_A            7 ALIGNPNSGKTSLFNLITGH   26 (272)
T ss_dssp             EEECCTTSSHHHHHHHHHCC
T ss_pred             EEECCCCCCHHHHHHHHHCC
Confidence            38999999999999998764

>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe}

Probab=93.15  E-value=0.034  Score=41.88  Aligned_cols=20  Identities=30%  Similarity=0.248  Sum_probs=17.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      .-|-||+||||++-.+.-..
T Consensus        24 ~sgkGGvGKTTva~~LA~~l   43 (329)
T 2woo_A           24 VGGKGGVGKTTTSCSLAIQM   43 (329)
T ss_dssp             EECSSSSSHHHHHHHHHHHH
T ss_pred             EeCCCCCcHHHHHHHHHHHH
Confidence            77999999999999887665

>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii}

Probab=93.14  E-value=0.035  Score=39.03  Aligned_cols=18  Identities=33%  Similarity=0.372  Sum_probs=15.8

Q ss_pred             ccCcCCCchhHHHHhh-hh
Q 042811           91 PFGVEGVGKITSLSKS-YP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v-~~  108 (130)
                      |.|-.|+|||||+.++ ++
T Consensus        35 i~G~pG~GKT~l~l~~~~~   53 (251)
T 2zts_A           35 LTGGTGTGKTTFAAQFIYK   53 (251)
T ss_dssp             EECCTTSSHHHHHHHHHHH
T ss_pred             EEeCCCCCHHHHHHHHHHH
Confidence            9999999999999875 44

>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A*

Probab=93.14  E-value=0.034  Score=42.20  Aligned_cols=20  Identities=30%  Similarity=0.255  Sum_probs=17.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      +-|-||+||||++..+.-..
T Consensus        21 ~sgkGGvGKTt~a~~lA~~l   40 (334)
T 3iqw_A           21 VGGKGGVGKTTTSCSLAIQL   40 (334)
T ss_dssp             EECSTTSSHHHHHHHHHHHH
T ss_pred             EeCCCCccHHHHHHHHHHHH
Confidence            78999999999999887655

>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4}

Probab=93.11  E-value=0.071  Score=41.75  Aligned_cols=21  Identities=19%  Similarity=0.045  Sum_probs=19.1

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|..|+||||++..+-...
T Consensus        49 li~G~aGTGKT~ll~~~~~~l   69 (459)
T 3upu_A           49 TINGPAGTGATTLTKFIIEAL   69 (459)
T ss_dssp             EEECCTTSCHHHHHHHHHHHH
T ss_pred             EEEeCCCCCHHHHHHHHHHHH
Confidence            399999999999999988876

>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A*

Probab=93.08  E-value=0.031  Score=43.54  Aligned_cols=17  Identities=24%  Similarity=0.090  Sum_probs=15.5

Q ss_pred             ccCcCCCchhHHHHhhh
Q 042811           91 PFGVEGVGKITSLSKSY  107 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~  107 (130)
                      |+|-.|+|||||+..+.
T Consensus       183 I~G~sGsGKTTLl~~la  199 (400)
T 3lda_A          183 LFGEFRTGKSQLCHTLA  199 (400)
T ss_dssp             EEESTTSSHHHHHHHHH
T ss_pred             EEcCCCCChHHHHHHHH
Confidence            99999999999999654

>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1

Probab=93.08  E-value=0.035  Score=43.27  Aligned_cols=20  Identities=25%  Similarity=0.184  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+....
T Consensus       185 ivG~~gvGKSTLln~l~g~~  204 (439)
T 1mky_A          185 IVGRPNVGKSTLFNAILNKE  204 (439)
T ss_dssp             EECSTTSSHHHHHHHHHTST
T ss_pred             EECCCCCCHHHHHHHHhCCc
Confidence            99999999999999987653

>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A*

Probab=93.04  E-value=0.04  Score=38.78  Aligned_cols=20  Identities=35%  Similarity=0.501  Sum_probs=17.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |=|.-|+||||+++.+.+..
T Consensus         7 ~EG~dGsGKsTq~~~L~~~L   26 (205)
T 4hlc_A            7 FEGPEGSGKTTVINEVYHRL   26 (205)
T ss_dssp             EECCTTSCHHHHHHHHHHHH
T ss_pred             EECCCCCcHHHHHHHHHHHH
Confidence            45899999999999988765

>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A

Probab=93.01  E-value=0.038  Score=40.48  Aligned_cols=19  Identities=21%  Similarity=0.113  Sum_probs=16.1

Q ss_pred             cCcCCCchhHHHHhhhhhh
Q 042811           92 FGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        92 ~GmGGvGKTTLak~v~~~~  110 (130)
                      -+-||+||||++..+..-.
T Consensus        11 s~KGGvGKTT~a~nLA~~L   29 (286)
T 2xj4_A           11 NEKGGAGKSTIAVHLVTAL   29 (286)
T ss_dssp             CSSSCTTHHHHHHHHHHHH
T ss_pred             cCCCCCCHHHHHHHHHHHH
Confidence            3689999999999987765

>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii}

Probab=93.01  E-value=0.036  Score=42.01  Aligned_cols=21  Identities=29%  Similarity=0.086  Sum_probs=18.1

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+|||||+..+.+..
T Consensus       171 ~lvG~~gvGKSTLin~L~~~~  191 (357)
T 2e87_A          171 VIAGHPNVGKSTLLKALTTAK  191 (357)
T ss_dssp             EEECSTTSSHHHHHHHHCSSC
T ss_pred             EEECCCCCCHHHHHHHHhCCC
Confidence            399999999999999987643

>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A*

Probab=92.98  E-value=0.039  Score=38.78  Aligned_cols=19  Identities=26%  Similarity=0.272  Sum_probs=16.0

Q ss_pred             cCcCCCchhHHHHhhhhhh
Q 042811           92 FGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        92 ~GmGGvGKTTLak~v~~~~  110 (130)
                      -+-||+||||++-.+-.-.
T Consensus         9 s~kgGvGKTt~a~~LA~~l   27 (237)
T 1g3q_A            9 SGKGGTGKTTVTANLSVAL   27 (237)
T ss_dssp             CSSTTSSHHHHHHHHHHHH
T ss_pred             cCCCCCCHHHHHHHHHHHH
Confidence            3579999999999987765

>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes}

Probab=92.97  E-value=0.033  Score=40.73  Aligned_cols=18  Identities=22%  Similarity=-0.123  Sum_probs=15.4

Q ss_pred             CcCCCchhHHHHhhhhhh
Q 042811           93 GVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        93 GmGGvGKTTLak~v~~~~  110 (130)
                      +-||+||||++-.+-.-.
T Consensus        44 ~KGGvGKTT~a~nLA~~l   61 (298)
T 2oze_A           44 FKGGVGKSKLSTMFAYLT   61 (298)
T ss_dssp             SSSSSSHHHHHHHHHHHH
T ss_pred             CCCCchHHHHHHHHHHHH
Confidence            489999999999987655

>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A

Probab=92.95  E-value=0.039  Score=42.49  Aligned_cols=20  Identities=25%  Similarity=0.189  Sum_probs=17.5

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||...+.+.
T Consensus         5 ~IVG~pnvGKSTL~n~L~~~   24 (368)
T 2dby_A            5 GIVGLPNVGKSTLFNALTRA   24 (368)
T ss_dssp             EEECCSSSSHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHhCC
Confidence            38999999999999998664

>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima}

Probab=92.89  E-value=0.033  Score=45.25  Aligned_cols=20  Identities=25%  Similarity=0.215  Sum_probs=17.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+..-.
T Consensus       374 ivG~sGsGKSTll~~l~g~~  393 (587)
T 3qf4_A          374 VLGETGSGKSTLMNLIPRLI  393 (587)
T ss_dssp             EECSSSSSHHHHHHTTTTSS
T ss_pred             EECCCCCCHHHHHHHHhCCc
Confidence            99999999999999987643

>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila}

Probab=92.86  E-value=0.038  Score=40.11  Aligned_cols=21  Identities=19%  Similarity=0.148  Sum_probs=17.9

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.++|-.|+|||||...+.+.
T Consensus         4 I~lvG~~n~GKSTL~n~L~g~   24 (256)
T 3iby_A            4 ALLIGNPNCGKTTLFNALTNA   24 (256)
T ss_dssp             EEEEESTTSSHHHHHHHHHTT
T ss_pred             EEEECCCCCCHHHHHHHHHCC
Confidence            347899999999999998765

>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans}

Probab=92.84  E-value=0.04  Score=42.26  Aligned_cols=18  Identities=33%  Similarity=0.608  Sum_probs=17.1

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |+|..|.|||||+..|+-
T Consensus        31 i~G~nG~GKttll~ai~~   48 (359)
T 2o5v_A           31 IYGENGAGKTNLLEAAYL   48 (359)
T ss_dssp             EECCTTSSHHHHHHHHHH
T ss_pred             EECCCCCChhHHHHHHHH
Confidence            999999999999999984

>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A

Probab=92.82  E-value=0.044  Score=39.79  Aligned_cols=20  Identities=20%  Similarity=0.120  Sum_probs=17.4

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .++|-.|+|||||...+.+.
T Consensus         9 ~lvG~~nvGKTsL~n~l~g~   28 (258)
T 3a1s_A            9 ALAGCPNVGKTSLFNALTGT   28 (258)
T ss_dssp             EEECCTTSSHHHHHHHHHTT
T ss_pred             EEECCCCCCHHHHHHHHHCC
Confidence            38999999999999998663

>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A*

Probab=92.81  E-value=0.035  Score=42.30  Aligned_cols=20  Identities=35%  Similarity=0.265  Sum_probs=17.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      .-|-||+||||++-.+--..
T Consensus        23 ~sgKGGvGKTTvaanLA~~l   42 (354)
T 2woj_A           23 VGGKGGVGKTTSSCSIAIQM   42 (354)
T ss_dssp             EEESTTSSHHHHHHHHHHHH
T ss_pred             EeCCCCCcHHHHHHHHHHHH
Confidence            67999999999998877655

>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12

Probab=92.81  E-value=0.041  Score=42.74  Aligned_cols=19  Identities=21%  Similarity=0.183  Sum_probs=17.3

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|..|.|||||+..|+--
T Consensus        31 i~G~nG~GKstll~ai~~~   49 (430)
T 1w1w_A           31 IIGPNGSGKSNMMDAISFV   49 (430)
T ss_dssp             EECSTTSSHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHhh
Confidence            9999999999999998753

>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A*

Probab=92.80  E-value=0.035  Score=44.33  Aligned_cols=16  Identities=25%  Similarity=0.183  Sum_probs=15.2

Q ss_pred             ccCcCCCchhHHHHhh
Q 042811           91 PFGVEGVGKITSLSKS  106 (130)
Q Consensus        91 I~GmGGvGKTTLak~v  106 (130)
                      |+|..|+|||||++.+
T Consensus        44 l~G~nGsGKSTL~~~~   59 (525)
T 1tf7_A           44 VSGTSGTGKTLFSIQF   59 (525)
T ss_dssp             EEESTTSSHHHHHHHH
T ss_pred             EEcCCCCCHHHHHHHH
Confidence            9999999999999994

>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima}

Probab=92.80  E-value=0.047  Score=38.15  Aligned_cols=20  Identities=25%  Similarity=0.280  Sum_probs=16.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |=|.-|+||||+++.+.+..
T Consensus         5 ~EG~DGsGKsTq~~~L~~~L   24 (197)
T 3hjn_A            5 FEGIDGSGKSTQIQLLAQYL   24 (197)
T ss_dssp             EECSTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            34889999999999987654

---

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Length	Definition	Probability
Query	130
d2a5yb3	277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	99.57
d1kaga_	169	Shikimate kinase (AroK) {Escherichia coli [TaxId:	97.84
d1fnna2	276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	97.77
d1m8pa3	183	ATP sulfurylase C-terminal domain {Fungus (Penicil	97.6
d1ixsb2	239	Holliday junction helicase RuvB {Thermus thermophi	97.58
d1rkba_	173	Adenylate kinase {Human (Homo sapiens), isoenzyme	97.52
d2fnaa2	283	Archaeal ATPase SSO1545 {Sulfolobus solfataricus [	97.52
d1lw7a2	192	Transcriptional regulator NadR, ribosylnicotinamid	97.52
d1e6ca_	170	Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax	97.49
d1in4a2	238	Holliday junction helicase RuvB {Thermotoga mariti	97.48
d1viaa_	161	Shikimate kinase (AroK) {Campylobacter jejuni [Tax	97.47
d1ly1a_	152	Polynucleotide kinase, kinase domain {Bacteriophag	97.45
d1w5sa2	287	CDC6-like protein APE0152, N-terminal domain {Aero	97.45
d2iyva1	165	Shikimate kinase (AroK) {Mycobacterium tuberculosi	97.44
d2bdta1	176	Hypothetical protein BH3686 {Bacillus halodurans [	97.35
d2i3ba1	189	Cancer-related NTPase, C1orf57 {Human (Homo sapien	97.34
d1y63a_	174	Probable kinase LmjF30.1890 {Leishmania major [Tax	97.33
d1np6a_	170	Molybdopterin-guanine dinucleotide biosynthesis pr	97.27
d1x6va3	195	Adenosine-5'phosphosulfate kinase (APS kinase) {Hu	97.26
d1bifa1	213	6-phosphofructo-2-kinase/fructose-2,6-bisphosphata	97.16
d1sxjd2	237	Replication factor C2 {Baker's yeast (Saccharomyce	97.11
d1qhxa_	178	Chloramphenicol phosphotransferase {Streptomyces v	97.06
d1gvnb_	273	Plasmid maintenance system epsilon/zeta, toxin zet	97.05
d1m7ga_	208	Adenosine-5'phosphosulfate kinase (APS kinase) {Fu	97.03
d1knqa_	171	Gluconate kinase {Escherichia coli [TaxId: 562]}	97.03
d1sxjb2	224	Replication factor C4 {Baker's yeast (Saccharomyce	97.03
d1sxje2	252	Replication factor C5 {Baker's yeast (Saccharomyce	97.0
d1ye8a1	178	Hypothetical kinase-like protein Aq_1292 {Aquifex	96.98
d1yj5a2	172	5' polynucleotide kinase-3' phosphatase, C-termina	96.97
d1khta_	190	Adenylate kinase {Archaeon Methanococcus voltae [T	96.94
d1zp6a1	176	Hypothetical protein Atu3015 {Agrobacterium tumefa	96.89
d1l8qa2	213	Chromosomal replication initiation factor DnaA {Aq	96.87
d1xjca_	165	Molybdopterin-guanine dinucleotide biosynthesis pr	96.82
d1nksa_	194	Adenylate kinase {Archaeon Sulfolobus acidocaldari	96.78
d1sxja2	253	Replication factor C1 {Baker's yeast (Saccharomyce	96.71
d1zina1	182	Adenylate kinase {Bacillus stearothermophilus [Tax	96.71
d1qf9a_	194	UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4	96.7
d1rz3a_	198	Hypothetical protein rbstp0775 {Bacillus stearothe	96.67
d1iqpa2	231	Replication factor C {Archaeon Pyrococcus furiosus	96.66
d2cdna1	181	Adenylate kinase {Mycobacterium tuberculosis [TaxI	96.66
d1r6bx2	268	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	96.66
d1s3ga1	182	Adenylate kinase {Bacillus globisporus [TaxId: 145	96.63
d1zaka1	189	Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	96.62
d2ak3a1	189	Adenylate kinase {Cow (Bos taurus), mitochondrial	96.61
d1ukza_	196	Uridylate kinase {Baker's yeast (Saccharomyces cer	96.6
d1cp2a_	269	Nitrogenase iron protein {Clostridium pasteurianum	96.6
d1sxjc2	227	Replication factor C3 {Baker's yeast (Saccharomyce	96.52
d1r8sa_	160	ADP-ribosylation factor {Human (Homo sapiens), ARF	96.51
d1jbka_	195	ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	96.49
d1lvga_	190	Guanylate kinase {Mouse (Mus musculus) [TaxId: 100	96.4
d2afhe1	289	Nitrogenase iron protein {Azotobacter vinelandii [	96.4
d1ofha_	309	HslU {Haemophilus influenzae [TaxId: 727]}	96.4
d1teva_	194	UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]	96.38
d1upta_	169	ADP-ribosylation factor {Human (Homo sapiens), ARL	96.36
d1akya1	180	Adenylate kinase {Baker's yeast (Saccharomyces cer	96.34
d1gkya_	186	Guanylate kinase {Baker's yeast (Saccharomyces cer	96.33
d1ckea_	225	CMP kinase {Escherichia coli [TaxId: 562]}	96.32
d1ak2a1	190	Adenylate kinase {Cow (Bos taurus), mitochondrial	96.3
d1z06a1	165	Rab-33b {Mouse (Mus musculus) [TaxId: 10090]}	96.3
d1sgwa_	200	Putative ABC transporter PF0895 {Pyrococcus furios	96.27
d1qvra2	387	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	96.27
d1d2na_	246	Hexamerization domain of N-ethylmalemide-sensitive	96.23
d1e4va1	179	Adenylate kinase {Escherichia coli [TaxId: 562]}	96.23
d1r7ra3	265	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	96.23
d1uj2a_	213	Uridine-cytidine kinase 2 {Human (Homo sapiens) [T	96.19
d1ihua1	296	Arsenite-translocating ATPase ArsA {Escherichia co	96.16
d1kgda_	178	Guanylate kinase-like domain of Cask {Human (Homo	96.15
d2vp4a1	197	Deoxyribonucleoside kinase {Fruit fly (Drosophila	96.13
d1ksha_	165	ADP-ribosylation factor {Mouse (Mus musculus), ARL	96.1
d1znwa1	182	Guanylate kinase {Mycobacterium tuberculosis [TaxI	96.08
d1l2ta_	230	MJ0796 {Archaeon Methanococcus jannaschii [TaxId:	96.03
d1ihua2	279	Arsenite-translocating ATPase ArsA {Escherichia co	96.0
d3dhwc1	240	Methionine import ATP-binding protein MetN {Escher	96.0
d2awna2	232	Maltose transport protein MalK, N-terminal domain	95.99
d1tf7a2	242	Circadian clock protein KaiC {Synechococcus sp. st	95.98
d1jj7a_	251	Peptide transporter Tap1, C-terminal ABC domain {H	95.98
d1f6ba_	186	SAR1 {Chinese hamster (Cricetulus griseus) [TaxId:	95.95
d1v43a3	239	Hypothetical protein PH0022, N-terminal domain {Py	95.93
d2onka1	240	Molybdate/tungstate import ATP-binding protein Wtp	95.9
d2a5ja1	173	Rab2b {Human (Homo sapiens) [TaxId: 9606]}	95.89
d2ew1a1	171	Rab30 {Human (Homo sapiens) [TaxId: 9606]}	95.88
d1g2912	240	Maltose transport protein MalK, N-terminal domain	95.85
d3b60a1	253	Multidrug resistance ABC transporter MsbA, C-termi	95.85
d1yrba1	244	ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss	95.85
d1q3ta_	223	CMP kinase {Streptococcus pneumoniae [TaxId: 1313]	95.84
d3raba_	169	Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]}	95.83
d1fzqa_	176	ADP-ribosylation factor {Mouse (Mus musculus), ARL	95.83
d1z2aa1	164	Rab23 {Mouse (Mus musculus) [TaxId: 10090]}	95.83
d2pmka1	241	Haemolysin B ATP-binding protein {Escherichia coli	95.82
d1mv5a_	242	Multidrug resistance ABC transporter LmrA, C-termi	95.81
d2gjsa1	168	Rad {Human (Homo sapiens) [TaxId: 9606]}	95.81
d1zcba2	200	Transducin (alpha subunit) {Mouse (Mus musculus) [	95.8
d2erxa1	171	di-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	95.78
d1ixza_	247	AAA domain of cell division protein FtsH {Thermus	95.75
d1yzqa1	164	Rab6 {Human (Homo sapiens) [TaxId: 9606]}	95.75
d1svsa1	195	Transducin (alpha subunit) {Rat (Rattus norvegicus	95.75
d1z0fa1	166	Rab14 {Human (Homo sapiens) [TaxId: 9606]}	95.71
d1r0wa_	281	Cystic fibrosis transmembrane conductance regulato	95.71
d1b0ua_	258	ATP-binding subunit of the histidine permease {Sal	95.7
d1z0ja1	167	Rab-22a {Mouse (Mus musculus) [TaxId: 10090]}	95.69
d3adka_	194	Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	95.68
d1z08a1	167	Rab21 {Human (Homo sapiens) [TaxId: 9606]}	95.65
d1r2qa_	170	Rab5a {Human (Homo sapiens) [TaxId: 9606]}	95.57
d1gsia_	208	Thymidylate kinase {Mycobacterium tuberculosis [Ta	95.56
d1uf9a_	191	Dephospho-CoA kinase {Thermus thermophilus [TaxId:	95.54
d2erya1	171	r-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	95.53
d2hyda1	255	Putative multidrug export ATP-binding/permease pro	95.52
d2qtvb1	166	SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta	95.51
d1byia_	224	Dethiobiotin synthetase {Escherichia coli [TaxId:	95.48
d1ky3a_	175	Rab-related protein ypt7p {Baker's yeast (Saccharo	95.47
d1mkya1	171	Probable GTPase Der, N-terminal and middle domains	95.46
d1p5zb_	241	Deoxycytidine kinase {Human (Homo sapiens) [TaxId:	95.45
d1g16a_	166	Rab-related protein Sec4 {Baker's yeast (Saccharom	95.45
d2bmea1	174	Rab4a {Human (Homo sapiens) [TaxId: 9606]}	95.45
d1lv7a_	256	AAA domain of cell division protein FtsH {Escheric	95.45
d1s96a_	205	Guanylate kinase {Escherichia coli [TaxId: 562]}	95.42
d2fn4a1	173	r-Ras {Human (Homo sapiens) [TaxId: 9606]}	95.39
d1zj6a1	177	ADP-ribosylation factor {Human (Homo sapiens), ARL	95.38
d1qhla_	222	Cell division protein MukB {Escherichia coli [TaxI	95.37
d2atva1	168	Ras-like estrogen-regulated growth inhibitor, RERG	95.37
d1c1ya_	167	Rap1A {Human (Homo sapiens) [TaxId: 9606]}	95.33
d1vpla_	238	Putative ABC transporter TM0544 {Thermotoga mariti	95.33
d1mh1a_	183	Rac {Human (Homo sapiens) [TaxId: 9606]}	95.32
d2bcgy1	194	GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi	95.31
d1nn5a_	209	Thymidylate kinase {Human (Homo sapiens) [TaxId: 9	95.3
d1x3sa1	177	Rab18 {Human (Homo sapiens) [TaxId: 9606]}	95.3
d2f7sa1	186	Rab27b {Human (Homo sapiens) [TaxId: 9606]}	95.28
d3d31a2	229	Sulfate/molybdate ABC transporter, ATP-binding pro	95.26
d1e32a2	258	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	95.26
d1kmqa_	177	RhoA {Human (Homo sapiens) [TaxId: 9606]}	95.26
d1ji0a_	240	Branched chain aminoacid ABC transporter {Thermoto	95.25
d2ocpa1	241	Deoxyguanosine kinase {Human (Homo sapiens) [TaxId	95.23
d1kaoa_	167	Rap2a {Human (Homo sapiens) [TaxId: 9606]}	95.23
d1l7vc_	231	ABC transporter involved in vitamin B12 uptake, Bt	95.21
d1szpa2	251	DNA repair protein Rad51, catalytic domain {Baker'	95.2
d2g3ya1	172	GTP-binding protein GEM {Human (Homo sapiens) [Tax	95.18
d1ctqa_	166	cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9	95.18
d2f9la1	175	Rab11b {Human (Homo sapiens) [TaxId: 9606]}	95.17
d1e0sa_	173	ADP-ribosylation factor {Human (Homo sapiens), ARF	95.13
d1g6ha_	254	MJ1267 {Archaeon Methanococcus jannaschii [TaxId:	95.13
d1udxa2	180	Obg GTP-binding protein middle domain {Thermus the	95.13
d1vg8a_	184	Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]}	95.12
d2bcjq2	200	Transducin (alpha subunit) {Mouse (Mus musculus) [	95.12
d1egaa1	179	GTPase Era, N-terminal domain {Escherichia coli [T	95.12
d1xtqa1	167	GTP-binding protein RheB {Human (Homo sapiens) [Ta	95.11
d1ek0a_	170	Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T	95.1
d1zd9a1	164	ADP-ribosylation factor {Human (Homo sapiens), ARL	95.1
d2atxa1	185	RhoQ {Human (Homo sapiens) [TaxId: 9606]}	95.09
d1azta2	221	Transducin (alpha subunit) {Cow (Bos taurus) [TaxI	95.07
d1i2ma_	170	Ran {Human (Homo sapiens) [TaxId: 9606]}	95.06
d1moza_	182	ADP-ribosylation factor {Baker's yeast (Saccharomy	95.06
d1ls1a2	207	GTPase domain of the signal sequence recognition p	95.06
d1hyqa_	232	Cell division regulator MinD {Archaeon Archaeoglob	94.99
d1x1ra1	169	Ras-related protein M-Ras (XRas) {Mouse (Mus muscu	94.98
g1f2t.1	292	Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	94.97
d1nija1	222	Hypothetical protein YjiA, N-terminal domain {Esch	94.96
d1wf3a1	178	GTPase Era, N-terminal domain {Thermus thermophilu	94.95
d1svia_	195	Probable GTPase EngB {Bacillus subtilis [TaxId: 14	94.95
d1oxxk2	242	Glucose transport protein GlcV, N-terminal domain	94.94
d2cxxa1	184	GTP-binding protein engB {Pyrococcus horikoshii [T	94.94
d1sq5a_	308	Pantothenate kinase PanK {Escherichia coli [TaxId:	94.94
d1nrjb_	209	Signal recognition particle receptor beta-subunit	94.92
d1okkd2	207	GTPase domain of the signal recognition particle r	94.86
d2fh5b1	207	Signal recognition particle receptor beta-subunit	94.84
d1njfa_	239	delta prime subunit of DNA polymerase III, N-domai	94.8
d1m7ba_	179	RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]}	94.74
d1u8za_	168	Ras-related protein RalA {Cotton-top tamarin (Sagu	94.74
d1w44a_	321	NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]}	94.66
g1ii8.1	369	Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	94.66
d4tmka_	210	Thymidylate kinase {Escherichia coli [TaxId: 562]}	94.65
d1puia_	188	Probable GTPase EngB {Escherichia coli [TaxId: 562	94.64
d1n0wa_	242	DNA repair protein Rad51, catalytic domain {Human	94.63
d1vmaa2	213	GTPase domain of the signal recognition particle r	94.57
d2bmja1	175	Centaurin gamma 1, G domain {Human (Homo sapiens)	94.54
d2g6ba1	170	Rab26 {Human (Homo sapiens) [TaxId: 9606]}	94.53
d1wmsa_	174	Rab9a {Human (Homo sapiens) [TaxId: 9606]}	94.51
d1nlfa_	274	Hexameric replicative helicase repA {Escherichia c	94.51
d1g3qa_	237	Cell division regulator MinD {Archaeon Pyrococcus	94.51
d1lnza2	185	Obg GTP-binding protein middle domain {Bacillus su	94.45
d1a5ta2	207	delta prime subunit of DNA polymerase III, N-domai	94.38
d1mkya2	186	Probable GTPase Der, N-terminal and middle domains	94.38
d2gj8a1	161	Probable tRNA modification GTPase TrmE (MnmE), G d	94.31
d1v5wa_	258	Meiotic recombination protein DMC1/LIM15 homolog {	94.26
d1g8pa_	333	ATPase subunit of magnesium chelatase, BchI {Rhodo	94.22
d1pzna2	254	DNA repair protein Rad51, catalytic domain {Archae	94.17
d2fu5c1	173	Rab8a {Mouse (Mus musculus) [TaxId: 10090]}	94.13
d1svma_	362	Papillomavirus large T antigen helicase domain {Si	94.05
d1t9ha2	231	Probable GTPase EngC (YjeQ), C-terminal domain {Ba	93.97
d2ngra_	191	CDC42 {Human (Homo sapiens) [TaxId: 9606]}	93.93
d1tmka_	214	Thymidylate kinase {Baker's yeast (Saccharomyces c	93.82
d1u0la2	225	Probable GTPase EngC (YjeQ), C-terminal domain {Th	93.77
d1g41a_	443	HslU {Haemophilus influenzae [TaxId: 727]}	93.77
d1w36d1	359	Exodeoxyribonuclease V alpha chain (RecD) {Escheri	93.76
d1g6oa_	323	Hexameric traffic ATPase, HP0525 {Helicobacter pyl	93.73
d1odfa_	286	Hypothetical protein Ygr205W {Baker's yeast (Sacch	93.73
d2qy9a2	211	GTPase domain of the signal recognition particle r	93.7
d1j8yf2	211	GTPase domain of the signal sequence recognition p	93.68
d1xzpa2	160	TrmE GTPase domain {Thermotoga maritima [TaxId: 23	93.52
g1xew.1	329	Smc head domain {Pyrococcus furiosus [TaxId: 2261]	93.43
d1r6bx3	315	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	93.41
d1htwa_	158	Hypothetical protein HI0065 {Haemophilus influenza	93.38
d1tf7a1	242	Circadian clock protein KaiC {Synechococcus sp. st	93.37
d1p6xa_	333	Thymidine kinase {Equine herpesvirus type 4 [TaxId	93.33
d2i1qa2	258	DNA repair protein Rad51, catalytic domain {Archae	93.13
d1a7ja_	288	Phosphoribulokinase {Rhodobacter sphaeroides [TaxI	92.91
d1h65a_	257	Chloroplast protein translocon GTPase Toc34 {Garde	92.76
d1vhta_	208	Dephospho-CoA kinase {Escherichia coli [TaxId: 562	92.65
d2qm8a1	323	Metallochaperone MeaB {Methylobacterium extorquens	92.63
d1um8a_	364	ClpX {Helicobacter pylori [TaxId: 210]}	92.58
d1cr2a_	277	Gene 4 protein (g4p, DNA primase), helicase domain	92.48
d1jjva_	205	Dephospho-CoA kinase {Haemophilus influenzae [TaxI	92.18
d2p67a1	327	LAO/AO transport system kinase ArgK {Escherichia c	91.72
d2bv3a2	276	Elongation factor G (EF-G), N-terminal (G) domain	91.33
d1uaaa1	306	DEXX box DNA helicase {Escherichia coli, RepD [Tax	91.24
d1e69a_	308	Smc head domain {Thermotoga maritima [TaxId: 2336]	91.23
d1qvra3	315	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	91.12
d1xpua3	289	Transcription termination factor Rho, ATPase domai	91.08
d1ny5a2	247	Transcriptional activator sigm54 (NtrC1), C-termin	90.42
d1osna_	331	Thymidine kinase {Varicella-zoster virus [TaxId: 1	90.38
d1knxa2	177	HPr kinase HprK C-terminal domain {Mycoplasma pneu	90.38
d1kkma_	176	HPr kinase HprK C-terminal domain {Lactobacillus c	90.29
d1e2ka_	329	Thymidine kinase {Herpes simplex virus type 1, dif	90.16
d2olra1	313	Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo	89.96
d2dy1a2	267	Elongation factor G (EF-G), N-terminal (G) domain	89.85
d1pjra1	318	DEXX box DNA helicase {Bacillus stearothermophilus	89.7
d1mo6a1	269	RecA protein, ATPase-domain {Mycobacterium tubercu	89.7
d1ii2a1	323	Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo	89.41
d1j3ba1	318	Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo	89.4
d1jala1	278	YchF GTP-binding protein N-terminal domain {Haemop	89.26
d1u94a1	263	RecA protein, ATPase-domain {Escherichia coli [Tax	88.92
d1xp8a1	268	RecA protein, ATPase-domain {Deinococcus radiodura	88.89
d1ko7a2	169	HPr kinase HprK C-terminal domain {Staphylococcus	88.8
d2c78a3	204	Elongation factor Tu (EF-Tu), N-terminal (G) domai	88.66
d1wb1a4	179	Elongation factor SelB, N-terminal domain {Methano	88.57
d1w1wa_	427	Smc head domain {Baker's yeast (Saccharomyces cere	88.56
d2jdid3	276	Central domain of beta subunit of F1 ATP synthase	88.05
d1deka_	241	Deoxynucleoside monophosphate kinase {Bacteriophag	88.02
d1ni3a1	296	YchF GTP-binding protein N-terminal domain {Fissio	87.77
d1e9ra_	433	Bacterial conjugative coupling protein TrwB {Esche	87.65
d1fx0a3	276	Central domain of alpha subunit of F1 ATP synthase	87.21
d1u0ja_	267	Rep 40 protein helicase domain {Adeno-associated v	86.72
d1g7sa4	227	Initiation factor IF2/eIF5b, N-terminal (G) domain	86.48
d1puja_	273	Probable GTPase YlqF {Bacillus subtilis [TaxId: 14	85.71
d1tq4a_	400	Interferon-inducible GTPase {Mouse (Mus musculus)	85.26
d1wxqa1	319	GTP-binding protein PH0525 {Pyrococcus horikoshii	85.23
d2gnoa2	198	gamma subunit of DNA polymerase III, N-domain {The	83.87

