Citrus Sinensis ID: 042822

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-----
MEIAEQIGLTLDKETEHARASMLYAQLKKSRKILVILDNVWTELHLKDVGIPFGDEHKGCKVLLTTRGRDLLSRMGSEADVRMDILNEEEAWRLFEVKLGNDGLIRRMKSTATQIVKQCGGLPIALEPIAKALRNKTESECWKNALHELRMPTENNFHRELGKAYTAIKLSYDALKGEQLKKIFQLCSLMPKSFFASDLFKYCIGLGIFRGINMEDARNTLYTLVHELKDSCLLLEGYSCREFSMHDVVHDVAILIACGEQKEFLVRNGDVWEWPDKDALKKCYAISWIDSSGGELPEGLECPQLELLLLSSKHSSVDVNIPRSFFTGMRELKVVDLTNMQLFSLPSSIDLLLNLRTLCLDHGTLGDITIIGELKNLEILSLIGSDIVEFPEELGKLTKLRLLDLTNCFHLKVIAANLIASFTRLEELYMSNCFVEWKVEDEGSSSKRSKASLDELMPLPRLTTLEIAVENDNALPEGFFVRELERFKILIGDRSFEPPVILSKDWFRISRSHFLILDHQSLRMLKLKLNCKTICSRKLQGIRKVEYLCLDKFQGVKNILFELDTQGFSQLKHLLVQNNPDLLFIVDSREIVDCDAFPLLELLSLQNLINLKTICVDRLSTESFAELRTMKVENCDELSNIFVLSTTKCLPSLQRIAVIKCNKMKEIFAIGGEEPDVADNSNANEKIEFAQIRYLSLGNLPELKSFFCELRGPSMSPNRRETQEGLTASTGDSEIIVEDMPDTWTSLFNEKRLWSCVKLMPKVFGTIKLLVAFNV
cHHHHHHccccccccHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccEEEEEEccHHHHHHcccccEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHccccccccccccccHHHHHHHHHccccccHHHHHHHHHccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccccccccEEEEcHHHHHHHHHHHccccccEEEEccccccccccccEEEEEEEEEEcccccccccccccccccEEEccccccccccccccHHHcccccccEEEccccccccccccccccccccEEEccccccccccHHcccccccEEcccccccccccHHccccccccEEccccccccccccHHHHcccccccEEEccccEEEEEEEcccccccccccccccccccccccEEEEEEEccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccEEEEccccccccccccccccccEEEcccccccEEccccccccccccccEEEEEcccccEEEccccccccccccccccEEEEEccccccEEccccccccccccccEEEEEcccccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccc
cHHHHHHccccccccHHHHHHHHHHHHHcccEEEEEEEccccHccHHHHcccccccccccEEEEEEccHHHHHHccccccEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccccHHHHHccHcccccHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEHHHHHHHHHHHHccccEEEEEEccccccccccccccEEEEEEEcccccccccccccccccEEEEEEccccccccccccHHHHcccccEEEEccccccccccccccccccccEEEccccccccccccccccccEEEEEccccccccccHHcccccccEEEEccccccccccHHHHHHcccccEEEEEcccccEcccccccccccccccHHHHcccccccEEEEcccccccccccccccccccEEEEEccccccccccccccccHHHHHHHHcccccccccEEcccccccccHHHHcccccccEEEcccccccccccccccccccccccEccccccHHHHHHccccccccccccccccEEEEcccHcHHHccccccccccccccEEEEEccccccccccccccccccccccEEEEcccHcHHHcccccccccccccccccccccccccccEEEEcccHHHHHHHHHcccccccHHHcccHccccccccccEEEcccccccccHHHcEEEcccccccccccccHHHEEEEEcc
MEIAEQIGLTLDKETEHARASMLYAQLKKSRKILVILDNVwtelhlkdvgipfgdehkgCKVLLTTRGRDLLSRMGSEADVRMDILNEEEAWRLFEVKLGNDGLIRRMKSTATQIVKQCGGLPIALEPIAKALRNKTESECWKNALHelrmptennfhRELGKAYTAIKLSYDALKGEQLKKIFQLCslmpksffasDLFKYCIGLGIFRGINMEDARNTLYTLVHELKDSClllegyscrefsmhdVVHDVAILIACGEQKEFlvrngdvwewpdkdalkkcyaiswidssggelpeglecpqlELLLLSskhssvdvniprsfftgmrelkvvdltnmqlfslpsSIDLLLNLRTLCldhgtlgditiigelkNLEILSLIGSDIVEFPEELGKLtklrlldltncFHLKVIAANLIASFTRLEELYMSncfvewkvedegssskrskasldelmplprlttLEIAVendnalpegfFVRELERFKIligdrsfeppvilskdwfrisrshFLILDHQSLRMLKLKLNCKTICSRKLQGIRKVEYLCLDKFQGVKNILFELDTQGFSQLKHLLvqnnpdllfivdsreivdcdafpLLELLSLQNLINLKTICVDRLSTESFAELRTMKVENCDELSNIFVLsttkclpslQRIAVIKCNKMKEIFaiggeepdvadnsnanEKIEFAQIRYLslgnlpelksffcelrgpsmspnrretqegltastgdseiivedmpdtwtslfnekRLWSCVKLMPKVFGTIKLLVAFNV