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.57  E-value=2e-16  Score=116.50  Aligned_cols=53  Identities=11%  Similarity=-0.173  Sum_probs=42.4

Q ss_pred             CceeecccCCCCcc---------------ccCcCCCchhHHHHhhhhhhh-hccCCCCeEEEEEeC-CCC
Q 042811           77 TTKLGDVRRNGNNW---------------PFGVEGVGKITSLSKSYPEFL-EDEGIFLIKMHDVVR-DMS  129 (130)
Q Consensus        77 ~~ivG~~~~~~~l~---------------I~GmGGvGKTTLak~v~~~~~-~~~~~Fd~~~wv~VS-~~~  129 (130)
                      ++++||+..+++++               ||||||+||||||+++||+.. ....+|++++||+|| +++
T Consensus        20 ~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~   89 (277)
T d2a5yb3          20 MTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAP   89 (277)
T ss_dssp             CCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCST
T ss_pred             CceeCcHHHHHHHHHHHHhccCCCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCC
Confidence            44578876555443               999999999999999999752 256789999999999 775

>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Shikimate kinase (AroK)
domain: Shikimate kinase (AroK)
species: Escherichia coli [TaxId: 562]

Probab=97.84  E-value=2.9e-06  Score=54.70  Aligned_cols=23  Identities=26%  Similarity=0.244  Sum_probs=19.5

Q ss_pred             CccccCcCCCchhHHHHhhhhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|.|+.|+||||+|+.+.+..
T Consensus         4 ~I~l~G~~GsGKSTvak~La~~L   26 (169)
T d1kaga_           4 NIFLVGPMGAGKSTIGRQLAQQL   26 (169)
T ss_dssp             CEEEECCTTSCHHHHHHHHHHHT
T ss_pred             eEEEECCCCCCHHHHHHHHHHHh
Confidence            45588999999999999987754

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CDC6, N-domain
species: Archaeon Pyrobaculum aerophilum [TaxId: 13773]

Probab=97.77  E-value=2.8e-06  Score=59.35  Aligned_cols=20  Identities=30%  Similarity=0.532  Sum_probs=19.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+||||+|+.+.+..
T Consensus        48 l~GppGtGKT~l~~~l~~~l   67 (276)
T d1fnna2          48 LLGRPGTGKTVTLRKLWELY   67 (276)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            99999999999999999976

>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ATP sulfurylase C-terminal domain
domain: ATP sulfurylase C-terminal domain
species: Fungus (Penicillium chrysogenum) [TaxId: 5076]

Probab=97.60  E-value=1.4e-05  Score=52.21  Aligned_cols=21  Identities=14%  Similarity=0.023  Sum_probs=19.0

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +|.|+.|+||||+|+.+....
T Consensus        10 ~l~G~~GsGKTTia~~La~~L   30 (183)
T d1m8pa3          10 FLTGYMNSGKDAIARALQVTL   30 (183)
T ss_dssp             EEECSTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHH
Confidence            378999999999999999876

>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Holliday junction helicase RuvB
species: Thermus thermophilus [TaxId: 274]

Probab=97.58  E-value=4.1e-06  Score=58.43  Aligned_cols=22  Identities=32%  Similarity=0.315  Sum_probs=19.6

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++++|..|+||||||+.+.+..
T Consensus        38 ~Ll~GPpG~GKTtla~~la~~~   59 (239)
T d1ixsb2          38 LLLFGPPGLGKTTLAHVIAHEL   59 (239)
T ss_dssp             EEEECCTTSCHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            3499999999999999998865

>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]

Probab=97.52  E-value=1.5e-05  Score=52.05  Aligned_cols=23  Identities=30%  Similarity=0.189  Sum_probs=19.3

Q ss_pred             CccccCcCCCchhHHHHhhhhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .+.|.|+.|+||||+|+.+..+.
T Consensus         6 ~I~i~G~pGsGKTTia~~La~~l   28 (173)
T d1rkba_           6 NILLTGTPGVGKTTLGKELASKS   28 (173)
T ss_dssp             CEEEECSTTSSHHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHHH
Confidence            34489999999999999997654

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Archaeal ATPase SSO1545
species: Sulfolobus solfataricus [TaxId: 2287]

Probab=97.52  E-value=4.1e-06  Score=58.47  Aligned_cols=33  Identities=12%  Similarity=0.116  Sum_probs=26.9

Q ss_pred             ceeecccCCCCcc--------ccCcCCCchhHHHHhhhhhh
Q 042811           78 TKLGDVRRNGNNW--------PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        78 ~ivG~~~~~~~l~--------I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++||+..++.+.        |+|.+|+|||||++.+-+..
T Consensus        13 ~f~GR~~el~~l~~~~~~~i~i~G~~G~GKTsLl~~~~~~~   53 (283)
T d2fnaa2          13 DFFDREKEIEKLKGLRAPITLVLGLRRTGKSSIIKIGINEL   53 (283)
T ss_dssp             GSCCCHHHHHHHHHTCSSEEEEEESTTSSHHHHHHHHHHHH
T ss_pred             hCCChHHHHHHHHhccCCEEEEEcCCCCcHHHHHHHHHHHC
Confidence            4699987655553        99999999999999987755

>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Transcriptional regulator NadR, ribosylnicotinamide kinase domain
species: Haemophilus influenzae [TaxId: 727]

Probab=97.52  E-value=1.2e-05  Score=52.62  Aligned_cols=24  Identities=25%  Similarity=0.171  Sum_probs=20.4

Q ss_pred             CCccccCcCCCchhHHHHhhhhhh
Q 042811           87 GNNWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        87 ~~l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ..|.|.|..|+||||||+.+.+..
T Consensus         8 K~I~i~G~~GsGKTTla~~La~~~   31 (192)
T d1lw7a2           8 KTVAILGGESSGKSVLVNKLAAVF   31 (192)
T ss_dssp             EEEEEECCTTSHHHHHHHHHHHHT
T ss_pred             eEEEEECCCCCCHHHHHHHHHHHh
Confidence            345599999999999999998765

>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Shikimate kinase (AroK)
domain: Shikimate kinase (AroK)
species: Erwinia chrysanthemi [TaxId: 556]

Probab=97.49  E-value=1.9e-05  Score=52.36  Aligned_cols=23  Identities=17%  Similarity=0.158  Sum_probs=19.2

Q ss_pred             CccccCcCCCchhHHHHhhhhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.+.||.|+||||+++.+.+..
T Consensus         4 ~Iil~G~~GsGKSTia~~LA~~L   26 (170)
T d1e6ca_           4 PIFMVGARGCGMTTVGRELARAL   26 (170)
T ss_dssp             CEEEESCTTSSHHHHHHHHHHHH
T ss_pred             CEEEECCCCCCHHHHHHHHHHHh
Confidence            34478999999999999997754

>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Holliday junction helicase RuvB
species: Thermotoga maritima [TaxId: 2336]

Probab=97.48  E-value=7.1e-06  Score=57.04  Aligned_cols=21  Identities=29%  Similarity=0.248  Sum_probs=19.2

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++|..|+||||||+.+.+..
T Consensus        39 L~~GPpGtGKT~lA~~la~~~   59 (238)
T d1in4a2          39 LLAGPPGLGKTTLAHIIASEL   59 (238)
T ss_dssp             EEESSTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCcHHHHHHHHHhcc
Confidence            399999999999999998865

>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Shikimate kinase (AroK)
domain: Shikimate kinase (AroK)
species: Campylobacter jejuni [TaxId: 197]

Probab=97.47  E-value=1.9e-05  Score=52.19  Aligned_cols=21  Identities=24%  Similarity=0.105  Sum_probs=17.7

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|.||.|+||||+++.+..+
T Consensus         3 I~liG~~GsGKsTi~k~La~~   23 (161)
T d1viaa_           3 IVFIGFMGSGKSTLARALAKD   23 (161)
T ss_dssp             EEEECCTTSCHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            447899999999999998554

>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Polynucleotide kinase, kinase domain
species: Bacteriophage T4 [TaxId: 10665]

Probab=97.45  E-value=2e-05  Score=50.65  Aligned_cols=20  Identities=25%  Similarity=0.287  Sum_probs=17.3

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      +|.|+.|+||||||+.+..+
T Consensus         6 ii~G~pGsGKTTla~~L~~~   25 (152)
T d1ly1a_           6 LTIGCPGSGKSTWAREFIAK   25 (152)
T ss_dssp             EEECCTTSSHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHh
Confidence            48999999999999987544

>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CDC6-like protein APE0152, N-terminal domain
species: Aeropyrum pernix [TaxId: 56636]

Probab=97.45  E-value=1.1e-05  Score=56.43  Aligned_cols=20  Identities=25%  Similarity=0.323  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+||||+++.+.+..
T Consensus        51 l~GppGtGKT~l~~~l~~~l   70 (287)
T d1w5sa2          51 SIGRVGIGKTTLAKFTVKRV   70 (287)
T ss_dssp             CTTCCSSSHHHHHHHHHHHH
T ss_pred             eECCCCCCHHHHHHHHHHHH
Confidence            68999999999999999875

>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Shikimate kinase (AroK)
domain: Shikimate kinase (AroK)
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=97.44  E-value=2.2e-05  Score=51.81  Aligned_cols=22  Identities=23%  Similarity=0.188  Sum_probs=18.5

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.+.||.|+||||+++.+.+..
T Consensus         4 IvliG~~G~GKSTig~~La~~l   25 (165)
T d2iyva1           4 AVLVGLPGSGKSTIGRRLAKAL   25 (165)
T ss_dssp             EEEECSTTSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            4467999999999999987653

>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Atu3015-like
domain: Hypothetical protein BH3686
species: Bacillus halodurans [TaxId: 86665]

Probab=97.35  E-value=3e-05  Score=50.27  Aligned_cols=21  Identities=29%  Similarity=0.338  Sum_probs=17.8

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|+.|+||||+|+.+-...
T Consensus         6 ~i~G~~GsGKTTva~~L~~~~   26 (176)
T d2bdta1           6 IITGPAGVGKSTTCKRLAAQL   26 (176)
T ss_dssp             EEECSTTSSHHHHHHHHHHHS
T ss_pred             EEECCCCCCHHHHHHHHHHHc
Confidence            389999999999999886543

>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Cancer-related NTPase, C1orf57
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.34  E-value=3.4e-05  Score=50.40  Aligned_cols=21  Identities=33%  Similarity=0.439  Sum_probs=19.0

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|.+|+|||||++.+....
T Consensus         5 ~ItG~~GtGKTtl~~~i~~~l   25 (189)
T d2i3ba1           5 FLTGPPGVGKTTLIHKASEVL   25 (189)
T ss_dssp             EEESCCSSCHHHHHHHHHHHH
T ss_pred             EEECCCCCcHHHHHHHHHHHH
Confidence            489999999999999998776

>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Probable kinase LmjF30.1890
species: Leishmania major [TaxId: 5664]

Probab=97.33  E-value=3.4e-05  Score=50.44  Aligned_cols=21  Identities=24%  Similarity=0.256  Sum_probs=18.8

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|+.|+||||+++.+.+..
T Consensus         9 ~i~G~~GsGKTT~~~~La~~l   29 (174)
T d1y63a_           9 LITGTPGTGKTSMAEMIAAEL   29 (174)
T ss_dssp             EEECSTTSSHHHHHHHHHHHS
T ss_pred             EEEeCCCCCHHHHHHHHHHHh
Confidence            389999999999999998765

>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Molybdopterin-guanine dinucleotide biosynthesis protein MobB
species: Escherichia coli [TaxId: 562]

Probab=97.27  E-value=4.1e-05  Score=49.72  Aligned_cols=22  Identities=32%  Similarity=0.240  Sum_probs=18.9

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|.|..|+|||||++.+-+..
T Consensus         5 i~itG~~GSGKTTL~~~L~~~l   26 (170)
T d1np6a_           5 LAFAAWSGTGKTTLLKKLIPAL   26 (170)
T ss_dssp             EEEECCTTSCHHHHHHHHHHHH
T ss_pred             EEEEcCCCCCHHHHHHHHHHHH
Confidence            3489999999999999997654

>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Adenosine-5'phosphosulfate kinase (APS kinase)
domain: Adenosine-5'phosphosulfate kinase (APS kinase)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.26  E-value=2.7e-05  Score=51.87  Aligned_cols=20  Identities=25%  Similarity=0.195  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+.|+||||||+.+....
T Consensus        24 L~G~pGSGKTTiAk~La~~l   43 (195)
T d1x6va3          24 LTGLSGAGKTTVSMALEEYL   43 (195)
T ss_dssp             EESSCHHHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            88999999999999998765

>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain
domain: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=97.16  E-value=6.7e-05  Score=50.42  Aligned_cols=20  Identities=20%  Similarity=0.089  Sum_probs=17.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+||||||+++.+..
T Consensus         7 l~GlpgsGKSTla~~L~~~l   26 (213)
T d1bifa1           7 MVGLPARGKTYISKKLTRYL   26 (213)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            79999999999999988654

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C2
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=97.11  E-value=5.7e-05  Score=51.94  Aligned_cols=21  Identities=24%  Similarity=0.398  Sum_probs=18.5

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++|..|+|||||++.+.+..
T Consensus        37 ll~Gp~G~GKTtl~~~i~~~l   57 (237)
T d1sxjd2          37 LFYGPPGTGKTSTILALTKEL   57 (237)
T ss_dssp             EEECSTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCChHHHHHHHHHHH
Confidence            399999999999999987764

>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Chloramphenicol phosphotransferase
domain: Chloramphenicol phosphotransferase
species: Streptomyces venezuelae [TaxId: 54571]

Probab=97.06  E-value=0.0001  Score=47.80  Aligned_cols=20  Identities=15%  Similarity=-0.011  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+||||+|+.+.+..
T Consensus         8 l~G~~GsGKsTva~~L~~~l   27 (178)
T d1qhxa_           8 LNGGSSAGKSGIVRCLQSVL   27 (178)
T ss_dssp             EECCTTSSHHHHHHHHHHHS
T ss_pred             EECCCCCCHHHHHHHHHHHc
Confidence            88999999999999988765

>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Plasmid maintenance system epsilon/zeta, toxin zeta subunit
domain: Plasmid maintenance system epsilon/zeta, toxin zeta subunit
species: Streptococcus pyogenes [TaxId: 1314]

Probab=97.05  E-value=0.00012  Score=51.04  Aligned_cols=22  Identities=27%  Similarity=0.173  Sum_probs=19.6

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++++|..|+||||||+.+.+..
T Consensus        35 ilL~GpPGtGKT~la~~la~~~   56 (273)
T d1gvnb_          35 FLLGGQPGSGKTSLRSAIFEET   56 (273)
T ss_dssp             EEEECCTTSCTHHHHHHHHHHT
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            3489999999999999999865

>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Adenosine-5'phosphosulfate kinase (APS kinase)
domain: Adenosine-5'phosphosulfate kinase (APS kinase)
species: Fungus (Penicillium chrysogenum) [TaxId: 5076]

Probab=97.03  E-value=9.4e-05  Score=51.01  Aligned_cols=22  Identities=23%  Similarity=0.308  Sum_probs=19.2

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +|+.|+.|+||||||+.+.+..
T Consensus        27 IwltGlsGsGKTTia~~L~~~l   48 (208)
T d1m7ga_          27 IWLTGLSASGKSTLAVELEHQL   48 (208)
T ss_dssp             EEEECSTTSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
Confidence            4599999999999999998654

>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Gluconate kinase
domain: Gluconate kinase
species: Escherichia coli [TaxId: 562]

Probab=97.03  E-value=0.00011  Score=47.82  Aligned_cols=20  Identities=30%  Similarity=0.406  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+||||+|+.+....
T Consensus        11 l~G~~GsGKsT~a~~La~~l   30 (171)
T d1knqa_          11 LMGVSGSGKSAVASEVAHQL   30 (171)
T ss_dssp             EECSTTSCHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            89999999999999987654

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C4
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=97.03  E-value=5e-05  Score=52.26  Aligned_cols=21  Identities=33%  Similarity=0.368  Sum_probs=18.1

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++|..|+||||+|+.+-+..
T Consensus        40 ll~Gp~G~GKTt~a~~la~~l   60 (224)
T d1sxjb2          40 IISGMPGIGKTTSVHCLAHEL   60 (224)
T ss_dssp             EEECSTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCCchhhHHHHHHHH
Confidence            399999999999999876654

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C5
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=97.00  E-value=0.00011  Score=50.97  Aligned_cols=22  Identities=23%  Similarity=0.255  Sum_probs=19.1

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+||||+|+.+.+..
T Consensus        36 lll~Gp~G~GKTt~~~~la~~l   57 (252)
T d1sxje2          36 LLLYGPNGTGKKTRCMALLESI   57 (252)
T ss_dssp             EEEECSTTSSHHHHHHTHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHhh
Confidence            3499999999999999998764

>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Hypothetical kinase-like protein Aq 1292
species: Aquifex aeolicus [TaxId: 63363]

Probab=96.98  E-value=0.00012  Score=48.04  Aligned_cols=21  Identities=33%  Similarity=0.264  Sum_probs=17.7

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|.|-.|+|||||++.+-..
T Consensus         3 i~I~G~~G~GKSTLl~~i~~~   23 (178)
T d1ye8a1           3 IIITGEPGVGKTTLVKKIVER   23 (178)
T ss_dssp             EEEECCTTSSHHHHHHHHHHH
T ss_pred             EEEECCCCcHHHHHHHHHHhc
Confidence            347899999999999998653

>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: 5' polynucleotide kinase-3' phosphatase, C-terminal domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=96.97  E-value=0.00014  Score=48.59  Aligned_cols=20  Identities=25%  Similarity=0.348  Sum_probs=17.7

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      +++|+.|+||||+|+.+...
T Consensus        18 il~G~pGsGKST~a~~l~~~   37 (172)
T d1yj5a2          18 VAVGFPGAGKSTFIQEHLVS   37 (172)
T ss_dssp             EEECCTTSSHHHHHHHHTGG
T ss_pred             EEECCCCCCHHHHHHHHHHh
Confidence            49999999999999988664

>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Archaeon Methanococcus voltae [TaxId: 2188]

Probab=96.94  E-value=0.00014  Score=47.42  Aligned_cols=20  Identities=35%  Similarity=0.424  Sum_probs=17.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|+.|+||||+++.+.+..
T Consensus         6 i~G~~GsGKsT~~~~L~~~l   25 (190)
T d1khta_           6 VTGVPGVGSTTSSQLAMDNL   25 (190)
T ss_dssp             EECCTTSCHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            88999999999999987654

>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Atu3015-like
domain: Hypothetical protein Atu3015
species: Agrobacterium tumefaciens [TaxId: 358]

Probab=96.89  E-value=0.00014  Score=47.35  Aligned_cols=20  Identities=25%  Similarity=0.004  Sum_probs=17.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|+.|+||||+|+.+-+..
T Consensus         9 l~G~~GsGKSTia~~La~~l   28 (176)
T d1zp6a1           9 LSGHPGSGKSTIAEALANLP   28 (176)
T ss_dssp             EEECTTSCHHHHHHHHHTCS
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            89999999999999987654

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Chromosomal replication initiation factor DnaA
species: Aquifex aeolicus [TaxId: 63363]

Probab=96.87  E-value=0.00018  Score=49.69  Aligned_cols=34  Identities=18%  Similarity=0.068  Sum_probs=25.3

Q ss_pred             ccccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEe
Q 042811           89 NWPFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVV  125 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~V  125 (130)
                      +.|||..|+|||.|++.+.+...   +....+++++.
T Consensus        39 l~l~G~~G~GKTHLl~A~~~~~~---~~~~~~~~~~~   72 (213)
T d1l8qa2          39 IFIYGSVGTGKTHLLQAAGNEAK---KRGYRVIYSSA   72 (213)
T ss_dssp             EEEECSSSSSHHHHHHHHHHHHH---HTTCCEEEEEH
T ss_pred             EEEECCCCCcHHHHHHHHHHHhc---cCccceEEech
Confidence            45999999999999999999873   22334455543

>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Molybdopterin-guanine dinucleotide biosynthesis protein MobB
species: Bacillus stearothermophilus [TaxId: 1422]

Probab=96.82  E-value=0.00019  Score=47.00  Aligned_cols=20  Identities=25%  Similarity=0.202  Sum_probs=17.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||+..+-+..
T Consensus         6 I~G~~gSGKTTli~~l~~~L   25 (165)
T d1xjca_           6 VVGYKHSGKTTLMEKWVAAA   25 (165)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EEeCCCCCHHHHHHHHHHHH
Confidence            89999999999999886654

>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Archaeon Sulfolobus acidocaldarius [TaxId: 2285]

Probab=96.78  E-value=0.00018  Score=47.12  Aligned_cols=20  Identities=40%  Similarity=0.479  Sum_probs=17.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|+.|+||||+++.+....
T Consensus         6 i~G~~GsGKTT~~~~La~~L   25 (194)
T d1nksa_           6 VTGIPGVGKSTVLAKVKEIL   25 (194)
T ss_dssp             EEECTTSCHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            78999999999999986544

>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=96.71  E-value=0.00027  Score=48.90  Aligned_cols=22  Identities=27%  Similarity=0.410  Sum_probs=19.6

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.++|..|+||||+|+.+.+..
T Consensus        55 lll~GPpG~GKTt~a~~la~~~   76 (253)
T d1sxja2          55 AMLYGPPGIGKTTAAHLVAQEL   76 (253)
T ss_dssp             EEEECSTTSSHHHHHHHHHHHT
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
Confidence            4599999999999999998865

>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Bacillus stearothermophilus [TaxId: 1422]

Probab=96.71  E-value=0.00028  Score=46.38  Aligned_cols=20  Identities=30%  Similarity=0.267  Sum_probs=17.0

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      |.|.|+.|+||||+|+.+.+
T Consensus         3 I~i~G~pGSGKsT~a~~La~   22 (182)
T d1zina1           3 LVLMGLPGAGKGTQAEKIVA   22 (182)
T ss_dssp             EEEECSTTSSHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            44889999999999999843

>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: UMP/CMP kinase
species: Dictyostelium discoideum [TaxId: 44689]

Probab=96.70  E-value=0.00025  Score=47.38  Aligned_cols=21  Identities=29%  Similarity=0.422  Sum_probs=18.6

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|+.|+||||+|+.+.+..
T Consensus        10 ~i~G~pGSGKsT~a~~La~~~   30 (194)
T d1qf9a_          10 FVLGGPGSGKGTQCANIVRDF   30 (194)
T ss_dssp             EEEESTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHH
Confidence            389999999999999997754

>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Hypothetical protein rbstp0775
species: Bacillus stearothermophilus [TaxId: 1422]

Probab=96.67  E-value=0.00039  Score=45.86  Aligned_cols=20  Identities=20%  Similarity=0.135  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|+||||||+.+....
T Consensus        27 I~G~~GSGKSTla~~L~~~l   46 (198)
T d1rz3a_          27 IDGLSRSGKTTLANQLSQTL   46 (198)
T ss_dssp             EEECTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            78999999999999998876

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C
species: Archaeon Pyrococcus furiosus [TaxId: 2261]

Probab=96.66  E-value=0.00031  Score=48.18  Aligned_cols=21  Identities=33%  Similarity=0.271  Sum_probs=18.6

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +++|..|+||||||+.+-+..
T Consensus        49 ll~Gp~G~GKTtla~~iak~l   69 (231)
T d1iqpa2          49 LFAGPPGVGKTTAALALAREL   69 (231)
T ss_dssp             EEESCTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCcHHHHHHHHHHHH
Confidence            399999999999999987754

>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=96.66  E-value=0.00032  Score=46.42  Aligned_cols=20  Identities=30%  Similarity=0.258  Sum_probs=17.2

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|.|+.|+||||+|+.+.+.
T Consensus         4 ~i~G~pGsGKsT~a~~La~~   23 (181)
T d2cdna1           4 LLLGPPGAGKGTQAVKLAEK   23 (181)
T ss_dssp             EEECCTTSSHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHH
Confidence            47899999999999998654

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpA, an Hsp100 chaperone, AAA+ modules
species: Escherichia coli [TaxId: 562]

Probab=96.66  E-value=0.0001  Score=52.95  Aligned_cols=32  Identities=19%  Similarity=0.141  Sum_probs=24.4

Q ss_pred             eeecccCCCCcc------------ccCcCCCchhHHHHhhhhhh
Q 042811           79 KLGDVRRNGNNW------------PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        79 ivG~~~~~~~l~------------I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++||+..++++.            ++|..|||||+|+..+....
T Consensus        20 ~igRd~Ei~~l~~iL~r~~k~n~lLVG~~GvGKTalv~~la~ri   63 (268)
T d1r6bx2          20 LIGREKELERAIQVLCRRRKNNPLLVGESGVGKTAIAEGLAWRI   63 (268)
T ss_dssp             CCSCHHHHHHHHHHHTSSSSCEEEEECCTTSSHHHHHHHHHHHH
T ss_pred             ccChHHHHHHHHHHHhcCccCCcEEECCCCCcHHHHHHHHHHHH
Confidence            477776444432            99999999999998877654

>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Bacillus globisporus [TaxId: 1459]

Probab=96.63  E-value=0.00034  Score=46.35  Aligned_cols=21  Identities=24%  Similarity=0.260  Sum_probs=17.7

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|.|+.|+||||+|+.+.+.
T Consensus         3 I~i~G~pGSGKsT~a~~La~~   23 (182)
T d1s3ga1           3 IVLMGLPGAGKGTQADRIVEK   23 (182)
T ss_dssp             EEEECSTTSSHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            347899999999999988654

>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Maize (Zea mays) [TaxId: 4577]

Probab=96.62  E-value=0.00031  Score=46.84  Aligned_cols=22  Identities=18%  Similarity=0.066  Sum_probs=19.1

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|.|+.|+||||+|+.+.+..
T Consensus         6 I~i~GppGsGKsT~a~~La~~~   27 (189)
T d1zaka1           6 VMISGAPASGKGTQCELIKTKY   27 (189)
T ss_dssp             EEEEESTTSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
Confidence            4489999999999999997765

>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]

Probab=96.61  E-value=0.00034  Score=47.09  Aligned_cols=21  Identities=33%  Similarity=0.317  Sum_probs=18.4

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|+.|+||||+++.+-...
T Consensus        10 iliG~PGSGKtT~a~~La~~~   30 (189)
T d2ak3a1          10 AIMGAPGSGKGTVSSRITKHF   30 (189)
T ss_dssp             EEECCTTSSHHHHHHHHHHHB
T ss_pred             EEECCCCCCHHHHHHHHHHHH
Confidence            388999999999999987754

>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Uridylate kinase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=96.60  E-value=0.00035  Score=46.76  Aligned_cols=22  Identities=27%  Similarity=0.371  Sum_probs=19.4

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|.|..|+||||+|+.+.+..
T Consensus        11 I~i~GppGSGKsT~a~~La~~~   32 (196)
T d1ukza_          11 IFVLGGPGAGKGTQCEKLVKDY   32 (196)
T ss_dssp             EEEECSTTSSHHHHHHHHHHHS
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            4589999999999999998765

>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Nitrogenase iron protein
species: Clostridium pasteurianum [TaxId: 1501]

Probab=96.60  E-value=0.00029  Score=49.52  Aligned_cols=20  Identities=25%  Similarity=0.428  Sum_probs=16.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-||+||||+|-++---.
T Consensus         6 i~gKGGvGKTT~a~nLA~~L   25 (269)
T d1cp2a_           6 IYGKGGIGKSTTTQNLTSGL   25 (269)
T ss_dssp             EEECTTSSHHHHHHHHHHHH
T ss_pred             EECCCcCCHHHHHHHHHHHH
Confidence            78999999999998765443

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C3
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=96.52  E-value=0.00043  Score=47.28  Aligned_cols=21  Identities=24%  Similarity=0.390  Sum_probs=18.8

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++|..|+||||||+.+-+..
T Consensus        39 Ll~Gp~G~GKttl~~~la~~l   59 (227)
T d1sxjc2          39 LFYGPPGTGKTSTIVALAREI   59 (227)
T ss_dssp             EEECSSSSSHHHHHHHHHHHH
T ss_pred             EEECCCCCChhHHHHHHHHHh
Confidence            499999999999999998764

>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Human (Homo sapiens), ARF1 [TaxId: 9606]

Probab=96.51  E-value=0.00046  Score=43.94  Aligned_cols=19  Identities=32%  Similarity=0.298  Sum_probs=16.4

Q ss_pred             ccccCcCCCchhHHHHhhh
Q 042811           89 NWPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~  107 (130)
                      +.|+|..|+|||||+..+.
T Consensus         3 ivlvG~~~vGKSsLi~~l~   21 (160)
T d1r8sa_           3 ILMVGLDAAGKTTILYKLK   21 (160)
T ss_dssp             EEEECSTTSSHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3479999999999999864

>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Escherichia coli [TaxId: 562]

Probab=96.49  E-value=0.00015  Score=49.79  Aligned_cols=20  Identities=25%  Similarity=0.313  Sum_probs=17.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|-.|||||+|+..+....
T Consensus        48 LvG~pGVGKTalv~~LA~ri   67 (195)
T d1jbka_          48 LIGEPGVGKTAIVEGLAQRI   67 (195)
T ss_dssp             EECCTTSCHHHHHHHHHHHH
T ss_pred             EEecCCcccHHHHHHHHHHH
Confidence            99999999999998877655

>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=96.40  E-value=0.00058  Score=45.92  Aligned_cols=20  Identities=40%  Similarity=0.436  Sum_probs=17.3

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||++.+...
T Consensus         4 vl~GPsGsGK~tl~~~L~~~   23 (190)
T d1lvga_           4 VLSGPSGAGKSTLLKKLFQE   23 (190)
T ss_dssp             EEECCTTSSHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHh
Confidence            37899999999999998654

>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Nitrogenase iron protein
species: Azotobacter vinelandii [TaxId: 354]

Probab=96.40  E-value=0.00045  Score=49.09  Aligned_cols=21  Identities=24%  Similarity=0.374  Sum_probs=16.7

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      -|+|-|||||||++-++---.
T Consensus         6 aisgKGGVGKTT~a~NLA~~L   26 (289)
T d2afhe1           6 AIYGKGGIGKSTTTQNLVAAL   26 (289)
T ss_dssp             EEEECTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHH
Confidence            378999999999888765433

>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: HslU
species: Haemophilus influenzae [TaxId: 727]

Probab=96.40  E-value=0.00056  Score=49.56  Aligned_cols=21  Identities=24%  Similarity=0.180  Sum_probs=19.0

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++|..|+|||.|||.+.+..
T Consensus        53 Ll~GPpG~GKT~lAkalA~~~   73 (309)
T d1ofha_          53 LMIGPTGVGKTEIARRLAKLA   73 (309)
T ss_dssp             EEECCTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHhhcc
Confidence            489999999999999998865

>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: UMP/CMP kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.38  E-value=0.00061  Score=45.36  Aligned_cols=21  Identities=24%  Similarity=0.422  Sum_probs=18.2

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|..|+||||+|+.+.+..
T Consensus         5 ~i~GppGSGKsT~a~~La~~~   25 (194)
T d1teva_           5 FVLGGPGAGKGTQCARIVEKY   25 (194)
T ss_dssp             EEECCTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHh
Confidence            388999999999999997744

>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Human (Homo sapiens), ARL1 [TaxId: 9606]

Probab=96.36  E-value=0.00063  Score=43.49  Aligned_cols=20  Identities=30%  Similarity=0.414  Sum_probs=17.4

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|-.|+|||||++.+.++
T Consensus         9 ~ivG~~~vGKSSLi~~~~~~   28 (169)
T d1upta_           9 LILGLDGAGKTTILYRLQVG   28 (169)
T ss_dssp             EEECSTTSSHHHHHHHHHHS
T ss_pred             EEECCCCCCHHHHHHHHhCC
Confidence            39999999999999987554

>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=96.34  E-value=0.00066  Score=44.92  Aligned_cols=21  Identities=29%  Similarity=0.290  Sum_probs=18.0

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|+.|+||||+++.+.+..
T Consensus         6 vl~G~pGSGKtT~a~~La~~~   26 (180)
T d1akya1           6 VLIGPPGAGKGTQAPNLQERF   26 (180)
T ss_dssp             EEECCTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHh
Confidence            377999999999999997654

>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=96.33  E-value=0.00064  Score=45.43  Aligned_cols=21  Identities=38%  Similarity=0.498  Sum_probs=18.2

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+|||||++.+.+++
T Consensus         5 vl~GpsG~GK~tl~~~L~~~~   25 (186)
T d1gkya_           5 VISGPSGTGKSTLLKKLFAEY   25 (186)
T ss_dssp             EEECCTTSSHHHHHHHHHHHC
T ss_pred             EEECCCCCCHHHHHHHHHHhC
Confidence            389999999999999987654

>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: CMP kinase
species: Escherichia coli [TaxId: 562]

Probab=96.32  E-value=0.00069  Score=45.56  Aligned_cols=20  Identities=25%  Similarity=0.109  Sum_probs=18.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |-|+.|+||||+|+.+-+++
T Consensus         8 I~GppGSGKgT~ak~La~~~   27 (225)
T d1ckea_           8 IDGPSGAGKGTLCKAMAEAL   27 (225)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            77999999999999998876

>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]

Probab=96.30  E-value=0.00071  Score=44.96  Aligned_cols=21  Identities=33%  Similarity=0.343  Sum_probs=18.1

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|.|+.|+||||+|+.+-...
T Consensus         7 il~G~pGSGKsT~a~~La~~~   27 (190)
T d1ak2a1           7 VLLGPPGAGKGTQAPKLAKNF   27 (190)
T ss_dssp             EEECCTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHh
Confidence            378999999999999987654

>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab-33b
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=96.30  E-value=0.0007  Score=43.80  Aligned_cols=20  Identities=20%  Similarity=0.092  Sum_probs=16.9

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.++|.+|+|||||+..+.+
T Consensus         5 v~liG~~~vGKTsLl~~~~~   24 (165)
T d1z06a1           5 IIVIGDSNVGKTCLTYRFCA   24 (165)
T ss_dssp             EEEECCTTSSHHHHHHHHHH
T ss_pred             EEEECCCCcCHHHHHHHHHh
Confidence            34899999999999998754

>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative ABC transporter PF0895
species: Pyrococcus furiosus [TaxId: 2261]

Probab=96.27  E-value=0.00071  Score=46.21  Aligned_cols=20  Identities=30%  Similarity=0.351  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        32 l~G~NGsGKSTLl~~i~gl~   51 (200)
T d1sgwa_          32 FHGPNGIGKTTLLKTISTYL   51 (200)
T ss_dssp             EECCTTSSHHHHHHHHTTSS
T ss_pred             EECCCCChHHHHHHHHhccc
Confidence            99999999999999997744

>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Thermus thermophilus [TaxId: 274]

Probab=96.27  E-value=0.00036  Score=52.49  Aligned_cols=33  Identities=21%  Similarity=0.283  Sum_probs=21.2

Q ss_pred             ccCcCCCchhHHHHhhhhhhhh---ccCCCCeEEEE
Q 042811           91 PFGVEGVGKITSLSKSYPEFLE---DEGIFLIKMHD  123 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~---~~~~Fd~~~wv  123 (130)
                      ++|-.|||||+|+..+......   -....+.++|.
T Consensus        48 lvG~~GvGKtaiv~~la~~i~~~~vp~~l~~~~i~~   83 (387)
T d1qvra2          48 LIGEPGVGKTAIVEGLAQRIVKGDVPEGLKGKRIVS   83 (387)
T ss_dssp             EEECTTSCHHHHHHHHHHHHHHTCSCTTSTTCEEEE
T ss_pred             EECCCCCCHHHHHHHHHHHHHhCCCCHHHcCceEEE
Confidence            9999999999987554433211   12345566663