meiaeqigltldketehARASMLYAQLKKSRKILVILDNVWTELHLKdvgipfgdehkGCKVLLTTrgrdllsrmgseadvrMDILNEEEAWRLFEVKLGNDGLIRRMKSTATQIVKQCGGLPIALEPIAKALRNKTESECWKNALHELRMPTENNFHRELGKAYTAIKLSYDALKGEQLKKIFQLCSLMPKSFFASDLFKYCIGLGIFRGINMEDARNTLYTLVHELKDSCLLLEGYSCREFSMHDVVHDVAILIACGEQKEFLVRNGDVWEWPDKDALKKCYAISWIDSSGGELPEGLECPQLELLLLSSKHSSVDVNIPRSFFTGMRELKVVDLTNMQLFSLPSSIDLLLNLRTLCLDHGTLGDITIIGELKNLEILSLIGSDIVEFPEELGKLTKLRLLDLTNCFHLKVIAANLIASFTRLEELYMSNCFVEWKVedegssskrskasldelmplpRLTTLEIAVENDNALPEGFFVRELERFKiligdrsfeppVILSKDWFRISRSHFLILDHQSLRMLKLKLNCKTICSRKLQGIRKVEYLCLDKFQGVKNILFELDTQGFSQLKHLLVQNNPDLLFIVDSREIVDCDAFPLLELLSLQNLINLKTICVDRLSTESFAELRTMKVENCDELSNIFVlsttkclpsLQRIAVIKCNKMKEIFAIGgeepdvadnsNANEKIEFAQIRYLSLGNLPELKSFFCELRGPsmspnrretqegltastgdseiiVEDMPDTWTSLFNEKRLWSCVKLMPKVFGTIKLLVAFNV
MEIAEQIGLTLDKETEHARASMLYAQLKKSRKILVILDNVWTELHLKDVGIPFGDEHKGCKVLLTTRGRDLLSRMGSEADVRMDILNEEEAWRLFEVKLGNDGLIRRMKSTATQIVKQCGGLPIALEPIAKALRNKTESECWKNALHELRMPTENNFHRELGKAYTAIKLSYDALKGEQLKKIFQLCSLMPKSFFASDLFKYCIGLGIFRGINMEDARNTLYTLVHELKDSCLLLEGYSCREFSMHDVVHDVAILIACGEQKEFLVRNGDVWEWPDKDALKKCYAISWIDssggelpeglecpqlellllssKHSSVDVNIPRSFFTGMRELKVVDLTNMQLFSLPSSIDlllnlrtlclDHGTLGDITIIGELKNLEILSLIGSDIVEFPEElgkltklrlldltNCFHLKVIAANLIASFTRLEELYMSNCFVEWKVEDEGSSSKRSKASLDELMPLPRLTTLEIAVENDNALPEGFFVRELERFKILIGDRSFEPPVILSKDWFRISRSHFLILDHQSLRMLKLKLNCKTICSRKLQGIRKVEYLCLDKFQGVKNILFELDTQGFSQLKHLLVQNNPDLLFIVDSREIVDCDAFPllellslqnlinlKTICVDRLSTESFAELRTMKVENCDELSNIFVLSTTKCLPSLQRIAVIKCNKMKEIFAIGGEEPDVADNSNANEKIEFAQIRYLSLGNLPELKSFFCELRGPSMSPNRRETQEGLTASTGDSEIIVEDMPDTWTSLFNEKRLWSCVKLMPKVFGTIKLLVAFNV
********************SMLYAQLKKSRKILVILDNVWTELHLKDVGIPFGDEHKGCKVLLTTRGRDLLSRMGSEADVRMDILNEEEAWRLFEVKLGNDGLIRRMKSTATQIVKQCGGLPIALEPIAKALRNKTESECWKNALHELRMPTENNFHRELGKAYTAIKLSYDALKGEQLKKIFQLCSLMPKSFFASDLFKYCIGLGIFRGINMEDARNTLYTLVHELKDSCLLLEGYSCREFSMHDVVHDVAILIACGEQKEFLVRNGDVWEWPDKDALKKCYAISWIDSSGGELPEGLECPQLELLLLSSKHSSVDVNIPRSFFTGMRELKVVDLTNMQLFSLPSSIDLLLNLRTLCLDHGTLGDITIIGELKNLEILSLIGSDIVEFPEELGKLTKLRLLDLTNCFHLKVIAANLIASFTRLEELYMSNCFVEWKV*******************LPRLTTLEIAVENDNALPEGFFVRELERFKILIGDRSFEPPVILSKDWFRISRSHFLILDHQSLRMLKLKLNCKTICSRKLQGIRKVEYLCLDKFQGVKNILFELDTQGFSQLKHLLVQNNPDLLFIVDSREIVDCDAFPLLELLSLQNLINLKTICVDRLSTESFAELRTMKVENCDELSNIFVLSTTKCLPSLQRIAVIKCNKMKEIFAIGGE***********EKIEFAQIRYLSLGNLPELKSFFCEL************************IIVEDMPDTWTSLFNEKRLWSCVKLMPKVFGTIKLLVAF**
MEIAEQIGLTLD*******A**LYAQLKKSRKILVILDNVWTELHLKDVGIPFGDEHKGCKVLLTTRGRDLLSRMGSEADVRMDILNEEEAWRLFEVKLGNDGLIRRMKSTATQIVKQCGGLPIALEPIAKALRNKTESECWKNALHELRMP******RELGKAYTAIKLSYDALKGEQLKKIFQLCSLMPKSFFASDLFKYCIGLGIFRGINMEDARNTLYTLVHELKDSCLLLEGYSCREFSMHDVVHDVAILIACGEQKEFLVRNGDVWEWPDKDALKKCYAISWIDSSGGELPEGLECPQLELLLLSSKHSSVDVNIPRSFFTGMRELKVVDLTNMQLFSLPSSIDLLLNLRTLCLDHGTLGDITIIGELKNLEILSLIGSDIVEFPEELGKLTKLRLLDLTNCFHLKVIAANLIASFTRLEELYMSNCFVEWKVEDEGSS******SLDELMPLPRLTTLEIAVENDNALPEGFFVRELERFKILIGDRSFEPPVILSKDWFRISRSHFLILDHQSLRMLKLKLNCKTICSRKLQGIRKVEYLCLDKFQGVKNILFELDTQGFSQLKHLLVQNNPDLLFIVDSREIVDCDAFPLLELLSLQNLINLKTICVDRLSTESFAELRTMKVENCDELSNIFVLSTTKCLPSLQRIAVIKCNKMKEIFAIG**************KIEFAQIRYLSLGNLPELKSFFCELRGPSMSPN***********************DTWTSLFNEKRLWSCVKLMPK*FGTIKLLVAFNV