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein
species: Chinese hamster (Cricetulus griseus) [TaxId: 10029]

Probab=96.23  E-value=0.00078  Score=47.32  Aligned_cols=22  Identities=23%  Similarity=0.001  Sum_probs=19.6

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++++|..|+|||+||+.|.+..
T Consensus        43 vLL~GppGtGKT~la~alA~~~   64 (246)
T d1d2na_          43 VLLEGPPHSGKTALAAKIAEES   64 (246)
T ss_dssp             EEEECSTTSSHHHHHHHHHHHH
T ss_pred             EEEECcCCCCHHHHHHHHhhcc
Confidence            3589999999999999999865

>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Escherichia coli [TaxId: 562]

Probab=96.23  E-value=0.00073  Score=44.49  Aligned_cols=20  Identities=20%  Similarity=0.057  Sum_probs=17.0

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|.|+.|+||||+++.+.+.
T Consensus         4 ~i~G~pGSGKsT~~~~La~~   23 (179)
T d1e4va1           4 ILLGAPVAGKGTQAQFIMEK   23 (179)
T ss_dssp             EEEESTTSSHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHH
Confidence            47899999999999998553

>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Membrane fusion ATPase VCP/p97
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=96.23  E-value=0.00073  Score=47.91  Aligned_cols=21  Identities=24%  Similarity=0.219  Sum_probs=19.1

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +++|..|+|||+||+.+.+..
T Consensus        45 LL~Gp~GtGKT~l~~ala~~~   65 (265)
T d1r7ra3          45 LFYGPPGCGKTLLAKAIANEC   65 (265)
T ss_dssp             EEBCCTTSSHHHHHHHHHHHT
T ss_pred             EEECCCCCcchhHHHHHHHHh
Confidence            399999999999999998865

>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Uridine-cytidine kinase 2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.19  E-value=0.00087  Score=45.31  Aligned_cols=20  Identities=20%  Similarity=0.094  Sum_probs=17.6

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |-|-.|+||||||+.+...+
T Consensus         7 I~G~~gSGKSTla~~L~~~l   26 (213)
T d1uj2a_           7 VSGGTASGKSSVCAKIVQLL   26 (213)
T ss_dssp             EECSTTSSHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            78999999999999887665

>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Arsenite-translocating ATPase ArsA
species: Escherichia coli [TaxId: 562]

Probab=96.16  E-value=0.00082  Score=47.26  Aligned_cols=20  Identities=25%  Similarity=0.230  Sum_probs=17.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|-||+||||++-.+-...
T Consensus        13 ~sGKGGVGKTTvaa~lA~~l   32 (296)
T d1ihua1          13 FTGKGGVGKTSISCATAIRL   32 (296)
T ss_dssp             EECSTTSSHHHHHHHHHHHH
T ss_pred             EECCCcChHHHHHHHHHHHH
Confidence            78999999999888876655

>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase-like domain of Cask
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.15  E-value=0.00063  Score=45.48  Aligned_cols=21  Identities=19%  Similarity=0.260  Sum_probs=18.6

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+|||||++.+..++
T Consensus         7 vl~Gpsg~GK~tl~~~L~~~~   27 (178)
T d1kgda_           7 VLLGAHGVGRRHIKNTLITKH   27 (178)
T ss_dssp             EEECCTTSSHHHHHHHHHHHC
T ss_pred             EEECCCCCCHHHHHHHHHHhC
Confidence            389999999999999988754

>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Deoxyribonucleoside kinase
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=96.13  E-value=0.00097  Score=44.35  Aligned_cols=20  Identities=30%  Similarity=0.069  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |-|.-|+|||||++.+.+..
T Consensus        14 ieG~~GsGKTTl~~~L~~~l   33 (197)
T d2vp4a1          14 IEGNIGSGKTTYLNHFEKYK   33 (197)
T ss_dssp             EECSTTSCHHHHHHTTGGGT
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            78999999999999998765

>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Mouse (Mus musculus), ARL2 [TaxId: 10090]

Probab=96.10  E-value=0.00099  Score=43.03  Aligned_cols=22  Identities=32%  Similarity=0.274  Sum_probs=18.2

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|+|..|+|||||+..+-++.
T Consensus         5 i~ivG~~~~GKTsLi~~l~~~~   26 (165)
T d1ksha_           5 LLMLGLDNAGKTTILKKFNGED   26 (165)
T ss_dssp             EEEECSTTSSHHHHHHHHTTCC
T ss_pred             EEEECCCCCCHHHHHHHHcCCC
Confidence            3489999999999999976643

>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=96.08  E-value=0.0011  Score=43.96  Aligned_cols=20  Identities=25%  Similarity=0.154  Sum_probs=17.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+.++.
T Consensus         7 l~GpsG~GK~tl~~~L~~~~   26 (182)
T d1znwa1           7 LSGPSAVGKSTVVRCLRERI   26 (182)
T ss_dssp             EECSTTSSHHHHHHHHHHHS
T ss_pred             EECCCCCCHHHHHHHHHhhC
Confidence            89999999999999986653

>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: MJ0796
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=96.03  E-value=0.0011  Score=46.45  Aligned_cols=24  Identities=29%  Similarity=0.101  Sum_probs=19.6

Q ss_pred             CCcc-ccCcCCCchhHHHHhhhhhh
Q 042811           87 GNNW-PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        87 ~~l~-I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++. |+|..|+|||||++.+..-.
T Consensus        31 Ge~~~iiG~sGsGKSTLl~~i~gl~   55 (230)
T d1l2ta_          31 GEFVSIMGPSGSGKSTMLNIIGCLD   55 (230)
T ss_dssp             TCEEEEECSTTSSHHHHHHHHTTSS
T ss_pred             CCEEEEECCCCCCcchhhHhccCCC
Confidence            3344 99999999999999987743

>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Arsenite-translocating ATPase ArsA
species: Escherichia coli [TaxId: 562]

Probab=96.00  E-value=0.0011  Score=46.46  Aligned_cols=20  Identities=30%  Similarity=0.331  Sum_probs=17.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|-|||||||++-++-...
T Consensus        25 ~sGKGGVGKTT~a~nLA~~l   44 (279)
T d1ihua2          25 LMGKGGVGKTTMAAAIAVRL   44 (279)
T ss_dssp             EECSTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            78999999999988876655

>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Methionine import ATP-binding protein MetN
species: Escherichia coli [TaxId: 562]

Probab=96.00  E-value=0.001  Score=46.91  Aligned_cols=24  Identities=25%  Similarity=0.255  Sum_probs=19.9

Q ss_pred             CCcc-ccCcCCCchhHHHHhhhhhh
Q 042811           87 GNNW-PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        87 ~~l~-I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++. |.|..|+|||||++.++.-.
T Consensus        31 Ge~~~iiG~sGsGKSTLl~~i~Gl~   55 (240)
T d3dhwc1          31 GQIYGVIGASGAGKSTLIRCVNLLE   55 (240)
T ss_dssp             SCEEEEEESTTSSHHHHHHHHTTSS
T ss_pred             CCEEEEECCCCCCHHHHHHHHcCCc
Confidence            3444 99999999999999998754

>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Maltose transport protein MalK, N-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=95.99  E-value=0.0012  Score=46.34  Aligned_cols=24  Identities=29%  Similarity=0.116  Sum_probs=19.4

Q ss_pred             CCcc-ccCcCCCchhHHHHhhhhhh
Q 042811           87 GNNW-PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        87 ~~l~-I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++. |.|..|+|||||++.+..-.
T Consensus        26 Gei~~liGpsGsGKSTLl~~i~Gl~   50 (232)
T d2awna2          26 GEFVVFVGPSGCGKSTLLRMIAGLE   50 (232)
T ss_dssp             TCEEEEECCTTSSHHHHHHHHHTSS
T ss_pred             CCEEEEECCCCChHHHHHHHHhcCC
Confidence            3344 99999999999999986643

>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Circadian clock protein KaiC
species: Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]

Probab=95.98  E-value=0.002  Score=43.92  Aligned_cols=33  Identities=15%  Similarity=-0.005  Sum_probs=27.4

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR  126 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS  126 (130)
                      |+|-.|+|||||+..+-...   .+....++|++..
T Consensus        31 i~G~pGsGKT~l~~qia~~~---~~~~~~~~~is~e   63 (242)
T d1tf7a2          31 ATGATGTGKTLLVSRFVENA---CANKERAILFAYE   63 (242)
T ss_dssp             EEECTTSSHHHHHHHHHHHH---HTTTCCEEEEESS
T ss_pred             EEeCCCCCHHHHHHHHHHHH---HHhccccceeecc
Confidence            99999999999999988876   3567777887754

>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Peptide transporter Tap1, C-terminal ABC domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.98  E-value=0.0012  Score=46.71  Aligned_cols=20  Identities=25%  Similarity=0.235  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        45 ivG~sGsGKSTLl~li~gl~   64 (251)
T d1jj7a_          45 LVGPNGSGKSTVAALLQNLY   64 (251)
T ss_dssp             EECSTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCcHHHHHHHHhccc
Confidence            99999999999999987644

>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: SAR1
species: Chinese hamster (Cricetulus griseus) [TaxId: 10029]

Probab=95.95  E-value=0.00099  Score=43.18  Aligned_cols=22  Identities=23%  Similarity=0.226  Sum_probs=18.4

Q ss_pred             CccccCcCCCchhHHHHhhhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~~  109 (130)
                      ++.|+|..|+|||||+..+-..
T Consensus        15 kI~lvG~~~vGKTsLl~~l~~~   36 (186)
T d1f6ba_          15 KLVFLGLDNAGKTTLLHMLKDD   36 (186)
T ss_dssp             EEEEEEETTSSHHHHHHHHSCC
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            4559999999999999987553

>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Hypothetical protein PH0022, N-terminal domain
species: Pyrococcus horikoshii [TaxId: 53953]

Probab=95.93  E-value=0.0013  Score=46.31  Aligned_cols=20  Identities=30%  Similarity=0.245  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        37 liGpsGaGKSTLl~~i~Gl~   56 (239)
T d1v43a3          37 LLGPSGCGKTTTLRMIAGLE   56 (239)
T ss_dssp             EECCTTSSHHHHHHHHHTSS
T ss_pred             EECCCCChHHHHHHHHHcCC
Confidence            99999999999999987744

>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Molybdate/tungstate import ATP-binding protein WtpC (ModC)
species: Archaeoglobus fulgidus [TaxId: 2234]

Probab=95.90  E-value=0.0014  Score=46.21  Aligned_cols=20  Identities=25%  Similarity=0.172  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+..-.
T Consensus        29 liGpnGaGKSTll~~i~Gl~   48 (240)
T d2onka1          29 LLGPTGAGKSVFLELIAGIV   48 (240)
T ss_dssp             EECCTTSSHHHHHHHHHTSS
T ss_pred             EECCCCChHHHHHHHHHcCC
Confidence            89999999999999998754

>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab2b
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.89  E-value=0.0014  Score=42.78  Aligned_cols=21  Identities=29%  Similarity=0.215  Sum_probs=17.3

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+-++
T Consensus         6 ivvvG~~~vGKTsli~r~~~~   26 (173)
T d2a5ja1           6 YIIIGDTGVGKSCLLLQFTDK   26 (173)
T ss_dssp             EEEESSTTSSHHHHHHHHHHS
T ss_pred             EEEECCCCcCHHHHHHHHhcC
Confidence            448999999999999985443

>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab30
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.88  E-value=0.0013  Score=42.92  Aligned_cols=20  Identities=25%  Similarity=0.230  Sum_probs=17.1

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|.+|+|||||++.+.+
T Consensus         8 i~lvG~~~vGKTsLi~~l~~   27 (171)
T d2ew1a1           8 IVLIGNAGVGKTCLVRRFTQ   27 (171)
T ss_dssp             EEEEESTTSSHHHHHHHHHH
T ss_pred             EEEECCCCcCHHHHHHHHHh
Confidence            34899999999999998665

>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Maltose transport protein MalK, N-terminal domain
species: Archaeon Thermococcus litoralis [TaxId: 2265]

Probab=95.85  E-value=0.0014  Score=46.06  Aligned_cols=20  Identities=30%  Similarity=0.245  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        34 liG~sGaGKSTll~~i~gl~   53 (240)
T d1g2912          34 LLGPSGCGKTTTLRMIAGLE   53 (240)
T ss_dssp             EECSTTSSHHHHHHHHHTSS
T ss_pred             EECCCCChHHHHHHHHhcCC
Confidence            99999999999999997644

>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Multidrug resistance ABC transporter MsbA, C-terminal domain
species: Salmonella typhimurium [TaxId: 90371]

Probab=95.85  E-value=0.0012  Score=46.67  Aligned_cols=20  Identities=30%  Similarity=0.209  Sum_probs=17.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        46 ivG~sGsGKSTLl~ll~gl~   65 (253)
T d3b60a1          46 LVGRSGSGKSTIASLITRFY   65 (253)
T ss_dssp             EEECTTSSHHHHHHHHTTTT
T ss_pred             EECCCCChHHHHHHHHhccc
Confidence            99999999999999986643

>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: ATP(GTP)-binding protein PAB0955
species: Pyrococcus abyssi [TaxId: 29292]

Probab=95.85  E-value=0.0014  Score=44.53  Aligned_cols=17  Identities=29%  Similarity=0.229  Sum_probs=15.4

Q ss_pred             ccCcCCCchhHHHHhhh
Q 042811           91 PFGVEGVGKITSLSKSY  107 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~  107 (130)
                      |.|..|.|||||+..+-
T Consensus         5 v~G~~GsGKTTLl~~ll   21 (244)
T d1yrba1           5 FVGTAGSGKTTLTGEFG   21 (244)
T ss_dssp             EECSTTSSHHHHHHHHH
T ss_pred             EEcCCCCcHHHHHHHHH
Confidence            68999999999998874

>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: CMP kinase
species: Streptococcus pneumoniae [TaxId: 1313]

Probab=95.84  E-value=0.0016  Score=43.90  Aligned_cols=20  Identities=25%  Similarity=0.144  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |-|..|+||||+|+.+-+++
T Consensus         8 IdGp~GsGKgT~ak~La~~l   27 (223)
T d1q3ta_           8 IDGPASSGKSTVAKIIAKDF   27 (223)
T ss_dssp             EECSSCSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            66999999999999998766

>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab3a
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=95.83  E-value=0.0016  Score=42.44  Aligned_cols=20  Identities=25%  Similarity=0.174  Sum_probs=16.8

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.++|-.|+|||||+..+.+
T Consensus         8 i~vvG~~~vGKTsLi~~l~~   27 (169)
T d3raba_           8 ILIIGNSSVGKTSFLFRYAD   27 (169)
T ss_dssp             EEEECSTTSSHHHHHHHHHH
T ss_pred             EEEECCCCcCHHHHHHHHHc
Confidence            44899999999999997643

>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Mouse (Mus musculus), ARL3 [TaxId: 10090]

Probab=95.83  E-value=0.0012  Score=42.99  Aligned_cols=20  Identities=25%  Similarity=0.320  Sum_probs=17.2

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|.+|+|||||+..+.+
T Consensus        19 I~vvG~~~vGKSsLi~~l~~   38 (176)
T d1fzqa_          19 ILLLGLDNAGKTTLLKQLAS   38 (176)
T ss_dssp             EEEEESTTSSHHHHHHHHCC
T ss_pred             EEEECCCCCCHHHHHHHHhc
Confidence            44999999999999998754

>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab23
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=95.83  E-value=0.0016  Score=42.15  Aligned_cols=19  Identities=21%  Similarity=0.247  Sum_probs=15.8

Q ss_pred             cccCcCCCchhHHHHhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~  108 (130)
                      .++|..|+|||||+..+.+
T Consensus         6 ~liG~~~vGKSsLi~rl~~   24 (164)
T d1z2aa1           6 VVVGNGAVGKSSMIQRYCK   24 (164)
T ss_dssp             EEECSTTSSHHHHHHHHHH
T ss_pred             EEECCCCcCHHHHHHHHHh
Confidence            3799999999999986543

>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Haemolysin B ATP-binding protein
species: Escherichia coli [TaxId: 562]

Probab=95.82  E-value=0.0015  Score=45.89  Aligned_cols=20  Identities=25%  Similarity=0.165  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|-.|.|||||++.+..-.
T Consensus        34 IvG~sGsGKSTLl~ll~gl~   53 (241)
T d2pmka1          34 IVGRSGSGKSTLTKLIQRFY   53 (241)
T ss_dssp             EECSTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCCHHHHHHHHHhcC
Confidence            99999999999999987744

>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Multidrug resistance ABC transporter LmrA, C-terminal domain
species: Lactococcus lactis [TaxId: 1358]

Probab=95.81  E-value=0.0015  Score=45.84  Aligned_cols=20  Identities=30%  Similarity=0.144  Sum_probs=17.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        33 ivG~sGsGKSTLl~ll~gl~   52 (242)
T d1mv5a_          33 FAGPSGGGKSTIFSLLERFY   52 (242)
T ss_dssp             EECCTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCCHHHHHHHHHHhh
Confidence            99999999999999986543

>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rad
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.81  E-value=0.0016  Score=42.40  Aligned_cols=21  Identities=24%  Similarity=0.093  Sum_probs=17.3

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||++.+.+.
T Consensus         4 i~lvG~~~vGKTsLi~~~~~~   24 (168)
T d2gjsa1           4 VLLLGAPGVGKSALARIFGGV   24 (168)
T ss_dssp             EEEECCTTSSHHHHHHHHHTC
T ss_pred             EEEECCCCcCHHHHHHHHhCC
Confidence            347899999999999987543

>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Transducin (alpha subunit)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=95.80  E-value=0.0016  Score=43.12  Aligned_cols=18  Identities=28%  Similarity=0.228  Sum_probs=16.1

Q ss_pred             ccccCcCCCchhHHHHhh
Q 042811           89 NWPFGVEGVGKITSLSKS  106 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v  106 (130)
                      +.|+|-+|+|||||++..
T Consensus         5 ivllG~~~vGKTsll~r~   22 (200)
T d1zcba2           5 ILLLGAGESGKSTFLKQM   22 (200)
T ss_dssp             EEEECSTTSSHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            448999999999999987

>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: di-Ras2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.78  E-value=0.0017  Score=42.20  Aligned_cols=20  Identities=30%  Similarity=0.345  Sum_probs=16.2

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|-+|+|||||+..+-+
T Consensus         5 i~viG~~~vGKTsLi~r~~~   24 (171)
T d2erxa1           5 VAVFGAGGVGKSSLVLRFVK   24 (171)
T ss_dssp             EEEECCTTSSHHHHHHHHHT
T ss_pred             EEEECCCCCCHHHHHHHHHh
Confidence            34899999999999987443

>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Thermus thermophilus [TaxId: 274]

Probab=95.75  E-value=0.0018  Score=45.51  Aligned_cols=22  Identities=27%  Similarity=0.164  Sum_probs=19.5

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++++|..|+|||+||+.+.+..
T Consensus        45 iLl~GppGtGKT~la~aia~~~   66 (247)
T d1ixza_          45 VLLVGPPGVGKTHLARAVAGEA   66 (247)
T ss_dssp             EEEECCTTSSHHHHHHHHHHHT
T ss_pred             EEEecCCCCChhHHHHHHHHHc
Confidence            3599999999999999999865

>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab6
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.75  E-value=0.0016  Score=42.07  Aligned_cols=19  Identities=21%  Similarity=0.272  Sum_probs=16.1

Q ss_pred             ccccCcCCCchhHHHHhhh
Q 042811           89 NWPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~  107 (130)
                      +.|+|..|+|||||+..+-
T Consensus         3 v~vvG~~~vGKTsLi~r~~   21 (164)
T d1yzqa1           3 LVFLGEQSVGKTSLITRFM   21 (164)
T ss_dssp             EEEEESTTSSHHHHHHHHH
T ss_pred             EEEECCCCcCHHHHHHHHH
Confidence            3478999999999999854

>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Transducin (alpha subunit)
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=95.75  E-value=0.0018  Score=42.40  Aligned_cols=21  Identities=19%  Similarity=0.056  Sum_probs=17.2

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.++|-+|+|||||++..-.+
T Consensus         5 ivllG~~~vGKTsl~~r~~~~   25 (195)
T d1svsa1           5 LLLLGAGESGKSTIVKQMKII   25 (195)
T ss_dssp             EEEECSTTSSHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHhhC
Confidence            348999999999999986443

>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab14
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.71  E-value=0.0019  Score=41.87  Aligned_cols=20  Identities=30%  Similarity=0.209  Sum_probs=16.5

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|-+|+|||||+..+-+
T Consensus         7 ivlvG~~~vGKTsli~~~~~   26 (166)
T d1z0fa1           7 YIIIGDMGVGKSCLLHQFTE   26 (166)
T ss_dssp             EEEECSTTSSHHHHHHHHHH
T ss_pred             EEEECCCCcCHHHHHHHHHh
Confidence            34899999999999987543

>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=95.71  E-value=0.0016  Score=46.81  Aligned_cols=20  Identities=30%  Similarity=0.295  Sum_probs=18.2

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        67 ivG~nGsGKSTLl~~i~Gl~   86 (281)
T d1r0wa_          67 ITGSTGSGKTSLLMLILGEL   86 (281)
T ss_dssp             EEESTTSSHHHHHHHHHTSS
T ss_pred             EECCCCChHHHHHHHHhCCC
Confidence            99999999999999997654

>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: ATP-binding subunit of the histidine permease
species: Salmonella typhimurium [TaxId: 90371]

Probab=95.70  E-value=0.0018  Score=45.99  Aligned_cols=25  Identities=28%  Similarity=0.126  Sum_probs=20.1

Q ss_pred             CCCcc-ccCcCCCchhHHHHhhhhhh
Q 042811           86 NGNNW-PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        86 ~~~l~-I~GmGGvGKTTLak~v~~~~  110 (130)
                      ..++. |+|..|+|||||++.+..-.
T Consensus        27 ~GEi~~iiG~sGsGKSTLl~~i~Gl~   52 (258)
T d1b0ua_          27 AGDVISIIGSSGSGKSTFLRCINFLE   52 (258)
T ss_dssp             TTCEEEEECCTTSSHHHHHHHHTTSS
T ss_pred             CCCEEEEECCCCCcHHHHHHHHHcCc
Confidence            33444 99999999999999997743

>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab-22a
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=95.69  E-value=0.0019  Score=41.85  Aligned_cols=19  Identities=26%  Similarity=0.314  Sum_probs=16.4

Q ss_pred             cccCcCCCchhHHHHhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~  108 (130)
                      .|+|-.|+|||||+..+-+
T Consensus         8 ~lvG~~~vGKTsli~rl~~   26 (167)
T d1z0ja1           8 CLLGDTGVGKSSIMWRFVE   26 (167)
T ss_dssp             EEECCTTSSHHHHHHHHHH
T ss_pred             EEECCCCcCHHHHHHHHHh
Confidence            3899999999999988654

>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=95.68  E-value=0.0018  Score=43.18  Aligned_cols=21  Identities=29%  Similarity=0.373  Sum_probs=18.4

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +|.|+.|+||||+|+.+-+..
T Consensus        12 ~l~G~pGSGKsT~a~~La~~~   32 (194)
T d3adka_          12 FVVGGPGSGKGTQCEKIVQKY   32 (194)
T ss_dssp             EEEECTTSSHHHHHHHHHHHT
T ss_pred             EEECCCCCCHHHHHHHHHHHh
Confidence            389999999999999997754

>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab21
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.65  E-value=0.002  Score=41.75  Aligned_cols=19  Identities=21%  Similarity=0.156  Sum_probs=16.2

Q ss_pred             ccccCcCCCchhHHHHhhh
Q 042811           89 NWPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~  107 (130)
                      +.|+|-.|+|||||+..+-
T Consensus         6 ivlvG~~~vGKTsLi~r~~   24 (167)
T d1z08a1           6 VVLLGEGCVGKTSLVLRYC   24 (167)
T ss_dssp             EEEECCTTSCHHHHHHHHH
T ss_pred             EEEECCCCcCHHHHHHHHH
Confidence            4489999999999999754

>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab5a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.57  E-value=0.0023  Score=41.60  Aligned_cols=19  Identities=21%  Similarity=0.156  Sum_probs=16.4

Q ss_pred             ccccCcCCCchhHHHHhhh
Q 042811           89 NWPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~  107 (130)
                      +.|+|..|+|||||+..+-
T Consensus         9 i~vvG~~~vGKTsLi~~l~   27 (170)
T d1r2qa_           9 LVLLGESAVGKSSLVLRFV   27 (170)
T ss_dssp             EEEECSTTSSHHHHHHHHH
T ss_pred             EEEECCCCcCHHHHHHHHH
Confidence            4489999999999998865

>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Thymidylate kinase
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=95.56  E-value=0.0024  Score=42.63  Aligned_cols=19  Identities=37%  Similarity=0.358  Sum_probs=16.1

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |-|.-|+||||+++.+.+.
T Consensus         5 ieG~dGsGKST~~~~L~~~   23 (208)
T d1gsia_           5 IEGVDGAGKRTLVEKLSGA   23 (208)
T ss_dssp             EECSTTSSHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHH
Confidence            5699999999999987653

>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Dephospho-CoA kinase
species: Thermus thermophilus [TaxId: 274]

Probab=95.54  E-value=0.002  Score=42.73  Aligned_cols=18  Identities=28%  Similarity=0.119  Sum_probs=15.6

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |.|+.|+||||+|+.+-+
T Consensus         8 itG~~gSGKstva~~l~~   25 (191)
T d1uf9a_           8 ITGNIGSGKSTVAALLRS   25 (191)
T ss_dssp             EEECTTSCHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHH
Confidence            789999999999987643

>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: r-Ras2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.53  E-value=0.0021  Score=41.81  Aligned_cols=20  Identities=25%  Similarity=0.109  Sum_probs=16.8

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|..|+|||||+..+-+
T Consensus         8 i~lvG~~~vGKTsLi~r~~~   27 (171)
T d2erya1           8 LVVVGGGGVGKSALTIQFIQ   27 (171)
T ss_dssp             EEEEECTTSSHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHh
Confidence            55999999999999987544

>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative multidrug export ATP-binding/permease protein SAV1866
species: Staphylococcus aureus [TaxId: 1280]

Probab=95.52  E-value=0.0018  Score=45.85  Aligned_cols=20  Identities=25%  Similarity=0.225  Sum_probs=17.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||++.+..-.
T Consensus        49 ivG~sGsGKSTLl~ll~gl~   68 (255)
T d2hyda1          49 FVGMSGGGKSTLINLIPRFY   68 (255)
T ss_dssp             EECSTTSSHHHHHTTTTTSS
T ss_pred             EECCCCCcHHHHHHHHHhcC
Confidence            99999999999999986543

>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: SAR1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=95.51  E-value=0.0024  Score=40.20  Aligned_cols=21  Identities=24%  Similarity=0.251  Sum_probs=17.4

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.++|..|+|||||+..+-+.
T Consensus         3 I~liG~~nvGKSSLln~l~~~   23 (166)
T d2qtvb1           3 LLFLGLDNAGKTTLLHMLKND   23 (166)
T ss_dssp             EEEECSTTSSHHHHHHHHHHS
T ss_pred             EEEECCCCCCHHHHHHHHhCC
Confidence            447999999999999887543

>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Dethiobiotin synthetase
species: Escherichia coli [TaxId: 562]

Probab=95.48  E-value=0.0021  Score=42.81  Aligned_cols=21  Identities=19%  Similarity=0.237  Sum_probs=17.8

Q ss_pred             cccCcC-CCchhHHHHhhhhhh
Q 042811           90 WPFGVE-GVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmG-GvGKTTLak~v~~~~  110 (130)
                      .|.|-| ||||||++-.+-.-+
T Consensus         5 ~i~gt~~GVGKTtvs~~La~aL   26 (224)
T d1byia_           5 FVTGTDTEVGKTVASCALLQAA   26 (224)
T ss_dssp             EEEESSTTSCHHHHHHHHHHHH
T ss_pred             EEEECCCCccHHHHHHHHHHHH
Confidence            378998 999999998887766

>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab-related protein ypt7p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=95.47  E-value=0.0026  Score=41.34  Aligned_cols=18  Identities=28%  Similarity=0.416  Sum_probs=15.8

Q ss_pred             cccCcCCCchhHHHHhhh
Q 042811           90 WPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~  107 (130)
                      .|+|-.|+|||||+..+-
T Consensus         6 ~~vG~~~vGKSsLi~~~~   23 (175)
T d1ky3a_           6 IILGDSGVGKTSLMHRYV   23 (175)
T ss_dssp             EEECCTTSSHHHHHHHHH
T ss_pred             EEECCCCcCHHHHHHHHH
Confidence            489999999999999854

>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase Der, N-terminal and middle domains
species: Thermotoga maritima [TaxId: 2336]

Probab=95.46  E-value=0.0025  Score=41.37  Aligned_cols=18  Identities=33%  Similarity=0.300  Sum_probs=16.2

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |+|..|+|||||+..+.+
T Consensus         5 liG~~n~GKSsLi~~L~~   22 (171)
T d1mkya1           5 IVGRPNVGKSTLFNKLVK   22 (171)
T ss_dssp             EECCTTSSHHHHHHHHHC
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            789999999999999854

>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Deoxycytidine kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.45  E-value=0.0023  Score=43.53  Aligned_cols=20  Identities=20%  Similarity=-0.062  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |-|.-|+||||+++.+.+..
T Consensus         7 ieG~dGsGKST~~~~L~~~l   26 (241)
T d1p5zb_           7 IEGNIAAGKSTFVNILKQLC   26 (241)
T ss_dssp             EECSTTSSHHHHHTTTGGGC
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            77999999999999998765

>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab-related protein Sec4
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=95.45  E-value=0.0023  Score=41.34  Aligned_cols=21  Identities=29%  Similarity=0.295  Sum_probs=17.2

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.++|..|+|||||+..+.+.
T Consensus         5 i~vvG~~~vGKTSli~~l~~~   25 (166)
T d1g16a_           5 ILLIGDSGVGKSCLLVRFVED   25 (166)
T ss_dssp             EEEEESTTSSHHHHHHHHHHC
T ss_pred             EEEECCCCcCHHHHHHHHHhC
Confidence            348999999999999986543

>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab4a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.45  E-value=0.0023  Score=41.65  Aligned_cols=19  Identities=26%  Similarity=0.240  Sum_probs=16.3

Q ss_pred             ccccCcCCCchhHHHHhhh
Q 042811           89 NWPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~  107 (130)
                      +.++|..|+|||||+..+-
T Consensus         8 I~lvG~~~vGKTsll~~~~   26 (174)
T d2bmea1           8 FLVIGNAGTGKSCLLHQFI   26 (174)
T ss_dssp             EEEEESTTSSHHHHHHHHH
T ss_pred             EEEECCCCcCHHHHHHHHH
Confidence            4489999999999999854

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

Probab=95.45  E-value=0.0027  Score=44.84  Aligned_cols=22  Identities=23%  Similarity=0.089  Sum_probs=19.5

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++++|..|+|||+||+.+-+..
T Consensus        48 iLL~GppGtGKT~la~~iA~~~   69 (256)
T d1lv7a_          48 VLMVGPPGTGKTLLAKAIAGEA   69 (256)
T ss_dssp             EEEECCTTSCHHHHHHHHHHHH
T ss_pred             EEeeCCCCCCccHHHHHHHHHc
Confidence            3499999999999999998865

>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase
species: Escherichia coli [TaxId: 562]

Probab=95.42  E-value=0.0027  Score=43.26  Aligned_cols=20  Identities=15%  Similarity=0.096  Sum_probs=17.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|+|||||.+.+....
T Consensus         7 i~GPSG~GK~tl~~~L~~~~   26 (205)
T d1s96a_           7 VSAPSGAGKSSLIQALLKTQ   26 (205)
T ss_dssp             EECCTTSCHHHHHHHHHHHS
T ss_pred             EECCCCCCHHHHHHHHHhhC
Confidence            89999999999999987654

>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: r-Ras
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.39  E-value=0.0025  Score=41.62  Aligned_cols=20  Identities=25%  Similarity=0.109  Sum_probs=16.6

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|-.|+|||||+..+-+
T Consensus         9 v~lvG~~~vGKTsLi~r~~~   28 (173)
T d2fn4a1           9 LVVVGGGGVGKSALTIQFIQ   28 (173)
T ss_dssp             EEEEECTTSSHHHHHHHHHH
T ss_pred             EEEECCCCcCHHHHHHHHHh
Confidence            44899999999999987543

>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Human (Homo sapiens), ARL5A [TaxId: 9606]

Probab=95.38  E-value=0.0027  Score=41.10  Aligned_cols=21  Identities=24%  Similarity=0.199  Sum_probs=17.5

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|-.|+|||||+..+-+.
T Consensus        18 I~vvG~~~~GKSsLi~rl~~~   38 (177)
T d1zj6a1          18 VIIVGLDNAGKTTILYQFSMN   38 (177)
T ss_dssp             EEEEESTTSSHHHHHHHHHTT
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            449999999999999986543

>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Cell division protein MukB
species: Escherichia coli [TaxId: 562]

Probab=95.37  E-value=0.0016  Score=42.35  Aligned_cols=17  Identities=29%  Similarity=0.343  Sum_probs=16.1

Q ss_pred             ccCcCCCchhHHHHhhh
Q 042811           91 PFGVEGVGKITSLSKSY  107 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~  107 (130)
                      |+|..|+|||||+..|.
T Consensus        29 i~G~NGsGKStil~Ai~   45 (222)
T d1qhla_          29 LSGGNGAGKSTTMAAFV   45 (222)
T ss_dssp             HHSCCSHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHH
Confidence            99999999999999985

>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Ras-like estrogen-regulated growth inhibitor, RERG
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.37  E-value=0.0029  Score=41.07  Aligned_cols=19  Identities=32%  Similarity=0.399  Sum_probs=16.3

Q ss_pred             cccCcCCCchhHHHHhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~  108 (130)
                      .++|-+|+|||+|+....+
T Consensus         6 ~lvG~~~vGKTsli~r~~~   24 (168)
T d2atva1           6 AIFGRAGVGKSALVVRFLT   24 (168)
T ss_dssp             EEECCTTSSHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHh
Confidence            3899999999999998654

>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rap1A
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.33  E-value=0.0031  Score=40.83  Aligned_cols=19  Identities=26%  Similarity=0.198  Sum_probs=16.2

Q ss_pred             ccccCcCCCchhHHHHhhh
Q 042811           89 NWPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~  107 (130)
                      +.|+|-.|||||+|+..+-
T Consensus         6 ivvvG~~~vGKTsli~r~~   24 (167)
T d1c1ya_           6 LVVLGSGGVGKSALTVQFV   24 (167)
T ss_dssp             EEEECSTTSSHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            3489999999999999853

>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative ABC transporter TM0544
species: Thermotoga maritima [TaxId: 2336]

Probab=95.33  E-value=0.003  Score=44.25  Aligned_cols=20  Identities=30%  Similarity=0.345  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+..-.
T Consensus        33 lvG~nGaGKSTLl~~l~G~~   52 (238)
T d1vpla_          33 LIGPNGAGKTTTLRIISTLI   52 (238)
T ss_dssp             EECCTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            99999999999999987754

>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rac
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.32  E-value=0.0031  Score=41.47  Aligned_cols=20  Identities=25%  Similarity=0.101  Sum_probs=16.5

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|-.|||||||+..+-+
T Consensus         8 ivviG~~~vGKTsli~~~~~   27 (183)
T d1mh1a_           8 CVVVGDGAVGKTCLLISYTT   27 (183)
T ss_dssp             EEEECSTTSSHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHh
Confidence            44899999999999977543

>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTPase Ytp1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=95.31  E-value=0.0027  Score=42.27  Aligned_cols=21  Identities=29%  Similarity=0.270  Sum_probs=17.4

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|-.|+|||||+..+.+.
T Consensus         9 ivvvG~~~vGKTsli~~l~~~   29 (194)
T d2bcgy1           9 LLLIGNSGVGKSCLLLRFSDD   29 (194)
T ss_dssp             EEEEESTTSSHHHHHHHHHHC
T ss_pred             EEEECCCCcCHHHHHHHHhhC
Confidence            348999999999999986543

>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Thymidylate kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.30  E-value=0.0049  Score=41.89  Aligned_cols=27  Identities=22%  Similarity=0.065  Sum_probs=21.2

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCe
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLI  119 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~  119 (130)
                      |-|.-|+||||+++.+.+.. +. ..+++
T Consensus         8 ieG~dGsGKsT~~~~L~~~L-~~-~g~~v   34 (209)
T d1nn5a_           8 LEGVDRAGKSTQSRKLVEAL-CA-AGHRA   34 (209)
T ss_dssp             EEESTTSSHHHHHHHHHHHH-HH-TTCCE
T ss_pred             EECCCCCCHHHHHHHHHHHH-HH-CCCcE
Confidence            56999999999999999977 32 34444

>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab18
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.30  E-value=0.0032  Score=41.19  Aligned_cols=19  Identities=32%  Similarity=0.338  Sum_probs=16.4

Q ss_pred             cccCcCCCchhHHHHhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~  108 (130)
                      .++|-.|+|||||++.+-+
T Consensus        11 ~vvG~~~vGKTsli~~l~~   29 (177)
T d1x3sa1          11 LIIGESGVGKSSLLLRFTD   29 (177)
T ss_dssp             EEECSTTSSHHHHHHHHHH
T ss_pred             EEECCCCcCHHHHHHHHHh
Confidence            4899999999999998644

>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab27b
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.28  E-value=0.0031  Score=41.48  Aligned_cols=20  Identities=35%  Similarity=0.363  Sum_probs=16.9

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|-.|+|||||+..+-+
T Consensus         8 i~ivG~~~vGKTsLi~~l~~   27 (186)
T d2f7sa1           8 LLALGDSGVGKTTFLYRYTD   27 (186)
T ss_dssp             EEEESCTTSSHHHHHHHHHC
T ss_pred             EEEECCCCcCHHHHHHHHhc
Confidence            34899999999999988654

>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Sulfate/molybdate ABC transporter, ATP-binding protein
species: Methanosarcina acetivorans [TaxId: 2214]

Probab=95.26  E-value=0.002  Score=44.97  Aligned_cols=24  Identities=25%  Similarity=0.253  Sum_probs=19.7

Q ss_pred             CCcc-ccCcCCCchhHHHHhhhhhh
Q 042811           87 GNNW-PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        87 ~~l~-I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++. |+|..|+|||||++.+..-.
T Consensus        26 Ge~~~liGpsGaGKSTll~~l~Gl~   50 (229)
T d3d31a2          26 GEYFVILGPTGAGKTLFLELIAGFH   50 (229)
T ss_dssp             TCEEEEECCCTHHHHHHHHHHHTSS
T ss_pred             CCEEEEECCCCCcHHHHHHHHhcCc
Confidence            3344 99999999999999997743

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Membrane fusion ATPase VCP/p97
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=95.26  E-value=0.0032  Score=44.19  Aligned_cols=22  Identities=23%  Similarity=0.181  Sum_probs=19.3

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++++|..|+|||+||+.+-+..
T Consensus        41 iLL~GppGtGKT~l~~ala~~~   62 (258)
T d1e32a2          41 ILLYGPPGTGKTLIARAVANET   62 (258)
T ss_dssp             EEEECCTTSSHHHHHHHHHHHT
T ss_pred             eEEecCCCCCchHHHHHHHHHh
Confidence            3589999999999999998855

>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: RhoA
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.26  E-value=0.0029  Score=41.33  Aligned_cols=21  Identities=19%  Similarity=0.028  Sum_probs=17.0

Q ss_pred             CccccCcCCCchhHHHHhhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~  108 (130)
                      ++.|+|-.|+|||||+..+-+
T Consensus         4 KivvvG~~~vGKTsLi~~~~~   24 (177)
T d1kmqa_           4 KLVIVGDGACGKTCLLIVNSK   24 (177)
T ss_dssp             EEEEEESTTSSHHHHHHHHHH
T ss_pred             EEEEECCCCcCHHHHHHHHHh
Confidence            345899999999999987544

>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Branched chain aminoacid ABC transporter
species: Thermotoga maritima, TM1139 [TaxId: 2336]

Probab=95.25  E-value=0.0033  Score=44.06  Aligned_cols=20  Identities=35%  Similarity=0.396  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|.|||||++.+..-.
T Consensus        37 liGpnGaGKSTl~~~i~Gl~   56 (240)
T d1ji0a_          37 LIGANGAGKTTTLSAIAGLV   56 (240)
T ss_dssp             EECSTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCcHHHHHHHHhCCC
Confidence            99999999999999998754

>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Deoxyguanosine kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.23  E-value=0.0029  Score=43.19  Aligned_cols=20  Identities=25%  Similarity=0.119  Sum_probs=17.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |=|.-|+||||+++.+.+.+
T Consensus         7 iEG~~GsGKST~~~~L~~~l   26 (241)
T d2ocpa1           7 IEGNIAVGKSTFVKLLTKTY   26 (241)
T ss_dssp             EEECTTSSHHHHHHHHHHHC
T ss_pred             EECCCCCcHHHHHHHHHHHH
Confidence            56899999999999998765

>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rap2a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.23  E-value=0.0035  Score=40.49  Aligned_cols=20  Identities=25%  Similarity=0.204  Sum_probs=16.7

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|-.|+|||||+..+-+
T Consensus         6 i~lvG~~~vGKTsLi~r~~~   25 (167)
T d1kaoa_           6 VVVLGSGGVGKSALTVQFVT   25 (167)
T ss_dssp             EEEECCTTSSHHHHHHHHHH
T ss_pred             EEEECCCCcCHHHHHHHHHh
Confidence            34899999999999988654

>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: ABC transporter involved in vitamin B12 uptake, BtuD
species: Escherichia coli [TaxId: 562]

Probab=95.21  E-value=0.0037  Score=43.45  Aligned_cols=18  Identities=33%  Similarity=0.394  Sum_probs=17.1

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |+|..|.|||||++.+..
T Consensus        30 iiG~nGaGKSTLl~~l~G   47 (231)
T d1l7vc_          30 LVGPNGAGKSTLLARMAG   47 (231)
T ss_dssp             CBCCTTSSHHHHHHHHHT
T ss_pred             EECCCCCcHHHHHHHHhC
Confidence            999999999999999876

>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: DNA repair protein Rad51, catalytic domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=95.20  E-value=0.0097  Score=39.89  Aligned_cols=36  Identities=14%  Similarity=-0.218  Sum_probs=23.3

Q ss_pred             ccCcCCCchhHHHHhhhhhhhh---ccCCCCeEEEEEeC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLE---DEGIFLIKMHDVVR  126 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~---~~~~Fd~~~wv~VS  126 (130)
                      |+|-.|+|||||+-.+-.....   ....=..++|+...
T Consensus        39 i~G~pGsGKT~l~lq~~~~~~~~~~~~~~~~~~~~i~~~   77 (251)
T d1szpa2          39 LFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTE   77 (251)
T ss_dssp             EEESTTSSHHHHHHHHTTTTTSCTTTTCCSCEEEEEESS
T ss_pred             EEcCCCCCHHHHHHHHHHHhhhhhhhccCCceEEEEeec
Confidence            9999999999999776443311   01112356777655

>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTP-binding protein GEM
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.18  E-value=0.0035  Score=40.90  Aligned_cols=20  Identities=30%  Similarity=0.164  Sum_probs=16.7

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.++|-.|+|||||++.+..
T Consensus         6 v~lvG~~~vGKTsLi~~~~~   25 (172)
T d2g3ya1           6 VVLIGEQGVGKSTLANIFAG   25 (172)
T ss_dssp             EEEECCTTSSHHHHHHHHHC
T ss_pred             EEEECCCCcCHHHHHHHHHh
Confidence            44899999999999988643

>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: cH-p21 Ras protein
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.18  E-value=0.0032  Score=40.68  Aligned_cols=21  Identities=24%  Similarity=0.183  Sum_probs=17.2

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.++|-.|+|||||+..+.++
T Consensus         6 i~viG~~~vGKTsli~~l~~~   26 (166)
T d1ctqa_           6 LVVVGAGGVGKSALTIQLIQN   26 (166)
T ss_dssp             EEEEESTTSSHHHHHHHHHHC
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            348999999999999876543

>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab11b
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.17  E-value=0.0037  Score=40.76  Aligned_cols=20  Identities=35%  Similarity=0.293  Sum_probs=16.9

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|-.|+|||||+..+-+
T Consensus         7 i~vvG~~~vGKTsLi~~~~~   26 (175)
T d2f9la1           7 VVLIGDSGVGKSNLLSRFTR   26 (175)
T ss_dssp             EEEESSTTSSHHHHHHHHHH
T ss_pred             EEEECCCCcCHHHHHHHHHh
Confidence            44899999999999998644

>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Human (Homo sapiens), ARF6 [TaxId: 9606]

Probab=95.13  E-value=0.0026  Score=41.41  Aligned_cols=21  Identities=29%  Similarity=0.251  Sum_probs=17.8

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.++|..|+|||||+..+-+.
T Consensus        15 IvlvG~~~vGKTSli~rl~~~   35 (173)
T d1e0sa_          15 ILMLGLDAAGKTTILYKLKLG   35 (173)
T ss_dssp             EEEEEETTSSHHHHHHHTTCC
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            448999999999999998543

>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: MJ1267
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=95.13  E-value=0.0036  Score=44.12  Aligned_cols=20  Identities=25%  Similarity=0.217  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|..|.|||||++.+..-.
T Consensus        35 liG~nGaGKSTLl~~i~Gl~   54 (254)
T d1g6ha_          35 IIGPNGSGKSTLINVITGFL   54 (254)
T ss_dssp             EECSTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCcHHHHHHHHHCCC
Confidence            99999999999999998754

>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Obg GTP-binding protein middle domain
species: Thermus thermophilus [TaxId: 274]