MEIAEQIGLTLDKETEHARASMLYAQLKKSRKILVILDNVWTELHLKDVGIPFGDEHKGCKVLLTTRGRDLLSRMGSEADVRMDILNEEEAWRLFEVKLGNDGLIRRMKSTATQIVKQCGGLPIALEPIAKALRNKTESECWKNALHELRMPTENNFHRELGKAYTAIKLSYDALKGEQLKKIFQLCSLMPKSFFASDLFKYCIGLGIFRGINMEDARNTLYTLVHELKDSCLLLEGYSCREFSMHDVVHDVAILIACGEQKEFLVRNGDVWEWPDKDALKKCYAISWIDSSGGELPEGLECPQLELLLLSSKHSSVDVNIPRSFFTGMRELKVVDLTNMQLFSLPSSIDLLLNLRTLCLDHGTLGDITIIGELKNLEILSLIGSDIVEFPEELGKLTKLRLLDLTNCFHLKVIAANLIASFTRLEELYMSNCFVEWK***********KASLDELMPLPRLTTLEIAVENDNALPEGFFVRELERFKILIGDRSFEPPVILSKDWFRISRSHFLILDHQSLRMLKLKLNCKTICSRKLQGIRKVEYLCLDKFQGVKNILFELDTQGFSQLKHLLVQNNPDLLFIVDSREIVDCDAFPLLELLSLQNLINLKTICVDRLSTESFAELRTMKVENCDELSNIFVLSTTKCLPSLQRIAVIKCNKMKEIFAIGGEEPDVADNSNANEKIEFAQIRYLSLGNLPELKSFFCELRGPSM**************TGDSEIIVEDMPDTWTSLFNEKRLWSCVKLMPKVFGTIKLLVAFNV
MEIAEQIGLTLDKETEHARASMLYAQLKKSRKILVILDNVWTELHLKDVGIPFGDEHKGCKVLLTTRGRDLLSRMGSEADVRMDILNEEEAWRLFEVKLGNDGLIRRMKSTATQIVKQCGGLPIALEPIAKALRNKTESECWKNALHELRMPTENNFHRELGKAYTAIKLSYDALKGEQLKKIFQLCSLMPKSFFASDLFKYCIGLGIFRGINMEDARNTLYTLVHELKDSCLLLEGYSCREFSMHDVVHDVAILIACGEQKEFLVRNGDVWEWPDKDALKKCYAISWIDSSGGELPEGLECPQLELLLLSSKHSSVDVNIPRSFFTGMRELKVVDLTNMQLFSLPSSIDLLLNLRTLCLDHGTLGDITIIGELKNLEILSLIGSDIVEFPEELGKLTKLRLLDLTNCFHLKVIAANLIASFTRLEELYMSNCFVEWKVEDEGSSSKRSKASLDELMPLPRLTTLEIAVENDNALPEGFFVRELERFKILIGDRSFEPPVILSKDWFRISRSHFLILDHQSLRMLKLKLNCKTICSRKLQGIRKVEYLCLDKFQGVKNILFELDTQGFSQLKHLLVQNNPDLLFIVDSREIVDCDAFPLLELLSLQNLINLKTICVDRLSTESFAELRTMKVENCDELSNIFVLSTTKCLPSLQRIAVIKCNKMKEIFAIGGEEPDVADNSNANEKIEFAQIRYLSLGNLPELKSFFCELRGPSMSPNRRETQEGLTASTGDSEIIVEDMPDTWTSLFNEKRLWSCVKLMPKVFGTIKLLVAFNV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEIAEQIGLTLDKETEHARASMLYAQLKKSRKILVILDNVWTELHLKDVGIPFGDEHKGCKVLLTTRGRDLLSRMGSEADVRMDILNEEEAWRLFEVKLGNDGLIRRMKSTATQIVKQCGGLPIALEPIAKALRNKTESECWKNALHELRMPTENNFHRELGKAYTAIKLSYDALKGEQLKKIFQLCSLMPKSFFASDLFKYCIGLGIFRGINMEDARNTLYTLVHELKDSCLLLEGYSCREFSMHDVVHDVAILIACGEQKEFLVRNGDVWEWPDKDALKKCYAISWIDSSGGELPEGLECPQLELLLLSSKHSSVDVNIPRSFFTGMRELKVVDLTNMQLFSLPSSIDLLLNLRTLCLDHGTLGDITIIGELKNLEILSLIGSDIVEFPEELGKLTKLRLLDLTNCFHLKVIAANLIASFTRLEELYMSNCFVEWKVEDEGSSSKRSKASLDELMPLPRLTTLEIAVENDNALPEGFFVRELERFKILIGDRSFEPPVILSKDWFRISRSHFLILDHQSLRMLKLKLNCKTICSRKLQGIRKVEYLCLDKFQGVKNILFELDTQGFSQLKHLLVQNNPDLLFIVDSREIVDCDAFPLLELLSLQNLINLKTICVDRLSTESFAELRTMKVENCDELSNIFVLSTTKCLPSLQRIAVIKCNKMKEIFAIGGEEPDVADNSNANEKIEFAQIRYLSLGNLPELKSFFCELRGPSMSPNRRETQEGLTASTGDSEIIVEDMPDTWTSLFNEKRLWSCVKLMPKVFGTIKLLVAFNV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query775 2.2.26 [Sep-21-2011]
Q9T048985 Disease resistance protei yes no 0.850 0.669 0.283 3e-59
O81825919 Probable disease resistan no no 0.860 0.725 0.289 3e-57
Q42484909 Disease resistance protei no no 0.565 0.481 0.314 4e-48
Q8RXS5888 Probable disease resistan no no 0.496 0.433 0.339 2e-39
O64973889 Disease resistance protei no no 0.485 0.422 0.319 2e-36
Q940K0889 Probable disease resistan no no 0.485 0.422 0.315 4e-36
Q9LVT4843 Probable disease resistan no no 0.518 0.476 0.301 3e-35
O82484892 Putative disease resistan no no 0.505 0.439 0.318 1e-33
Q9SH22884 Probable disease resistan no no 0.548 0.480 0.302 1e-33
Q9SI85893 Probable disease resistan no no 0.552 0.479 0.294 2e-33
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function desciption
 Score =  230 bits (587), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 210/740 (28%), Positives = 362/740 (48%), Gaps = 81/740 (10%)

Query: 2   EIAEQIGLTLD-----KETEHARASMLYAQLKKSRKILVILDNVWTELHLKDVGIPFGDE 56
           E+ +QI   LD     +E+E   A  +Y  L K RK L+ILD+VW  + L  +GIP  +E
Sbjct: 213 EVQKQIAERLDIDTQMEESEEKLARRIYVGLMKERKFLLILDDVWKPIDLDLLGIPRTEE 272

Query: 57  HKGCKVLLTTRGRDLLSRMGSEADVRMDILNEEEAWRLFEVKLGNDGLIRRMKSTATQIV 116
           +KG KV+LT+R  ++   M ++ DVR+D L EE+AW LF    G+      ++  A  + 
Sbjct: 273 NKGSKVILTSRFLEVCRSMKTDLDVRVDCLLEEDAWELFCKNAGDVVRSDHVRKIAKAVS 332

Query: 117 KQCGGLPIALEPIAKALRNKTESECWKNALHEL--RMPTENNFHRELGKAYTAIKLSYDA 174
           ++CGGLP+A+  +  A+R K   + W + L +L   +P   +      K +  +KLSYD 
Sbjct: 333 QECGGLPLAIITVGTAMRGKKNVKLWNHVLSKLSKSVPWIKSIEE---KIFQPLKLSYDF 389

Query: 175 LKGEQLKKIFQLCSLMPKSFF--ASDLFKYCIGLGIFRGI-NMEDARNTLYTLVHELKDS 231
           L+ ++ K  F LC+L P+ +    +++ +Y +  G    + + ED+ N   T V  LKD 
Sbjct: 390 LE-DKAKFCFLLCALFPEDYSIEVTEVVRYWMAEGFMEELGSQEDSMNEGITTVESLKDY 448

Query: 232 CLLLEGYSCREFSMHDVVHDVAILIACGEQKE--FLVRNGDVWEWPDKDALKKCY-AISW 288
           CLL +G       MHDVV D AI I    Q +   LV +G   +   +D L      +S 
Sbjct: 449 CLLEDGDRRDTVKMHDVVRDFAIWIMSSSQDDSHSLVMSGTGLQDIRQDKLAPSLRRVSL 508

Query: 289 IDSSGGELPEGLE--CPQLELLLLSSKHSSVDVNIPRSFFTGMRELKVVDLTNMQLFSLP 346
           +++    LP+ +E  C +  +LLL       +V  P  F      L++++L+  ++ S P
Sbjct: 509 MNNKLESLPDLVEEFCVKTSVLLLQGNFLLKEV--PIGFLQAFPTLRILNLSGTRIKSFP 566