Probab=95.13  E-value=0.0024  Score=41.78  Aligned_cols=21  Identities=19%  Similarity=0.082  Sum_probs=17.6

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +-|+|..|+|||||+..+.+.
T Consensus         4 VaivG~~nvGKSTLin~L~~~   24 (180)
T d1udxa2           4 VGLVGYPNAGKSSLLAAMTRA   24 (180)
T ss_dssp             EEEECCGGGCHHHHHHHHCSS
T ss_pred             EEEECCCCCCHHHHHHHHhCC
Confidence            347899999999999998653

>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab7
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=95.12  E-value=0.0039  Score=40.97  Aligned_cols=20  Identities=25%  Similarity=0.321  Sum_probs=16.6

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.++|-.|+|||||+..+-+
T Consensus         5 v~vvG~~~vGKSSLi~~l~~   24 (184)
T d1vg8a_           5 VIILGDSGVGKTSLMNQYVN   24 (184)
T ss_dssp             EEEECCTTSSHHHHHHHHHH
T ss_pred             EEEECCCCcCHHHHHHHHHh
Confidence            34899999999999987654

>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Transducin (alpha subunit)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=95.12  E-value=0.0035  Score=41.10  Aligned_cols=19  Identities=21%  Similarity=0.158  Sum_probs=16.2

Q ss_pred             ccccCcCCCchhHHHHhhh
Q 042811           89 NWPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~  107 (130)
                      +++.|-+|||||||+..+-
T Consensus         5 iv~lG~~~vGKTsll~r~~   23 (200)
T d2bcjq2           5 LLLLGTGESGKSTFIKQMR   23 (200)
T ss_dssp             EEEEESTTSSHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3488999999999999863

>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTPase Era, N-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=95.12  E-value=0.004  Score=40.36  Aligned_cols=20  Identities=35%  Similarity=0.273  Sum_probs=17.7

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|-.|+|||||...+.+.
T Consensus         9 ~iiG~~nvGKSSLin~L~~~   28 (179)
T d1egaa1           9 AIVGRPNVGKSTLLNKLLGQ   28 (179)
T ss_dssp             EEECSSSSSHHHHHHHHHTC
T ss_pred             EEECCCCCCHHHHHHHHhCC
Confidence            48999999999999999763

>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTP-binding protein RheB
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.11  E-value=0.0035  Score=40.49  Aligned_cols=22  Identities=23%  Similarity=0.155  Sum_probs=17.8

Q ss_pred             ccccCcCCCchhHHHHhh-hhhh
Q 042811           89 NWPFGVEGVGKITSLSKS-YPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v-~~~~  110 (130)
                      +.|+|-.|+|||||+..+ ++.+
T Consensus         7 v~liG~~~vGKTsLl~~~~~~~f   29 (167)
T d1xtqa1           7 IAILGYRSVGKSSLTIQFVEGQF   29 (167)
T ss_dssp             EEEEESTTSSHHHHHHHHHHSCC
T ss_pred             EEEECCCCcCHHHHHHHHHhCCC
Confidence            448999999999999985 4544

>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Ypt51
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=95.10  E-value=0.004  Score=40.31  Aligned_cols=18  Identities=22%  Similarity=0.222  Sum_probs=15.6

Q ss_pred             cccCcCCCchhHHHHhhh
Q 042811           90 WPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~  107 (130)
                      .|+|..|+|||||+..+-
T Consensus         7 ~vvG~~~vGKTsLi~~~~   24 (170)
T d1ek0a_           7 VLLGEAAVGKSSIVLRFV   24 (170)
T ss_dssp             EEECSTTSSHHHHHHHHH
T ss_pred             EEECCCCcCHHHHHHHHH
Confidence            389999999999999744

>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Human (Homo sapiens), ARL8A [TaxId: 9606]

Probab=95.10  E-value=0.004  Score=40.12  Aligned_cols=19  Identities=21%  Similarity=0.102  Sum_probs=16.1

Q ss_pred             cccCcCCCchhHHHHhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~  108 (130)
                      .++|..|+|||||+..+-+
T Consensus         6 ~i~G~~~~GKTsLl~~l~~   24 (164)
T d1zd9a1           6 TLVGLQYSGKTTFVNVIAS   24 (164)
T ss_dssp             EEECSTTSSHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHc
Confidence            3789999999999997644

>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: RhoQ
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.09  E-value=0.0035  Score=41.38  Aligned_cols=20  Identities=25%  Similarity=0.086  Sum_probs=16.6

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|-.|+|||||+..+-+
T Consensus        12 i~lvG~~~vGKTsLi~r~~~   31 (185)
T d2atxa1          12 CVVVGDGAVGKTCLLMSYAN   31 (185)
T ss_dssp             EEEEECTTSSHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHhh
Confidence            44999999999999987443

>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Transducin (alpha subunit)
species: Cow (Bos taurus) [TaxId: 9913]

Probab=95.07  E-value=0.0038  Score=42.61  Aligned_cols=20  Identities=20%  Similarity=0.109  Sum_probs=17.0

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +++.|-+|+|||||++.+..
T Consensus         9 illlG~~~vGKTsll~~~~~   28 (221)
T d1azta2           9 LLLLGAGESGKSTIVKQMRI   28 (221)
T ss_dssp             EEEECSTTSSHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHhc
Confidence            45899999999999998643

>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Ran
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.06  E-value=0.0029  Score=41.25  Aligned_cols=20  Identities=25%  Similarity=0.253  Sum_probs=16.3

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|..|+|||||+..+.+
T Consensus         6 i~vvG~~~vGKTsli~~~~~   25 (170)
T d1i2ma_           6 LVLVGDGGTGKTTFVKRHLT   25 (170)
T ss_dssp             EEEEECTTSSHHHHHHTTC-
T ss_pred             EEEECCCCcCHHHHHHHHHh
Confidence            44889999999999998644

>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]

Probab=95.06  E-value=0.0029  Score=41.46  Aligned_cols=20  Identities=30%  Similarity=0.368  Sum_probs=17.1

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.++|..|+|||||+..+.+
T Consensus        20 I~lvG~~~vGKTsLi~~l~~   39 (182)
T d1moza_          20 ILILGLDGAGKTTILYRLQI   39 (182)
T ss_dssp             EEEEEETTSSHHHHHHHTCC
T ss_pred             EEEECCCCCCHHHHHHHHhc
Confidence            34999999999999998744

>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: GTPase domain of the signal sequence recognition protein Ffh
species: Thermus aquaticus [TaxId: 271]

Probab=95.06  E-value=0.006  Score=41.75  Aligned_cols=20  Identities=30%  Similarity=0.428  Sum_probs=17.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+||||.+.++-..+
T Consensus        15 lvGp~GvGKTTTiaKLA~~~   34 (207)
T d1ls1a2          15 LVGLQGSGKTTTAAKLALYY   34 (207)
T ss_dssp             EECCTTTTHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            79999999998888877666

>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Cell division regulator MinD
species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]

Probab=94.99  E-value=0.0043  Score=41.88  Aligned_cols=19  Identities=26%  Similarity=0.221  Sum_probs=15.9

Q ss_pred             cCcCCCchhHHHHhhhhhh
Q 042811           92 FGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        92 ~GmGGvGKTTLak~v~~~~  110 (130)
                      -|-||+||||+|..+-.-.
T Consensus         8 s~KGGvGKTtia~nlA~~l   26 (232)
T d1hyqa_           8 SGKGGTGKTTITANLGVAL   26 (232)
T ss_dssp             ESSSCSCHHHHHHHHHHHH
T ss_pred             CCCCCChHHHHHHHHHHHH
Confidence            3789999999999876655

>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Ras-related protein M-Ras (XRas)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=94.98  E-value=0.0045  Score=40.22  Aligned_cols=21  Identities=24%  Similarity=0.221  Sum_probs=17.3

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.++|-.|+|||||+..+.++
T Consensus         7 i~lvG~~~vGKTsll~~~~~~   27 (169)
T d1x1ra1           7 LVVVGDGGVGKSALTIQFFQK   27 (169)
T ss_dssp             EEEECCTTSSHHHHHHHHHHS
T ss_pred             EEEECCCCcCHHHHHHHHHhC
Confidence            347899999999999986553

>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Hypothetical protein YjiA, N-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=94.96  E-value=0.0034  Score=43.16  Aligned_cols=20  Identities=35%  Similarity=0.308  Sum_probs=17.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|.-|.|||||++.+-+..
T Consensus         8 itGFLGaGKTTll~~lL~~~   27 (222)
T d1nija1           8 LTGFLGAGKTTLLRHILNEQ   27 (222)
T ss_dssp             EEESSSSSCHHHHHHHHHSC
T ss_pred             EeeCCCCCHHHHHHHHHhcC
Confidence            78999999999999986643

>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTPase Era, N-terminal domain
species: Thermus thermophilus [TaxId: 274]

Probab=94.95  E-value=0.0046  Score=40.34  Aligned_cols=21  Identities=29%  Similarity=0.135  Sum_probs=18.1

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||+..+.+.
T Consensus         8 I~lvG~~~~GKSSLin~l~~~   28 (178)
T d1wf3a1           8 VAIVGKPNVGKSTLLNNLLGV   28 (178)
T ss_dssp             EEEECSTTSSHHHHHHHHHTS
T ss_pred             EEEECCCCCCHHHHHHHHhCC
Confidence            348999999999999998764

>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase EngB
species: Bacillus subtilis [TaxId: 1423]

Probab=94.95  E-value=0.004  Score=41.19  Aligned_cols=21  Identities=19%  Similarity=0.078  Sum_probs=18.4

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..|+|||||...+.+.
T Consensus        26 I~lvG~~n~GKSTLin~L~g~   46 (195)
T d1svia_          26 IALAGRSNVGKSSFINSLINR   46 (195)
T ss_dssp             EEEEEBTTSSHHHHHHHHHTC
T ss_pred             EEEECCCCCCHHHHHHHhcCC
Confidence            459999999999999999763

>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Glucose transport protein GlcV, N-terminal domain
species: Archaeon Sulfolobus solfataricus [TaxId: 2287]

Probab=94.94  E-value=0.0021  Score=45.24  Aligned_cols=20  Identities=25%  Similarity=0.129  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||++.+..-.
T Consensus        36 iiG~sGsGKSTll~~i~gl~   55 (242)
T d1oxxk2          36 ILGPSGAGKTTFMRIIAGLD   55 (242)
T ss_dssp             EECSCHHHHHHHHHHHHTSS
T ss_pred             EECCCCCcHHHHHHHHHcCc
Confidence            99999999999999997743

>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTP-binding protein engB
species: Pyrococcus horikoshii [TaxId: 53953]

Probab=94.94  E-value=0.0039  Score=40.59  Aligned_cols=20  Identities=25%  Similarity=0.140  Sum_probs=17.2

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      .|+|..|+|||||...+.+.
T Consensus         4 ~lvG~~nvGKSsLin~l~~~   23 (184)
T d2cxxa1           4 IFAGRSNVGKSTLIYRLTGK   23 (184)
T ss_dssp             EEEEBTTSSHHHHHHHHHSC
T ss_pred             EEECCCCCCHHHHHHHHhCC
Confidence            47899999999999988753

>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Pantothenate kinase PanK
species: Escherichia coli [TaxId: 562]

Probab=94.94  E-value=0.0073  Score=43.78  Aligned_cols=20  Identities=25%  Similarity=0.124  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|+||||+|+.+....
T Consensus        85 IaG~sgSGKSTla~~L~~lL  104 (308)
T d1sq5a_          85 IAGSVAVGKSTTARVLQALL  104 (308)
T ss_dssp             EEECTTSSHHHHHHHHHHHH
T ss_pred             EeCCCCCCCcHHHHHHHHHH
Confidence            78999999999999998766

>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Signal recognition particle receptor beta-subunit
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=94.92  E-value=0.0047  Score=40.91  Aligned_cols=21  Identities=19%  Similarity=0.117  Sum_probs=17.8

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|-+|+|||||+..+-+.
T Consensus         6 V~lvG~~n~GKTSLln~l~~~   26 (209)
T d1nrjb_           6 IIIAGPQNSGKTSLLTLLTTD   26 (209)
T ss_dssp             EEEECSTTSSHHHHHHHHHHS
T ss_pred             EEEECCCCCCHHHHHHHHhCC
Confidence            348999999999999988654

>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: GTPase domain of the signal recognition particle receptor FtsY
species: Thermus aquaticus [TaxId: 271]

Probab=94.86  E-value=0.0085  Score=40.98  Aligned_cols=32  Identities=28%  Similarity=0.229  Sum_probs=22.3

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEe
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVV  125 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~V  125 (130)
                      ++|..|+||||.+-++-..+ .. .. ..+..|+.
T Consensus        11 lvGptGvGKTTTiaKLA~~~-~~-~g-~kV~lit~   42 (207)
T d1okkd2          11 VVGVNGVGKTTTIAKLGRYY-QN-LG-KKVMFCAG   42 (207)
T ss_dssp             EECSTTSSHHHHHHHHHHHH-HT-TT-CCEEEECC
T ss_pred             EECCCCCCHHHHHHHHHHHH-HH-CC-CcEEEEEe
Confidence            79999999999888887766 32 23 24555443

>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Signal recognition particle receptor beta-subunit
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=94.84  E-value=0.0051  Score=41.06  Aligned_cols=20  Identities=15%  Similarity=0.092  Sum_probs=16.9

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|-.|+|||||+..+-+
T Consensus         3 V~ivG~~~~GKTsLl~~l~~   22 (207)
T d2fh5b1           3 VLFVGLCDSGKTLLFVRLLT   22 (207)
T ss_dssp             EEEECSTTSSHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHc
Confidence            34789999999999998754

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: delta prime subunit of DNA polymerase III, N-domain
species: Escherichia coli [TaxId: 562]

Probab=94.80  E-value=0.0054  Score=42.20  Aligned_cols=21  Identities=24%  Similarity=0.183  Sum_probs=18.0

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +|+|-.|+||||+|+.+.+..
T Consensus        38 Ll~Gp~G~GKtt~a~~~~~~l   58 (239)
T d1njfa_          38 LFSGTRGVGKTSIARLLAKGL   58 (239)
T ss_dssp             EEECSTTSSHHHHHHHHHHHH
T ss_pred             EEECCCCCcHHHHHHHHHHHh
Confidence            389999999999999976654

>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: RhoE (RND3)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=94.74  E-value=0.005  Score=40.49  Aligned_cols=20  Identities=20%  Similarity=0.003  Sum_probs=16.2

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.++|..|+|||+|++.+-+
T Consensus         5 ivliG~~~vGKTsli~r~~~   24 (179)
T d1m7ba_           5 IVVVGDSQCGKTALLHVFAK   24 (179)
T ss_dssp             EEEEESTTSSHHHHHHHHHH
T ss_pred             EEEECCCCcCHHHHHHHHHh
Confidence            34789999999999986543

>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Ras-related protein RalA
species: Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]

Probab=94.74  E-value=0.0057  Score=39.67  Aligned_cols=20  Identities=25%  Similarity=0.184  Sum_probs=16.7

Q ss_pred             CccccCcCCCchhHHHHhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~  107 (130)
                      ++.|+|-.|+|||||+..+.
T Consensus         6 KivlvG~~~vGKTsli~~~~   25 (168)
T d1u8za_           6 KVIMVGSGGVGKSALTLQFM   25 (168)
T ss_dssp             EEEEECSTTSSHHHHHHHHH
T ss_pred             EEEEECCCCcCHHHHHHHHH
Confidence            34589999999999999853

>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: NTPase P4
species: Bacteriophage phi-12 [TaxId: 161736]

Probab=94.66  E-value=0.0074  Score=44.01  Aligned_cols=20  Identities=15%  Similarity=0.057  Sum_probs=18.4

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|.+|+|||.||+.+....
T Consensus       128 ~~G~pG~GKT~la~ala~~~  147 (321)
T d1w44a_         128 VTGKGNSGKTPLVHALGEAL  147 (321)
T ss_dssp             EECSSSSCHHHHHHHHHHHH
T ss_pred             EECCCCccHHHHHHHHHHHh
Confidence            68999999999999999865

>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Thymidylate kinase
species: Escherichia coli [TaxId: 562]

Probab=94.65  E-value=0.011  Score=39.61  Aligned_cols=30  Identities=23%  Similarity=0.144  Sum_probs=22.1

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEE
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMH  122 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~w  122 (130)
                      |-|.-|+||||+++.+.+.. + ...+..+++
T Consensus         7 iEG~dGsGKsT~~~~L~~~L-~-~~g~~~~~~   36 (210)
T d4tmka_           7 IEGLEGAGKTTARNVVVETL-E-QLGIRDMVF   36 (210)
T ss_dssp             EEECTTSCHHHHHHHHHHHH-H-HTTCCCEEE
T ss_pred             EECCCCCCHHHHHHHHHHHH-H-hCCCCeEEE
Confidence            55999999999999998876 3 234444443

>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase EngB
species: Escherichia coli [TaxId: 562]

Probab=94.64  E-value=0.0041  Score=40.20  Aligned_cols=21  Identities=19%  Similarity=0.094  Sum_probs=17.8

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +.|+|..++|||||+..+.+.
T Consensus        19 I~lvG~~NvGKSSL~n~L~~~   39 (188)
T d1puia_          19 VAFAGRSNAGKSSALNTLTNQ   39 (188)
T ss_dssp             EEEEECTTSSHHHHHTTTCCC
T ss_pred             EEEECCCCCCHHHHHHHHhCC
Confidence            349999999999999988653

>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: DNA repair protein Rad51, catalytic domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.63  E-value=0.006  Score=39.76  Aligned_cols=20  Identities=20%  Similarity=0.056  Sum_probs=17.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|+|||||+..+-...
T Consensus        28 i~G~~GsGKT~l~l~la~~~   47 (242)
T d1n0wa_          28 MFGEFRTGKTQICHTLAVTC   47 (242)
T ss_dssp             EECCTTSSHHHHHHHHHHHT
T ss_pred             EEeCCCCCHHHHHHHHHHHH
Confidence            99999999999998875443

>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: GTPase domain of the signal recognition particle receptor FtsY
species: Thermotoga maritima [TaxId: 2336]

Probab=94.57  E-value=0.014  Score=40.12  Aligned_cols=32  Identities=34%  Similarity=0.291  Sum_probs=22.4

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEe
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVV  125 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~V  125 (130)
                      ++|..|+||||.+-++...+ ... . ..+..|++
T Consensus        16 lvGptGvGKTTTiAKLAa~~-~~~-~-~kV~lit~   47 (213)
T d1vmaa2          16 VVGVNGTGKTTSCGKLAKMF-VDE-G-KSVVLAAA   47 (213)
T ss_dssp             EECCTTSSHHHHHHHHHHHH-HHT-T-CCEEEEEE
T ss_pred             EECCCCCCHHHHHHHHHHHH-HHC-C-CceEEEee
Confidence            79999999998877777766 322 2 34565554

>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Centaurin gamma 1, G domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.54  E-value=0.0067  Score=39.85  Aligned_cols=18  Identities=17%  Similarity=0.222  Sum_probs=15.8

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      ++|-.|+|||||+..+.+
T Consensus        10 vlG~~~vGKTsLi~~~~~   27 (175)
T d2bmja1          10 VLGDARSGKSSLIHRFLT   27 (175)
T ss_dssp             EECCTTTTHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHh
Confidence            899999999999997644

>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab26
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.53  E-value=0.0069  Score=39.17  Aligned_cols=20  Identities=30%  Similarity=0.255  Sum_probs=16.5

Q ss_pred             ccccCcCCCchhHHHHhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~  108 (130)
                      +.|+|-+|+|||||+..+-+
T Consensus         9 i~vvG~~~vGKTsli~~~~~   28 (170)
T d2g6ba1           9 VMLVGDSGVGKTCLLVRFKD   28 (170)
T ss_dssp             EEEECSTTSSHHHHHHHHHH
T ss_pred             EEEECCCCcCHHHHHHHHHh
Confidence            44899999999999997533

>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab9a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.51  E-value=0.0069  Score=39.30  Aligned_cols=19  Identities=26%  Similarity=0.342  Sum_probs=15.9

Q ss_pred             ccccCcCCCchhHHHHhhh
Q 042811           89 NWPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~  107 (130)
                      +.++|-.|+|||||+..+.
T Consensus         9 I~vvG~~~vGKSSli~~~~   27 (174)
T d1wmsa_           9 VILLGDGGVGKSSLMNRYV   27 (174)
T ss_dssp             EEEECCTTSSHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            4489999999999996653

>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Hexameric replicative helicase repA
species: Escherichia coli [TaxId: 562]

Probab=94.51  E-value=0.0057  Score=42.43  Aligned_cols=19  Identities=16%  Similarity=0.064  Sum_probs=16.4

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|.+|+|||||+-.+--.
T Consensus        34 i~G~~G~GKS~l~l~la~~   52 (274)
T d1nlfa_          34 LVSPGGAGKSMLALQLAAQ   52 (274)
T ss_dssp             EEESTTSSHHHHHHHHHHH
T ss_pred             EEeCCCCCHHHHHHHHHHH
Confidence            9999999999999776543

>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Cell division regulator MinD
species: Archaeon Pyrococcus furiosus [TaxId: 2261]

Probab=94.51  E-value=0.0066  Score=40.91  Aligned_cols=18  Identities=28%  Similarity=0.338  Sum_probs=15.8

Q ss_pred             CcCCCchhHHHHhhhhhh
Q 042811           93 GVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        93 GmGGvGKTTLak~v~~~~  110 (130)
                      +-||+||||++..+-.-.
T Consensus        10 ~kGGvGKTtia~nLA~~l   27 (237)
T d1g3qa_          10 GKGGTGKTTVTANLSVAL   27 (237)
T ss_dssp             SSTTSSHHHHHHHHHHHH
T ss_pred             CCCCCcHHHHHHHHHHHH
Confidence            679999999999987665

>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Obg GTP-binding protein middle domain
species: Bacillus subtilis [TaxId: 1423]

Probab=94.45  E-value=0.0054  Score=40.14  Aligned_cols=21  Identities=33%  Similarity=0.192  Sum_probs=17.4

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      +-|+|..++|||||+..+.+.
T Consensus         4 VaiiG~~nvGKSSLin~L~~~   24 (185)
T d1lnza2           4 VGLVGFPSVGKSTLLSVVSSA   24 (185)
T ss_dssp             EEEESSTTSSHHHHHHHSEEE
T ss_pred             EEEECCCCCCHHHHHHHHhCC
Confidence            347999999999999998543

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: delta prime subunit of DNA polymerase III, N-domain
species: Escherichia coli [TaxId: 562]

Probab=94.38  E-value=0.0076  Score=40.79  Aligned_cols=20  Identities=10%  Similarity=-0.017  Sum_probs=17.2

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      +++|..|+||||+|+.+-+.
T Consensus        28 Ll~Gp~G~GKtt~a~~~a~~   47 (207)
T d1a5ta2          28 LIQALPGMGDDALIYALSRY   47 (207)
T ss_dssp             EEECCTTSCHHHHHHHHHHH
T ss_pred             EEECCCCCcHHHHHHHHHHh
Confidence            48999999999999987654