Query: 347 S-SIDLLLNLRTLCL-DHGTLGDITIIGELKNLEILSLIGSDIVEFPEELGKLTKLRLLD 404
           S S+  L +L +L L D   L  +  +  L  LE+L L G+ I+EFP  L +L + R LD
Sbjct: 567 SCSLLRLFSLHSLFLRDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLD 626

Query: 405 LTNCFHLKVIAANLIASFTRLEELYMSNCFVEWKVEDEGSSSKRSKASLDELMPLPRLTT 464
           L+   HL+ I A +++  + LE L M++    W V+ E   +++ +A+++E+  L RL  
Sbjct: 627 LSRTLHLESIPARVVSRLSSLETLDMTSSHYRWSVQGE---TQKGQATVEEIGCLQRLQV 683

Query: 465 LEIAVENDNAL--PEGFFVRELERFKILIGDRSFEPPVILSKDWFRISRSHFLILDHQSL 522
           L I + +   L      +++ L++F++++G R                  + L   H   
Sbjct: 684 LSIRLHSSPFLLNKRNTWIKRLKKFQLVVGSR------------------YILRTRHDKR 725

Query: 523 RMLKLKLNCKTICSRKLQGIRKVEYLCLDKFQGVKNILFEL--DTQGFSQLKHLLVQNNP 580
           R+    LN   +    L  +     L L+  QG++ ++ +L  D +GF  LK L ++N  
Sbjct: 726 RLTISHLNVSQVSIGWL--LAYTTSLALNHCQGIEAMMKKLVSDNKGFKNLKSLTIEN-- 781

Query: 581 DLLFIVDSREIVDCDAFPLLELLS--LQNLINLKTICVDRLSTESFAELRT--------- 629
               I+++   V+  +    +  S  L  L NL+ + + R+  E+F+EL+T         
Sbjct: 782 ---VIINTNSWVEMVSTNTSKQSSDILDLLPNLEELHLRRVDLETFSELQTHLGLKLETL 838

Query: 630 --MKVENCDELSNIFVLSTTKCLPSLQRIAVIKCNKMKEIF-AIGGEEPDVADNSNANEK 686
             +++  C +L  +        +P+L+ I +  C+ ++ +  A+   +P V +       
Sbjct: 839 KIIEITMCRKLRTLLDKRNFLTIPNLEEIEISYCDSLQNLHEALLYHQPFVPN------- 891

Query: 687 IEFAQIRYLSLGNLPELKSF 706
                +R L L NLP L S 
Sbjct: 892 -----LRVLKLRNLPNLVSI 906
Disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description
>sp|Q940K0|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVT4|DRL37_ARATH Probable disease resistance protein At5g47250 OS=Arabidopsis thaliana GN=At5g47250 PE=2 SV=1 Back     alignment and function description
>sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1 Back     alignment and function description
>sp|Q9SH22|DRL20_ARATH Probable disease resistance protein At1g63360 OS=Arabidopsis thaliana GN=At1g63360 PE=2 SV=1 Back     alignment and function description
>sp|Q9SI85|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query775
255563252 1603 Disease resistance protein RPS5, putativ 0.918 0.444 0.436 1e-148
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.927 0.546 0.424 1e-144
224125154 949 cc-nbs-lrr resistance protein [Populus t 0.918 0.750 0.412 1e-140
224143316 1337 cc-nbs-lrr resistance protein [Populus t 0.916 0.531 0.425 1e-136
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.903 0.284 0.415 1e-136
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.916 0.529 0.425 1e-134
224083434 1144 cc-nbs-lrr resistance protein [Populus t 0.914 0.619 0.415 1e-133
255574526 1232 Disease resistance protein RFL1, putativ 0.873 0.549 0.423 1e-131
359488027 1520 PREDICTED: disease resistance protein At 0.92 0.469 0.396 1e-130
296087872 1152 unnamed protein product [Vitis vinifera] 0.914 0.615 0.397 1e-129
>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  531 bits (1367), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 329/754 (43%), Positives = 456/754 (60%), Gaps = 42/754 (5%)

Query: 3   IAEQIGLTLDKETEHARASMLYAQLKKSRKILVILDNVWTELHLKDVGIPFGDEHKGCKV 62
           IA+ +GL  D+ETE  RA  L  +L   +KILVILDN+W +L L++VGIP G +HKGCK+
Sbjct: 226 IADVLGLKFDEETETGRAYRLRQRLMTEKKILVILDNIWAQLELEEVGIPCGVDHKGCKI 285

Query: 63  LLTTRGRDLLS-RMGSEADVRMDILNEEEAWRLFEVKLGNDGLIRRMKSTATQIVKQCGG 121
           LLT+R RDLLS  MG +   R+++L EEEA  LFE+ +G D      +S A+++ K+C G
Sbjct: 286 LLTSRSRDLLSCDMGVQKVFRLEVLQEEEALSLFEMMVG-DVKGGEFQSAASEVTKKCAG 344

Query: 122 LPIALEPIAKALRNKTESECWKNALHELRMPTENNFHRELGKAYTAIKLSYDALKGEQLK 181
           LP+ +  IA+AL+NK +   WK+A+ +L             K Y+A++LSY+ L G ++K
Sbjct: 345 LPVLIVTIARALKNK-DLYVWKDAVKQLSRCDNEEIQE---KVYSALELSYNHLIGAEVK 400

Query: 182 KIFQLCSLMPKSFFAS-DLFKYCIGLGIFRGIN-MEDARNTLYTLVHELKDSCLLLEGYS 239
            +F LC L+ KS  A  DL  Y  GLG+F+GI+ + DARN ++ L+ +LK +CLLL+   
Sbjct: 401 SLFLLCGLLGKSDIAILDLLMYSTGLGLFKGIDTLGDARNRVHKLISDLKAACLLLDSDI 460

Query: 240 CREFSMHDVVHDVAILIACGEQKEFLVRNGDVW-EWPDKDALKKCYAISWIDSSGGELPE 298
                +HDVV DVAI IA   Q  F VRNG +  EWP+KD  K C  IS   +    LPE
Sbjct: 461 KGRVKIHDVVRDVAISIASRMQHLFTVRNGALLKEWPNKDVCKSCTRISLPYNDIHGLPE 520

Query: 299 GLECPQLELLLLSSKHSSVDVNIPRSFFTGMRELKVVDLTNMQLFSLPSSIDLLLNLRTL 358
            LECP+LEL LL ++   + + +P   F   + L+V++ T M   SLP S+  L NL TL
Sbjct: 521 VLECPELELFLLFTQ--DISLKVPDLCFELTKNLRVLNFTGMHFSSLPPSLGFLKNLFTL 578

Query: 359 CLDHGTLGDITIIGELKNLEILSLIGSDIVEFPEELGKLTKLRLLDLTNCFHLKVIAANL 418
           CLD   L D+ IIGEL  L ILS   SDIVE P E+ +LTKL+ LDL++C  LKVI A +
Sbjct: 579 CLDWCALRDVAIIGELTGLTILSFKHSDIVELPREIRQLTKLKFLDLSHCLKLKVIPAKI 638

Query: 419 IASFTRLEELYMSNCFVEWKVEDEGSSSKRSKASLDELMPLPRLTTLEIAVENDNALPEG 478
           I+  T+LEELYM+N F  W V+  G +++R+ ASL EL  LP LTTLEI V +   LP+ 
Sbjct: 639 ISELTQLEELYMNNSFDLWDVQ--GINNQRN-ASLAELECLPYLTTLEICVLDAKILPKD 695

Query: 479 FFVRELERFKILIGDRSFEPPVILSKDWFRISRSHFLILDHQSLRMLKLKLNCKTICSRK 538
            F R+LERF+I IGD            W           D+ + R LKLKLN  +I    
Sbjct: 696 LFFRKLERFRIFIGDV-----------WSGTG-------DYGTSRTLKLKLNTSSIHLEH 737

Query: 539 LQGI--RKVEYLCLDKFQGVKNILFELDTQGFSQLKHLLVQNNPDLLFIVDSREIVDCDA 596
              I     E L L + +G+K++L++LD+QGF+QLKHL VQN+P++ +I+D      C+A
Sbjct: 738 GLSILLEVTEDLYLAEVKGIKSVLYDLDSQGFTQLKHLDVQNDPEIQYIIDPNRRSPCNA 797

Query: 597 FPLLELLSLQNLINLKTICVDRLSTESFAELRTMKVENCDELSNIFVLSTTKCLPSLQRI 656
           FP+LE L L NL++L+ IC  +L+T SF++LR++ V  CD L N+F  S  +CL  LQ++
Sbjct: 798 FPILESLYLDNLMSLEKICCGKLTTGSFSKLRSLTVVKCDRLKNLFSFSMMRCLLQLQQM 857

Query: 657 AVIKCNKMKEIFAIGGEEPDVADNSNANEKIEFAQIRYLSLGNLPELKSFFCELRGPSMS 716
            V+ C  ++EI A G E+ D     N  E ++  Q+  L+L  LP  KS FC  +   +S
Sbjct: 858 KVVDCANLEEIVACGSEDTD-----NDYEAVKLTQLCSLTLKRLPMFKS-FCSKK--KVS 909

Query: 717 PNRRETQEGLTASTGDSEIIVEDMPDTWTSLFNE 750
           P     Q+ LT  TG  EI  +        LFNE
Sbjct: 910 PISLRVQKQLTTDTGLKEIAPKGELGDPLPLFNE 943

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224125154|ref|XP_002319513.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222857889|gb|EEE95436.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224143316|ref|XP_002336027.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222838884|gb|EEE77235.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224083434|ref|XP_002307025.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222856474|gb|EEE94021.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255574526|ref|XP_002528174.1| Disease resistance protein RFL1, putative [Ricinus communis] gi|223532386|gb|EEF34181.1| Disease resistance protein RFL1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359488027|ref|XP_002269288.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087872|emb|CBI35155.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query775
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.634 0.535 0.284 2e-47
TAIR|locus:2136447985 AT4G27190 [Arabidopsis thalian 0.845 0.664 0.251 4.4e-47
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.436 0.371 0.305 7.3e-39
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.326 0.284 0.363 1e-33
TAIR|locus:2201996889 RPS5 "AT1G12220" [Arabidopsis 0.485 0.422 0.294 2.8e-32
TAIR|locus:2201986885 RFL1 "AT1G12210" [Arabidopsis 0.441 0.386 0.288 1.2e-30
TAIR|locus:2036214851 AT1G15890 [Arabidopsis thalian 0.425 0.387 0.292 9.9e-30
TAIR|locus:2203881893 AT1G62630 [Arabidopsis thalian 0.344 0.298 0.316 1.6e-29
TAIR|locus:2170892848 AT5G43730 [Arabidopsis thalian 0.428 0.391 0.295 1.7e-29
TAIR|locus:2008440899 AT1G61180 [Arabidopsis thalian 0.485 0.418 0.296 2.6e-29
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 478 (173.3 bits), Expect = 2.0e-47, Sum P(2) = 2.0e-47
 Identities = 145/510 (28%), Positives = 232/510 (45%)