>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase Der, N-terminal and middle domains
species: Thermotoga maritima [TaxId: 2336]

Probab=94.38  E-value=0.0077  Score=39.26  Aligned_cols=19  Identities=26%  Similarity=0.261  Sum_probs=16.9

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|-.|+|||||+..+.+.
T Consensus        13 iiG~~~~GKSTLin~l~~~   31 (186)
T d1mkya2          13 IVGRPNVGKSTLFNAILNK   31 (186)
T ss_dssp             EECSTTSSHHHHHHHHHTS
T ss_pred             EECCCCCCHHHHHHHHHCC
Confidence            8999999999999887654

>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable tRNA modification GTPase TrmE (MnmE), G domain
species: Escherichia coli [TaxId: 562]

Probab=94.31  E-value=0.0073  Score=38.39  Aligned_cols=18  Identities=22%  Similarity=0.108  Sum_probs=15.8

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |+|-.|+|||||+..+.+
T Consensus         6 lvG~~nvGKSsLin~l~~   23 (161)
T d2gj8a1           6 IAGRPNAGKSSLLNALAG   23 (161)
T ss_dssp             EEESTTSSHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            789999999999988753

>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Meiotic recombination protein DMC1/LIM15 homolog
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.26  E-value=0.022  Score=38.33  Aligned_cols=36  Identities=11%  Similarity=-0.221  Sum_probs=25.4

Q ss_pred             ccCcCCCchhHHHHhhhhhhhh---ccCCCCeEEEEEeC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLE---DEGIFLIKMHDVVR  126 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~---~~~~Fd~~~wv~VS  126 (130)
                      |+|..|+|||||+..+-.....   ....+..+.|+...
T Consensus        42 i~G~~GsGKT~lalq~~~~~~~~~~~~~~~~~~~~~~~~   80 (258)
T d1v5wa_          42 AFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTE   80 (258)
T ss_dssp             EECCTTCTHHHHHHHHHHHTTSCBTTTBCCCEEEEEESS
T ss_pred             EECCCCCCHHHHHHHHHHHHHhhhhcccccceEEEechH
Confidence            9999999999999887543311   12346677777665

>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ATPase subunit of magnesium chelatase, BchI
species: Rhodobacter capsulatus [TaxId: 1061]

Probab=94.22  E-value=0.0052  Score=44.29  Aligned_cols=17  Identities=35%  Similarity=0.479  Sum_probs=15.8

Q ss_pred             ccCcCCCchhHHHHhhh
Q 042811           91 PFGVEGVGKITSLSKSY  107 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~  107 (130)
                      +.|-.|+||||||+.+-
T Consensus        33 l~G~pG~GKT~lar~~~   49 (333)
T d1g8pa_          33 VFGDRGTGKSTAVRALA   49 (333)
T ss_dssp             EECCGGGCTTHHHHHHH
T ss_pred             EECCCCccHHHHHHHHH
Confidence            99999999999999874

>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: DNA repair protein Rad51, catalytic domain
species: Archaeon Pyrococcus furiosus [TaxId: 2261]

Probab=94.17  E-value=0.024  Score=38.20  Aligned_cols=36  Identities=17%  Similarity=0.009  Sum_probs=23.9

Q ss_pred             ccCcCCCchhHHHHhhhhhhhh---ccCCCCeEEEEEeC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLE---DEGIFLIKMHDVVR  126 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~---~~~~Fd~~~wv~VS  126 (130)
                      |+|-.|+|||||+-++-.....   .......++|+...
T Consensus        41 i~G~pGsGKT~~~lq~~~~~~~~~~~~~~~~~~~~~~~~   79 (254)
T d1pzna2          41 VFGEFGSGKTQLAHTLAVMVQLPPEEGGLNGSVIWIDTE   79 (254)
T ss_dssp             EEESTTSSHHHHHHHHHHHTTSCGGGTSCSCEEEEEESS
T ss_pred             EEcCCCCCHHHHHHHHHHHhhchHHhcCCCceEEEEecc
Confidence            9999999999999887544311   11224566776654

>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab8a
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=94.13  E-value=0.0055  Score=39.84  Aligned_cols=19  Identities=32%  Similarity=0.279  Sum_probs=7.6

Q ss_pred             ccccCcCCCchhHHHHhhh
Q 042811           89 NWPFGVEGVGKITSLSKSY  107 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~  107 (130)
                      +.|+|-.|+|||||+..+-
T Consensus         9 i~vvG~~~vGKTsLi~~l~   27 (173)
T d2fu5c1           9 LLLIGDSGVGKTCVLFRFS   27 (173)
T ss_dssp             EEEECCCCC----------
T ss_pred             EEEECCCCcCHHHHHHHHH
Confidence            4489999999999997543

>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Papillomavirus large T antigen helicase domain
species: Simian virus 40 [TaxId: 10633]

Probab=94.05  E-value=0.0093  Score=44.03  Aligned_cols=20  Identities=20%  Similarity=-0.047  Sum_probs=18.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+|||++|+.+-+..
T Consensus       159 ~~g~~~~gk~~~~~~~~~~~  178 (362)
T d1svma_         159 FKGPIDSGKTTLAAALLELC  178 (362)
T ss_dssp             EECSTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHc
Confidence            99999999999999998865

>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase EngC (YjeQ), C-terminal domain
species: Bacillus subtilis [TaxId: 1423]

Probab=93.97  E-value=0.0031  Score=44.04  Aligned_cols=20  Identities=40%  Similarity=0.511  Sum_probs=16.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      +.|..|||||||+..+..+.
T Consensus       102 l~G~SGVGKSSLiN~L~~~~  121 (231)
T d1t9ha2         102 FAGQSGVGKSSLLNAISPEL  121 (231)
T ss_dssp             EEESHHHHHHHHHHHHCC--
T ss_pred             EECCCCccHHHHHHhhccHh
Confidence            89999999999999987754

>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: CDC42
species: Human (Homo sapiens) [TaxId: 9606]

Probab=93.93  E-value=0.0094  Score=39.32  Aligned_cols=20  Identities=25%  Similarity=0.134  Sum_probs=16.0

Q ss_pred             cccCcCCCchhHHHHhh-hhh
Q 042811           90 WPFGVEGVGKITSLSKS-YPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v-~~~  109 (130)
                      .++|-.|+|||+|+..+ .+.
T Consensus         7 vllG~~~vGKTSli~r~~~~~   27 (191)
T d2ngra_           7 VVVGDGAVGKTCLLISYTTNK   27 (191)
T ss_dssp             EEEESTTSSHHHHHHHHHHSC
T ss_pred             EEECCCCcCHHHHHHHHHhCC
Confidence            38999999999998764 444

>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Thymidylate kinase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=93.82  E-value=0.01  Score=40.22  Aligned_cols=20  Identities=25%  Similarity=0.353  Sum_probs=17.8

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |-|.-|+||||+++.+.+..
T Consensus         8 iEG~DGsGKST~~~~L~~~L   27 (214)
T d1tmka_           8 IEGLDRTGKTTQCNILYKKL   27 (214)
T ss_dssp             EEESTTSSHHHHHHHHHHHT
T ss_pred             EECCCCCcHHHHHHHHHHHH
Confidence            67999999999999998775

>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase EngC (YjeQ), C-terminal domain
species: Thermotoga maritima [TaxId: 2336]

Probab=93.77  E-value=0.011  Score=40.91  Aligned_cols=20  Identities=35%  Similarity=0.524  Sum_probs=17.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|-.|||||||+..+..+.
T Consensus       100 ~~G~SGVGKSTLiN~L~~~~  119 (225)
T d1u0la2         100 MAGLSGVGKSSLLNAINPGL  119 (225)
T ss_dssp             EECSTTSSHHHHHHHHSTTC
T ss_pred             EECCCCCCHHHHHHhhcchh
Confidence            99999999999999987653

>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: HslU
species: Haemophilus influenzae [TaxId: 727]

Probab=93.77  E-value=0.012  Score=44.47  Aligned_cols=24  Identities=25%  Similarity=0.156  Sum_probs=20.4

Q ss_pred             CCccccCcCCCchhHHHHhhhhhh
Q 042811           87 GNNWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        87 ~~l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .+++++|..|+|||-||+.+....
T Consensus        50 sNILliGPTGvGKTlLAr~LAk~l   73 (443)
T d1g41a_          50 KNILMIGPTGVGKTEIARRLAKLA   73 (443)
T ss_dssp             CCEEEECCTTSSHHHHHHHHHHHT
T ss_pred             ccEEEECCCCCCHHHHHHHHHHHh
Confidence            455699999999999999998754

>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Exodeoxyribonuclease V alpha chain (RecD)
species: Escherichia coli [TaxId: 562]

Probab=93.76  E-value=0.023  Score=41.78  Aligned_cols=19  Identities=32%  Similarity=0.379  Sum_probs=15.7

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|.+|+||||++..+...
T Consensus       168 I~G~pGTGKTt~i~~~l~~  186 (359)
T d1w36d1         168 ISGGPGTGKTTTVAKLLAA  186 (359)
T ss_dssp             EECCTTSTHHHHHHHHHHH
T ss_pred             EEcCCCCCceehHHHHHHH
Confidence            9999999999988665443

>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Hexameric traffic ATPase, HP0525
species: Helicobacter pylori [TaxId: 210]

Probab=93.73  E-value=0.011  Score=42.92  Aligned_cols=20  Identities=25%  Similarity=0.228  Sum_probs=18.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|+|||||++.+.+..
T Consensus       171 i~G~tgSGKTT~l~al~~~i  190 (323)
T d1g6oa_         171 VCGGTGSGKTTYIKSIMEFI  190 (323)
T ss_dssp             EEESTTSSHHHHHHHHGGGS
T ss_pred             EEeeccccchHHHHHHhhhc
Confidence            99999999999999988754

>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Hypothetical protein Ygr205W
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=93.73  E-value=0.011  Score=42.33  Aligned_cols=20  Identities=25%  Similarity=0.300  Sum_probs=17.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |-|..|+|||||+..+....
T Consensus        32 i~G~qGSGKSTl~~~l~~~L   51 (286)
T d1odfa_          32 FSGPQGSGKSFTSIQIYNHL   51 (286)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             eECCCCCCHHHHHHHHHHHH
Confidence            68999999999999887654

>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: GTPase domain of the signal recognition particle receptor FtsY
species: Escherichia coli [TaxId: 562]

Probab=93.70  E-value=0.02  Score=39.16  Aligned_cols=20  Identities=45%  Similarity=0.695  Sum_probs=17.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      ++|..|+||||.+-++-..+
T Consensus        14 lvGptGvGKTTTiAKLA~~~   33 (211)
T d2qy9a2          14 MVGVNGVGKTTTIGKLARQF   33 (211)
T ss_dssp             EECCTTSCHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            79999999998888887766

>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: GTPase domain of the signal sequence recognition protein Ffh
species: Archaeon Acidianus ambivalens [TaxId: 2283]

Probab=93.68  E-value=0.021  Score=39.06  Aligned_cols=32  Identities=25%  Similarity=0.139  Sum_probs=18.0

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEe
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVV  125 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~V  125 (130)
                      ++|..|+||||.+-++-..+ +. ... .++.|+.
T Consensus        17 lvGptGvGKTTTiAKLA~~~-~~-~g~-kV~lit~   48 (211)
T d1j8yf2          17 LVGVQGTGKATTAGKLAYFY-KK-KGF-KVGLVGA   48 (211)
T ss_dssp             EECSCCC----HHHHHHHHH-HH-TTC-CEEEEEC
T ss_pred             EECCCCCCHHHHHHHHHHHH-HH-CCC-ceEEEEe
Confidence            78999999988877776665 42 333 3555543

>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: TrmE GTPase domain
species: Thermotoga maritima [TaxId: 2336]

Probab=93.52  E-value=0.0042  Score=39.57  Aligned_cols=19  Identities=37%  Similarity=0.392  Sum_probs=16.5

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      ++|..|+|||||+..+.+.
T Consensus         5 liG~~n~GKSSLin~l~g~   23 (160)
T d1xzpa2           5 IVGKPNVGKSTLLNRLLNE   23 (160)
T ss_dssp             EECCHHHHTCHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            7899999999999988644

>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpA, an Hsp100 chaperone, AAA+ modules
species: Escherichia coli [TaxId: 562]

Probab=93.41  E-value=0.014  Score=42.11  Aligned_cols=22  Identities=23%  Similarity=0.146  Sum_probs=18.6

Q ss_pred             ccccCcCCCchhHHHHhhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +..+|..|+|||.||+.+..-.
T Consensus        55 ~lf~Gp~GvGKT~lak~la~~l   76 (315)
T d1r6bx3          55 FLFAGPTGVGKTEVTVQLSKAL   76 (315)
T ss_dssp             EEEECSTTSSHHHHHHHHHHHH
T ss_pred             EEEECCCcchhHHHHHHHHhhc
Confidence            3488999999999999987743

>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: YjeE-like
domain: Hypothetical protein HI0065
species: Haemophilus influenzae [TaxId: 727]

Probab=93.38  E-value=0.024  Score=37.12  Aligned_cols=22  Identities=23%  Similarity=0.114  Sum_probs=18.6

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhc
Q 042811           91 PFGVEGVGKITSLSKSYPEFLED  113 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~  113 (130)
                      +.|-=|+||||++|.+-+.. .+
T Consensus        38 L~G~LGaGKTtfvr~~~~~l-g~   59 (158)
T d1htwa_          38 LNGDLGAGKTTLTRGMLQGI-GH   59 (158)
T ss_dssp             EECSTTSSHHHHHHHHHHHT-TC
T ss_pred             EecCCCccHHHHHHHHHhhc-cc
Confidence            67888999999999998866 44

>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Circadian clock protein KaiC
species: Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]

Probab=93.37  E-value=0.013  Score=39.03  Aligned_cols=20  Identities=25%  Similarity=0.277  Sum_probs=16.5

Q ss_pred             ccCcCCCchhHHHHh-hhhhh
Q 042811           91 PFGVEGVGKITSLSK-SYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~-v~~~~  110 (130)
                      |+|..|+|||||+.. +++-.
T Consensus        31 I~G~~G~GKT~la~~~~~~~~   51 (242)
T d1tf7a1          31 VSGTSGTGKTLFSIQFLYNGI   51 (242)
T ss_dssp             EEESTTSSHHHHHHHHHHHHH
T ss_pred             EEeCCCCCHHHHHHHHHHHHH
Confidence            999999999999965 45544

>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Thymidine kinase
species: Equine herpesvirus type 4 [TaxId: 10331]

Probab=93.33  E-value=0.029  Score=40.88  Aligned_cols=20  Identities=30%  Similarity=0.175  Sum_probs=18.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |=|.=|+||||+++.+.+..
T Consensus        11 iEG~iGsGKSTl~~~L~~~l   30 (333)
T d1p6xa_          11 LDGVYGIGKSTTGRVMASAA   30 (333)
T ss_dssp             EECSTTSSHHHHHHHHHSGG
T ss_pred             EECCccCCHHHHHHHHHHHh
Confidence            66999999999999999876

>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: DNA repair protein Rad51, catalytic domain
species: Archaeon Methanococcus voltae [TaxId: 2188]

Probab=93.13  E-value=0.015  Score=38.88  Aligned_cols=20  Identities=30%  Similarity=0.333  Sum_probs=17.3

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-+|+|||||+..+-...
T Consensus        39 i~G~~G~GKT~~~l~~a~~~   58 (258)
T d2i1qa2          39 FAGVFGSGKTQIMHQSCVNL   58 (258)
T ss_dssp             EEESTTSSHHHHHHHHHHHT
T ss_pred             EEeCCCCCHHHHHHHHHHHH
Confidence            99999999999999985443

>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Phosphoribulokinase
species: Rhodobacter sphaeroides [TaxId: 1063]

Probab=92.91  E-value=0.012  Score=42.26  Aligned_cols=20  Identities=25%  Similarity=0.189  Sum_probs=14.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|-.|+||||+++.+-+.+
T Consensus         9 IaG~SGSGKTTva~~l~~i~   28 (288)
T d1a7ja_           9 VTGSSGAGTSTVKHTFDQIF   28 (288)
T ss_dssp             EESCC---CCTHHHHHHHHH
T ss_pred             EECCCCCcHHHHHHHHHHHH
Confidence            78999999999999876655

>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Chloroplast protein translocon GTPase Toc34
species: Garden pea (Pisum sativum) [TaxId: 3888]

Probab=92.76  E-value=0.018  Score=40.12  Aligned_cols=21  Identities=29%  Similarity=0.371  Sum_probs=18.4

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .|+|..|+|||||...+.+..
T Consensus        36 ~LvG~tg~GKSSliN~ilg~~   56 (257)
T d1h65a_          36 LVMGKGGVGKSSTVNSIIGER   56 (257)
T ss_dssp             EEEESTTSSHHHHHHHHHTSC
T ss_pred             EEECCCCCcHHHHHHHHhCCC
Confidence            399999999999999998753

>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Dephospho-CoA kinase
species: Escherichia coli [TaxId: 562]

Probab=92.65  E-value=0.021  Score=38.30  Aligned_cols=16  Identities=31%  Similarity=0.162  Sum_probs=14.4

Q ss_pred             ccCcCCCchhHHHHhh
Q 042811           91 PFGVEGVGKITSLSKS  106 (130)
Q Consensus        91 I~GmGGvGKTTLak~v  106 (130)
                      |.|+-|+||||.++.+
T Consensus         8 itG~igSGKStv~~~l   23 (208)
T d1vhta_           8 LTGGIGSGKSTVANAF   23 (208)
T ss_dssp             EECCTTSCHHHHHHHH
T ss_pred             EECCCcCCHHHHHHHH
Confidence            7899999999999854

>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Metallochaperone MeaB
species: Methylobacterium extorquens [TaxId: 408]

Probab=92.63  E-value=0.021  Score=41.46  Aligned_cols=20  Identities=35%  Similarity=0.386  Sum_probs=17.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|.+|+|||||.-.+-...
T Consensus        56 itG~pGaGKSTli~~l~~~~   75 (323)
T d2qm8a1          56 ITGVPGVGKSTTIDALGSLL   75 (323)
T ss_dssp             EECCTTSCHHHHHHHHHHHH
T ss_pred             eeCCCCCCHHHHHHHHHHHH
Confidence            89999999999999987755

>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpX
species: Helicobacter pylori [TaxId: 210]

Probab=92.58  E-value=0.021  Score=42.06  Aligned_cols=21  Identities=19%  Similarity=0.107  Sum_probs=17.7

Q ss_pred             ccccCcCCCchhHHHHhhhhh
Q 042811           89 NWPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v~~~  109 (130)
                      ++.+|..|||||-|||.+..-
T Consensus        71 iLfiGPTGvGKTElAk~LA~~   91 (364)
T d1um8a_          71 ILLIGPTGSGKTLMAQTLAKH   91 (364)
T ss_dssp             EEEECCTTSSHHHHHHHHHHH
T ss_pred             eeeeCCCCccHHHHHHHHHhh
Confidence            457899999999999998653

>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Gene 4 protein (g4p, DNA primase), helicase domain
species: Bacteriophage T7 [TaxId: 10760]

Probab=92.48  E-value=0.045  Score=37.73  Aligned_cols=20  Identities=20%  Similarity=0.223  Sum_probs=17.0

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|..|+|||||+-.+--..
T Consensus        40 i~G~~G~GKT~~~~~la~~~   59 (277)
T d1cr2a_          40 VTSGSGMGKSTFVRQQALQW   59 (277)
T ss_dssp             EECSTTSSHHHHHHHHHHHH
T ss_pred             EEeCCCCCHHHHHHHHHHhh
Confidence            99999999999998876443

>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Dephospho-CoA kinase
species: Haemophilus influenzae [TaxId: 727]

Probab=92.18  E-value=0.027  Score=37.67  Aligned_cols=16  Identities=31%  Similarity=0.135  Sum_probs=14.5

Q ss_pred             ccCcCCCchhHHHHhh
Q 042811           91 PFGVEGVGKITSLSKS  106 (130)
Q Consensus        91 I~GmGGvGKTTLak~v  106 (130)
                      |.|.-|+||||+++.+
T Consensus         7 ITG~igSGKStv~~~l   22 (205)
T d1jjva_           7 LTGGIGSGKTTIANLF   22 (205)
T ss_dssp             EECSTTSCHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHH
Confidence            7899999999999875

>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: LAO/AO transport system kinase ArgK
species: Escherichia coli [TaxId: 562]

Probab=91.72  E-value=0.044  Score=39.74  Aligned_cols=20  Identities=30%  Similarity=0.174  Sum_probs=17.7

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |.|.+|+|||||+-.+-...
T Consensus        59 itG~pGaGKSTLi~~l~~~~   78 (327)
T d2p67a1          59 VTGTPGAGKSTFLEAFGMLL   78 (327)
T ss_dssp             EEECTTSCHHHHHHHHHHHH
T ss_pred             eeCCCCCCHHHHHHHHHHHH
Confidence            89999999999999887655

>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor G (EF-G), N-terminal (G) domain
species: Thermus thermophilus [TaxId: 274]

Probab=91.33  E-value=0.032  Score=39.62  Aligned_cols=18  Identities=17%  Similarity=0.021  Sum_probs=16.4

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |+|-+|.|||||+-.+..
T Consensus        11 i~gh~~~GKTtL~e~ll~   28 (276)
T d2bv3a2          11 IAAHIDAGKTTTTERILY   28 (276)
T ss_dssp             EEECTTSCHHHHHHHHHH
T ss_pred             EEeCCCCCHHHHHHHHHH
Confidence            999999999999999754

>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: DEXX box DNA helicase
species: Escherichia coli, RepD [TaxId: 562]

Probab=91.24  E-value=0.032  Score=38.67  Aligned_cols=14  Identities=21%  Similarity=0.314  Sum_probs=11.7

Q ss_pred             cccCcCCCchhHHH
Q 042811           90 WPFGVEGVGKITSL  103 (130)
Q Consensus        90 ~I~GmGGvGKTTLa  103 (130)
                      .|.|-.|+||||.+
T Consensus        18 lI~g~aGTGKTt~l   31 (306)
T d1uaaa1          18 LVLAGAGSGKTRVI   31 (306)
T ss_dssp             EECCCTTSCHHHHH
T ss_pred             EEEeeCCccHHHHH
Confidence            48899999999753

>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Smc head domain
species: Thermotoga maritima [TaxId: 2336]

Probab=91.23  E-value=0.034  Score=38.81  Aligned_cols=16  Identities=25%  Similarity=0.347  Sum_probs=15.2

Q ss_pred             ccCcCCCchhHHHHhh
Q 042811           91 PFGVEGVGKITSLSKS  106 (130)
Q Consensus        91 I~GmGGvGKTTLak~v  106 (130)
                      |+|.-|+||||++.++
T Consensus        29 lvG~NgsGKS~iL~Ai   44 (308)
T d1e69a_          29 IVGPNGSGKSNIIDAI   44 (308)
T ss_dssp             EECCTTTCSTHHHHHH
T ss_pred             EECCCCCcHHHHHHHH
Confidence            9999999999999887