Query:     1 MEIAEQIGLTLDKETEHARASMLYAQLKKSRKILVILDNVWTELHLKDVGIPFGDEH-KG 59
             M+IA+++G    +E  +     +  +L   +  L+ILD+VW  + L  +GIP   E  K 
Sbjct:   186 MDIAKRLGKRFTREQMNQLGLTICERLIDLKNFLLILDDVWHPIDLDQLGIPLALERSKD 245

Query:    60 CKVLLTTRGRDLLSRMGSEADVRMDILNEEEAWRLFEVKLGNDGLIRRMKSTATQIVKQC 119
              KV+LT+R  ++  +M +  ++++  L E+EAW LF   +G       +K  A  +  +C
Sbjct:   246 SKVVLTSRRLEVCQQMMTNENIKVACLQEKEAWELFCHNVGEVANSDNVKPIAKDVSHEC 305

Query:   120 GGLPIALEPIAKALRNKTESECWKNALHELRMPTENNFHRELGKAYTAIKLSYDALKGEQ 179
              GLP+A+  I + LR K + E WK+ L+ L+    +    E  K +  +KLSYD L+ + 
Sbjct:   306 CGLPLAIITIGRTLRGKPQVEVWKHTLNLLKRSAPSIDTEE--KIFGTLKLSYDFLQ-DN 362

Query:   180 LKKIFQLCSLMPKSFF--ASDLFKYCIGLGIFRGIN-MEDARNTLYTLVHELKDSCLLLE 236
             +K  F  C+L P+ +    S+L  Y +  G+  G +  ED  N   TLV  LKDSCLL +
Sbjct:   363 MKSCFLFCALFPEDYSIKVSELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLED 422

Query:   237 GYSCREFSMHDVVHDVAI--LIACGEQKEFLVRNG-DVWEWPDKDALKKCYAISWIDXXX 293
             G SC    MHDVV D AI  + + GE    LV  G  + E+P    +     +S +    
Sbjct:   423 GDSCDTVKMHDVVRDFAIWFMSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKL 482

Query:   294 XXXXXXXXXXXXXXXXXXXKHSSVDVNIPRSFFTGMRELKVVDLTNMQLFSLPSSIDXXX 353
                                 +S V   +P  F      L+++DL+ +++ +LP S     
Sbjct:   483 ERLPNNVIEGVETLVLLLQGNSHVK-EVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLH 541

Query:   354 XXXXXXXDH-GTLGDITIIGELKNLEILSLIGSDIVEFPEEXXXXXXXXXXXXXNCFHLK 412
                     +   L ++  +  L  L+ L L  S I E P               N + L+
Sbjct:   542 SLRSLVLRNCKKLRNLPSLESLVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQ 601

Query:   413 VIAANLIASFTRLEELYMSNCFVEWKVEDEGSSSKRSKASLDELMPLPRLTTLEIAVEND 472
              I A  I   + LE L M+     W ++ E    +  +A+LDE+  LP L  L I + + 
Sbjct:   602 SIPAGTILQLSSLEVLDMAGSAYSWGIKGE---EREGQATLDEVTCLPHLQFLAIKLLDV 658

Query:   473 NALPEGF--FVRELERFKILIGD-RSFEPP 499
              +    F    + L +F+ L    RS  PP
Sbjct:   659 LSFSYEFDSLTKRLTKFQFLFSPIRSVSPP 688
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036214 AT1G15890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203881 AT1G62630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170892 AT5G43730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query775
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 9e-32
PLN032101153 PLN03210, PLN03210, Resistant to P 3e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 9e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.003
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score =  125 bits (315), Expect = 9e-32
 Identities = 59/214 (27%), Positives = 102/214 (47%), Gaps = 12/214 (5%)

Query: 3   IAEQIGLT---LDKETEHARASMLYAQLKKSRKILVILDNVWTELHLKDVGIPFGDEHKG 59
           I +++GL      ++ E   A  +   L   ++ L++LD+VW +     +G+PF D   G
Sbjct: 70  ILQELGLDDSDWVEKNESELAVKIKEALL-RKRFLLVLDDVWEKNDWDKIGVPFPDGENG 128

Query: 60  CKVLLTTRGRDLLSRMGSEAD-VRMDILNEEEAWRLFEVKLG--NDGLIRRMKSTATQIV 116
            +V++TTR   +  RMG  +    ++ L  EE+W LF  K+          ++  A +IV
Sbjct: 129 SRVIVTTRSESVAGRMGGTSKPHEVESLEPEESWELFSNKVFEKELPPCPELEEVAKEIV 188

Query: 117 KQCGGLPIALEPIAKALRNKTESECWKNALHELRMPTENNFHRELGKAYTAIKLSYDALK 176
           ++C GLP+AL+ +   L  K+  + W++ L +L           L +  + + LSYD L 
Sbjct: 189 EKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLN-NELAGRD-GLNEVLSILSLSYDNLP 246