>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Thermus thermophilus [TaxId: 274]

Probab=91.12  E-value=0.043  Score=39.45  Aligned_cols=21  Identities=24%  Similarity=0.257  Sum_probs=17.9

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      ..+|..|+|||.||+.+-+..
T Consensus        57 lf~Gp~G~GKt~lak~la~~l   77 (315)
T d1qvra3          57 LFLGPTGVGKTELAKTLAATL   77 (315)
T ss_dssp             EEBSCSSSSHHHHHHHHHHHH
T ss_pred             EEECCCcchHHHHHHHHHHHh
Confidence            389999999999999877653

>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Transcription termination factor Rho, ATPase domain
species: Escherichia coli [TaxId: 562]

Probab=91.08  E-value=0.056  Score=38.65  Aligned_cols=31  Identities=10%  Similarity=-0.140  Sum_probs=23.0

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEE
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHD  123 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv  123 (130)
                      |.|-.|+|||||+..+-+.. . ..+-++++.+
T Consensus        48 I~g~~g~GKT~l~~~i~~~~-~-~~~~~~v~~~   78 (289)
T d1xpua3          48 IVAPPKAGKTMLLQNIAQSI-A-YNHPDCVLMV   78 (289)
T ss_dssp             EEECSSSSHHHHHHHHHHHH-H-HHCTTSEEEE
T ss_pred             EeCCCCCCHHHHHHHHHHHH-h-hcCCCeEEEE
Confidence            99999999999999988765 3 2344444443

>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Transcriptional activator sigm54 (NtrC1), C-terminal domain
species: Aquifex aeolicus [TaxId: 63363]

Probab=90.42  E-value=0.053  Score=37.54  Aligned_cols=21  Identities=24%  Similarity=0.031  Sum_probs=18.3

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      +|.|-.|+|||++|+.++...
T Consensus        27 lI~Ge~GtGK~~~A~~ih~~s   47 (247)
T d1ny5a2          27 LITGESGVGKEVVARLIHKLS   47 (247)
T ss_dssp             EEECSTTSSHHHHHHHHHHHS
T ss_pred             EEECCCCcCHHHHHHHHHHhc
Confidence            388999999999999998754

>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Thymidine kinase
species: Varicella-zoster virus [TaxId: 10335]

Probab=90.38  E-value=0.044  Score=39.88  Aligned_cols=20  Identities=30%  Similarity=0.391  Sum_probs=17.5

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |=|.=|+||||+++.+-+..
T Consensus        10 IEG~iGsGKSTl~~~L~~~l   29 (331)
T d1osna_          10 LDGAYGIGKTTAAEEFLHHF   29 (331)
T ss_dssp             EEESSSSCTTHHHHHHHHTT
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            66889999999999998765

>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]}

class: Alpha and beta proteins (a/b)
fold: PEP carboxykinase-like
superfamily: PEP carboxykinase-like
family: HPr kinase HprK C-terminal domain
domain: HPr kinase HprK C-terminal domain
species: Mycoplasma pneumoniae [TaxId: 2104]

Probab=90.38  E-value=0.05  Score=36.17  Aligned_cols=19  Identities=21%  Similarity=0.191  Sum_probs=15.9

Q ss_pred             cccCcCCCchhHHHHhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~  108 (130)
                      .|.|..|+||||||-.+..
T Consensus        19 li~G~sG~GKS~lal~l~~   37 (177)
T d1knxa2          19 LLTGRSGIGKSECALDLIN   37 (177)
T ss_dssp             EEEESSSSSHHHHHHHHHT
T ss_pred             EEEcCCCCCHHHHHHHHHH
Confidence            3899999999999977543

>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]}

class: Alpha and beta proteins (a/b)
fold: PEP carboxykinase-like
superfamily: PEP carboxykinase-like
family: HPr kinase HprK C-terminal domain
domain: HPr kinase HprK C-terminal domain
species: Lactobacillus casei [TaxId: 1582]

Probab=90.29  E-value=0.054  Score=35.95  Aligned_cols=18  Identities=28%  Similarity=0.243  Sum_probs=15.6

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |.|-.|+||||||-.+-.
T Consensus        19 ~~G~sG~GKStlal~l~~   36 (176)
T d1kkma_          19 ITGDSGVGKSETALELVQ   36 (176)
T ss_dssp             EECCTTSCHHHHHHHHHH
T ss_pred             EEeCCCCCHHHHHHHHHH
Confidence            899999999999977544

>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Thymidine kinase
species: Herpes simplex virus type 1, different strains [TaxId: 10298]

Probab=90.16  E-value=0.053  Score=39.43  Aligned_cols=20  Identities=25%  Similarity=0.092  Sum_probs=16.1

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |=|.=|+||||+++.+-+..
T Consensus         9 IEG~iGsGKTTl~~~La~~l   28 (329)
T d1e2ka_           9 IDGPHGMGKTTTTQLLVALG   28 (329)
T ss_dssp             ECSCTTSSHHHHHHHHTC--
T ss_pred             EECCcCCCHHHHHHHHHHHh
Confidence            56889999999999997654

>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: PEP carboxykinase-like
superfamily: PEP carboxykinase-like
family: PEP carboxykinase C-terminal domain
domain: Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase)
species: Escherichia coli [TaxId: 562]

Probab=89.96  E-value=0.045  Score=39.57  Aligned_cols=15  Identities=40%  Similarity=0.552  Sum_probs=13.5

Q ss_pred             cccCcCCCchhHHHH
Q 042811           90 WPFGVEGVGKITSLS  104 (130)
Q Consensus        90 ~I~GmGGvGKTTLak  104 (130)
                      +..|..|.|||||..
T Consensus        18 lfFGLSGTGKTTLs~   32 (313)
T d2olra1          18 VFFGLSGTGKTTLST   32 (313)
T ss_dssp             EEECSTTSSHHHHHC
T ss_pred             EEEccCCCCccccee
Confidence            489999999999984

>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor G (EF-G), N-terminal (G) domain
species: Thermus thermophilus, EF-G-2 [TaxId: 274]

Probab=89.85  E-value=0.052  Score=38.22  Aligned_cols=18  Identities=28%  Similarity=0.154  Sum_probs=15.8

Q ss_pred             ccccCcCCCchhHHHHhh
Q 042811           89 NWPFGVEGVGKITSLSKS  106 (130)
Q Consensus        89 l~I~GmGGvGKTTLak~v  106 (130)
                      +.|+|-.|.|||||+..+
T Consensus         5 v~iiGh~~~GKTtL~e~l   22 (267)
T d2dy1a2           5 VALVGHAGSGKTTLTEAL   22 (267)
T ss_dssp             EEEEESTTSSHHHHHHHH
T ss_pred             EEEEcCCCCcHHHHHHHH
Confidence            347899999999999987

>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: DEXX box DNA helicase
species: Bacillus stearothermophilus, PcrA [TaxId: 1422]

Probab=89.70  E-value=0.046  Score=38.31  Aligned_cols=15  Identities=27%  Similarity=0.226  Sum_probs=12.2

Q ss_pred             ccccCcCCCchhHHH
Q 042811           89 NWPFGVEGVGKITSL  103 (130)
Q Consensus        89 l~I~GmGGvGKTTLa  103 (130)
                      +.|.|..|+||||.+
T Consensus        27 ~lV~g~aGSGKTt~l   41 (318)
T d1pjra1          27 LLIMAGAGSGKTRVL   41 (318)
T ss_dssp             EEEEECTTSCHHHHH
T ss_pred             EEEEecCCccHHHHH
Confidence            348899999999754

>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: RecA protein, ATPase-domain
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=89.70  E-value=0.13  Score=36.23  Aligned_cols=37  Identities=19%  Similarity=0.177  Sum_probs=26.3

Q ss_pred             CCcc-ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC
Q 042811           87 GNNW-PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR  126 (130)
Q Consensus        87 ~~l~-I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS  126 (130)
                      ..+. |+|-.|+|||||+-.+.... ...+  -.++|+-.-
T Consensus        60 g~i~e~~G~~~~GKT~l~l~~~~~~-q~~g--~~~vyIDtE   97 (269)
T d1mo6a1          60 GRVIEIYGPESSGKTTVALHAVANA-QAAG--GVAAFIDAE   97 (269)
T ss_dssp             SSEEEEECSSSSSHHHHHHHHHHHH-HHTT--CEEEEEESS
T ss_pred             ceeEEEecCCCcHHHHHHHHHHHHH-hcCC--CEEEEEECC
Confidence            3444 99999999999997777665 2223  367887654

>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]}

class: Alpha and beta proteins (a/b)
fold: PEP carboxykinase-like
superfamily: PEP carboxykinase-like
family: PEP carboxykinase C-terminal domain
domain: Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase)
species: Trypanosoma cruzi [TaxId: 5693]

Probab=89.41  E-value=0.053  Score=39.38  Aligned_cols=15  Identities=40%  Similarity=0.543  Sum_probs=13.5

Q ss_pred             cccCcCCCchhHHHH
Q 042811           90 WPFGVEGVGKITSLS  104 (130)
Q Consensus        90 ~I~GmGGvGKTTLak  104 (130)
                      +..|..|.|||||..
T Consensus        18 lfFGLSGTGKTTLs~   32 (323)
T d1ii2a1          18 VFFGLSGTGKTTLSA   32 (323)
T ss_dssp             EEECCTTSSHHHHHC
T ss_pred             EEEccCCCCccccee
Confidence            489999999999984

>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: PEP carboxykinase-like
superfamily: PEP carboxykinase-like
family: PEP carboxykinase C-terminal domain
domain: Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase)
species: Thermus thermophilus [TaxId: 274]

Probab=89.40  E-value=0.047  Score=39.59  Aligned_cols=16  Identities=38%  Similarity=0.528  Sum_probs=13.8

Q ss_pred             cccCcCCCchhHHHHh
Q 042811           90 WPFGVEGVGKITSLSK  105 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~  105 (130)
                      +..|..|.|||||.-.
T Consensus        18 lffGLSGTGKTTLs~~   33 (318)
T d1j3ba1          18 VFFGLSGTGKTTLSTD   33 (318)
T ss_dssp             EEEECTTSCHHHHTCB
T ss_pred             EEEccCCCCccccccC
Confidence            4899999999999843

>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: YchF GTP-binding protein N-terminal domain
species: Haemophilus influenzae [TaxId: 727]

Probab=89.26  E-value=0.07  Score=37.30  Aligned_cols=20  Identities=25%  Similarity=0.174  Sum_probs=17.6

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+|+..+|||||...+-+..
T Consensus         7 ivG~Pn~GKSTlf~~lt~~~   26 (278)
T d1jala1           7 IVGLPNVGKSTLFNALTKAG   26 (278)
T ss_dssp             EECCTTSSHHHHHHHHHHTC
T ss_pred             EECCCCCCHHHHHHHHHCCC
Confidence            89999999999999887644

>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: RecA protein, ATPase-domain
species: Escherichia coli [TaxId: 562]

Probab=88.92  E-value=0.15  Score=35.70  Aligned_cols=33  Identities=21%  Similarity=0.111  Sum_probs=24.4

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR  126 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS  126 (130)
                      |+|-.|+|||||+-.+-....+ .+  ..++|+..-
T Consensus        59 i~G~~gsGKTtl~l~~~~~~q~-~g--~~~vyidtE   91 (263)
T d1u94a1          59 IYGPESSGKTTLTLQVIAAAQR-EG--KTCAFIDAE   91 (263)
T ss_dssp             EECSTTSSHHHHHHHHHHHHHH-TT--CCEEEEESS
T ss_pred             EecCCCcHHHHHHHHHHHHHHc-CC--CEEEEEccc
Confidence            9999999999999888776632 22  246776544

>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: RecA protein, ATPase-domain
species: Deinococcus radiodurans [TaxId: 1299]

Probab=88.89  E-value=0.17  Score=35.44  Aligned_cols=33  Identities=18%  Similarity=0.050  Sum_probs=24.9

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR  126 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS  126 (130)
                      |+|-.|+|||||+-.+-... ...+  -.++|+..-
T Consensus        62 i~G~~~sGKT~l~l~~~~~a-qk~g--~~v~yiDtE   94 (268)
T d1xp8a1          62 IYGPESGGKTTLALAIVAQA-QKAG--GTCAFIDAE   94 (268)
T ss_dssp             EEESTTSSHHHHHHHHHHHH-HHTT--CCEEEEESS
T ss_pred             EecCCccchHHHHHHHHHHH-HhCC--CEEEEEECC
Confidence            99999999999999887776 3222  346777654

>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]}

class: Alpha and beta proteins (a/b)
fold: PEP carboxykinase-like
superfamily: PEP carboxykinase-like
family: HPr kinase HprK C-terminal domain
domain: HPr kinase HprK C-terminal domain
species: Staphylococcus xylosus [TaxId: 1288]

Probab=88.80  E-value=0.078  Score=34.86  Aligned_cols=18  Identities=22%  Similarity=0.237  Sum_probs=15.2

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |.|-.|+||||||-.+-.
T Consensus        20 i~G~sg~GKS~la~~l~~   37 (169)
T d1ko7a2          20 ITGDSGIGKSETALELIK   37 (169)
T ss_dssp             EEESTTSSHHHHHHHHHH
T ss_pred             EEeCCCCCHHHHHHHHHH
Confidence            999999999999966543

>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor Tu (EF-Tu), N-terminal (G) domain
species: Thermus thermophilus [TaxId: 274]

Probab=88.66  E-value=0.084  Score=35.34  Aligned_cols=17  Identities=24%  Similarity=0.137  Sum_probs=15.4

Q ss_pred             ccCcCCCchhHHHHhhh
Q 042811           91 PFGVEGVGKITSLSKSY  107 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~  107 (130)
                      |+|-.+.|||||+..+.
T Consensus         8 iiGhvd~GKSTL~~~Ll   24 (204)
T d2c78a3           8 TIGHVDHGKTTLTAALT   24 (204)
T ss_dssp             EECSTTSSHHHHHHHHH
T ss_pred             EEeCCCCcHHHHHHHHH
Confidence            78999999999998874

>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor SelB, N-terminal domain
species: Methanococcus maripaludis [TaxId: 39152]

Probab=88.57  E-value=0.076  Score=34.40  Aligned_cols=18  Identities=28%  Similarity=0.110  Sum_probs=16.2

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |+|-..+|||||+..+-+
T Consensus        10 iiG~~naGKSTL~n~L~~   27 (179)
T d1wb1a4          10 IFGHIDHGKTTLSKVLTE   27 (179)
T ss_dssp             EEECTTSSHHHHHHHHHT
T ss_pred             EEeCCCCcHHHHHHHHHH
Confidence            899999999999998754

>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Smc head domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=88.56  E-value=0.081  Score=38.05  Aligned_cols=17  Identities=24%  Similarity=0.315  Sum_probs=15.8

Q ss_pred             ccCcCCCchhHHHHhhh
Q 042811           91 PFGVEGVGKITSLSKSY  107 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~  107 (130)
                      |+|--|+||||++.+|.
T Consensus        30 i~G~NGsGKS~ileAi~   46 (427)
T d1w1wa_          30 IIGPNGSGKSNMMDAIS   46 (427)
T ss_dssp             EECSTTSSHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHH
Confidence            99999999999999874

>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Central domain of beta subunit of F1 ATP synthase
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=88.05  E-value=0.24  Score=34.94  Aligned_cols=34  Identities=21%  Similarity=0.145  Sum_probs=24.6

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR  126 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS  126 (130)
                      |.|-.|+|||||+..+-+.. . +.+=++++++-+.
T Consensus        73 If~~~g~GKt~l~~~i~~~~-~-~~~~~v~V~~~iG  106 (276)
T d2jdid3          73 LFGGAGVGKTVLIMELINNV-A-KAHGGYSVFAGVG  106 (276)
T ss_dssp             EEECTTSSHHHHHHHHHHHH-T-TTCSSEEEEEEES
T ss_pred             eeCCCCCCHHHHHHHHHHHH-H-hhCCCeEEEEEec
Confidence            99999999999988887654 1 2333566666554

>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Deoxynucleoside monophosphate kinase
species: Bacteriophage T4 [TaxId: 10665]

Probab=88.02  E-value=0.1  Score=35.10  Aligned_cols=19  Identities=26%  Similarity=0.167  Sum_probs=16.2

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |.|.-|+||||.|+.+.+.
T Consensus         6 iTG~igSGKsTva~~l~e~   24 (241)
T d1deka_           6 LSGVKRSGKDTTADFIMSN   24 (241)
T ss_dssp             EECCTTSSHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHh
Confidence            7899999999999988543

>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: YchF GTP-binding protein N-terminal domain
species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]

Probab=87.77  E-value=0.088  Score=37.14  Aligned_cols=19  Identities=26%  Similarity=0.247  Sum_probs=17.4

Q ss_pred             ccCcCCCchhHHHHhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~  109 (130)
                      |+|...+|||||...+-+.
T Consensus        15 ivG~Pn~GKSTlfnalT~~   33 (296)
T d1ni3a1          15 IVGMPNVGKSTFFRAITKS   33 (296)
T ss_dssp             EEECSSSSHHHHHHHHHHS
T ss_pred             EECCCCCCHHHHHHHHHCC
Confidence            9999999999999999764

>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Bacterial conjugative coupling protein TrwB
species: Escherichia coli [TaxId: 562]

Probab=87.65  E-value=0.088  Score=38.45  Aligned_cols=23  Identities=22%  Similarity=0.060  Sum_probs=17.6

Q ss_pred             CccccCcCCCchhHHHHhhhhhh
Q 042811           88 NNWPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        88 ~l~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .+.|+|..|+|||++++.+....
T Consensus        52 H~~I~G~tGsGKT~~l~~li~~~   74 (433)
T d1e9ra_          52 HLLVNGATGTGKSVLLRELAYTG   74 (433)
T ss_dssp             CEEEEECTTSSHHHHHHHHHHHH
T ss_pred             eEEEEeCCCCcHHHHHHHHHHHH
Confidence            34599999999999987654433

>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Central domain of alpha subunit of F1 ATP synthase
species: Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]

Probab=87.21  E-value=0.27  Score=34.64  Aligned_cols=33  Identities=15%  Similarity=0.132  Sum_probs=22.8

Q ss_pred             ccCcCCCchhHHHHhhhhhhhhccCCCCeEEEEEeC
Q 042811           91 PFGVEGVGKITSLSKSYPEFLEDEGIFLIKMHDVVR  126 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~~~~~~~Fd~~~wv~VS  126 (130)
                      |+|-.|+|||+|+..+-...   ..+-+.++++-+.
T Consensus        72 Ifg~~g~GKt~l~~~~~~~~---~~~~~v~V~~~iG  104 (276)
T d1fx0a3          72 IIGDRQTGKTAVATDTILNQ---QGQNVICVYVAIG  104 (276)
T ss_dssp             EEESSSSSHHHHHHHHHHTC---CTTTCEEEEEEES
T ss_pred             eccCCCCChHHHHHHHHhhh---cccCceeeeeeec
Confidence            99999999999998743322   2344566666553

>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Rep 40 protein helicase domain
species: Adeno-associated virus 2, AAV2 [TaxId: 10804]

Probab=86.72  E-value=0.13  Score=36.11  Aligned_cols=20  Identities=25%  Similarity=0.400  Sum_probs=17.3

Q ss_pred             cccCcCCCchhHHHHhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPE  109 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~  109 (130)
                      +++|.|+.||||++..|-+-
T Consensus       108 ~l~G~~~tGKS~f~~~i~~~  127 (267)
T d1u0ja_         108 WLFGPATTGKTNIAEAIAHT  127 (267)
T ss_dssp             EEECSTTSSHHHHHHHHHHH
T ss_pred             EEEcCCCCCHHHHHHHHHHH
Confidence            39999999999999887653

>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Initiation factor IF2/eIF5b, N-terminal (G) domain
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]

Probab=86.48  E-value=0.13  Score=34.64  Aligned_cols=18  Identities=28%  Similarity=0.196  Sum_probs=15.7

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |+|-..+|||||+..+-.
T Consensus        10 IiGh~d~GKSTL~~~L~~   27 (227)
T d1g7sa4          10 VLGHVDHGKTTLLDHIRG   27 (227)
T ss_dssp             EECSTTSSHHHHHHHHHH
T ss_pred             EEeCCCccHHHHHHHHHh
Confidence            789999999999988754

>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase YlqF
species: Bacillus subtilis [TaxId: 1423]

Probab=85.71  E-value=0.14  Score=35.65  Aligned_cols=20  Identities=25%  Similarity=0.325  Sum_probs=17.9

Q ss_pred             ccCcCCCchhHHHHhhhhhh
Q 042811           91 PFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~~~  110 (130)
                      |+||..|||+||+..+.+..
T Consensus       117 vvG~PNvGKSsliN~L~~~~  136 (273)
T d1puja_         117 IIGIPNVGKSTLINRLAKKN  136 (273)
T ss_dssp             EEESTTSSHHHHHHHHHTSC
T ss_pred             EEecCccchhhhhhhhhccc
Confidence            99999999999999987743

>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Interferon-inducible GTPase
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=85.26  E-value=0.15  Score=37.64  Aligned_cols=18  Identities=22%  Similarity=0.209  Sum_probs=16.5

Q ss_pred             ccCcCCCchhHHHHhhhh
Q 042811           91 PFGVEGVGKITSLSKSYP  108 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~~  108 (130)
                      |+|..|+|||||...+.+
T Consensus        61 i~G~~n~GKSSLiNaL~G   78 (400)
T d1tq4a_          61 VTGETGSGKSSFINTLRG   78 (400)
T ss_dssp             EEECTTSSHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            899999999999999865

>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTP-binding protein PH0525
species: Pyrococcus horikoshii [TaxId: 53953]

Probab=85.23  E-value=0.14  Score=36.06  Aligned_cols=17  Identities=35%  Similarity=0.339  Sum_probs=15.4

Q ss_pred             ccCcCCCchhHHHHhhh
Q 042811           91 PFGVEGVGKITSLSKSY  107 (130)
Q Consensus        91 I~GmGGvGKTTLak~v~  107 (130)
                      |+|...+|||||...+-
T Consensus         5 lvG~pn~GKStlfn~lt   21 (319)
T d1wxqa1           5 VVGKPNVGKSTFFSAAT   21 (319)
T ss_dssp             EEECTTSSHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHH
Confidence            78999999999999983

>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: gamma subunit of DNA polymerase III, N-domain
species: Thermotoga maritima [TaxId: 2336]

Probab=83.87  E-value=0.19  Score=33.36  Aligned_cols=21  Identities=5%  Similarity=-0.374  Sum_probs=18.3

Q ss_pred             cccCcCCCchhHHHHhhhhhh
Q 042811           90 WPFGVEGVGKITSLSKSYPEF  110 (130)
Q Consensus        90 ~I~GmGGvGKTTLak~v~~~~  110 (130)
                      .++|-.|+||||+|+.+-+..
T Consensus        19 l~~G~~g~gk~~~a~~l~~~i   39 (198)
T d2gnoa2          19 LINGEDLSYPREVSLELPEYV   39 (198)
T ss_dssp             EEECSSSSHHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHH
Confidence            389999999999999887755