Query: 177 GEQLKKIFQLCSLMPK--SFFASDLFKYCIGLGI 208
              LK+ F   +L P+  +     L K  I  G 
Sbjct: 247 -MHLKRCFLYLALFPEDYNIRKEQLIKLWIAEGF 279

Length = 285
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 775
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.97
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.89
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.88
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.85
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.84
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.83
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.79
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.76
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.67
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.56
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.56
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.56
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.53
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.5
KOG4237498 consensus Extracellular matrix protein slit, conta 99.24
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.17
KOG4237498 consensus Extracellular matrix protein slit, conta 99.14
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.12
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.1
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.1
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.95
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.95
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.91
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.77
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.77
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.74
KOG4341483 consensus F-box protein containing LRR [General fu 98.69
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.67
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.61
PLN03150623 hypothetical protein; Provisional 98.51
PLN03150623 hypothetical protein; Provisional 98.5
KOG4341483 consensus F-box protein containing LRR [General fu 98.48
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.38
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.36
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.36
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.29
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.28
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.23
PRK04841903 transcriptional regulator MalT; Provisional 98.15
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.12
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.07
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.01
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.01
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.0
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.97
PRK15386426 type III secretion protein GogB; Provisional 97.91
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.86
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.79
PRK15386426 type III secretion protein GogB; Provisional 97.69
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.68
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.64
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.61
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.44
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.42
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.39
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.27
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.01
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.81
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 96.42
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.41
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.36
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.35
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.29
PF05729166 NACHT: NACHT domain 96.25
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.15
PRK06893229 DNA replication initiation factor; Validated 96.1
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.91
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.8
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 95.56
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.28
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.02
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.63
COG3903414 Predicted ATPase [General function prediction only 94.03
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.0
PRK00411394 cdc6 cell division control protein 6; Reviewed 93.94
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.75
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 93.66
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.65
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 92.94
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.8
PF13173128 AAA_14: AAA domain 92.12
COG3899849 Predicted ATPase [General function prediction only 92.1
PF14516331 AAA_35: AAA-like domain 91.57
PRK13342413 recombination factor protein RarA; Reviewed 90.86
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.42
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.26
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 90.2
PRK09087226 hypothetical protein; Validated 89.79
PRK07471365 DNA polymerase III subunit delta'; Validated 89.74
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.02
smart0037026 LRR Leucine-rich repeats, outliers. 89.02
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 87.95
TIGR02928365 orc1/cdc6 family replication initiation protein. M 86.46
PRK05564313 DNA polymerase III subunit delta'; Validated 86.41
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 86.02
PRK08727233 hypothetical protein; Validated 85.96
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 85.18
PRK09112351 DNA polymerase III subunit delta'; Validated 84.73
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.31
smart0037026 LRR Leucine-rich repeats, outliers. 84.31
PRK08084235 DNA replication initiation factor; Provisional 83.43
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 82.8
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 81.41
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 81.22
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1e-67  Score=599.67  Aligned_cols=596  Identities=28%  Similarity=0.400  Sum_probs=430.4

Q ss_pred             ChHHHHhCCCCcc---ccHHHHHHHHHHHHhcCCcEEEEEEcCCCchhhhhccccCCCCCCCcEEEEEeCChHHHhh-cC
Q 042822            1 MEIAEQIGLTLDK---ETEHARASMLYAQLKKSRKILVILDNVWTELHLKDVGIPFGDEHKGCKVLLTTRGRDLLSR-MG   76 (775)
Q Consensus         1 ~~i~~~l~~~~~~---~~~~~~~~~l~~~l~~~kr~LlVlDdv~~~~~~~~l~~~~~~~~~gs~iivTTR~~~v~~~-~~   76 (775)
                      ++|+..+|.....   ...++.+..|.+.|+ +|||+|||||||+..+|+.|+.++|...+||||++|||++.|+.. ++
T Consensus       229 ~~Il~~l~~~~~~~~~~~~~~~~~~i~~~L~-~krfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~  307 (889)
T KOG4658|consen  229 QTILERLGLLDEEWEDKEEDELASKLLNLLE-GKRFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMG  307 (889)
T ss_pred             HHHHHHhccCCcccchhhHHHHHHHHHHHhc-cCceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhcccc
Confidence            4789999884433   334688899999998 799999999999999999999999999999999999999999998 88


Q ss_pred             CCceEEcCCCCHHHHHHHHHHHhCCC--CCcchhhHHHHHHHHHhCCCchhHHHHHHHHhcCCcHHHHHHHHHHhcCCCc
Q 042822           77 SEADVRMDILNEEEAWRLFEVKLGND--GLIRRMKSTATQIVKQCGGLPIALEPIAKALRNKTESECWKNALHELRMPTE  154 (775)
Q Consensus        77 ~~~~~~l~~L~~~~~~~Lf~~~a~~~--~~~~~~~~~~~~i~~~c~glPLai~~~g~~L~~~~~~~~w~~~l~~l~~~~~  154 (775)
                      +...+++++|+.+|||+||++.|+..  ...+.++++|++|+++|+|+|||++++|+.|+.|.+.++|+++.+.+.....
T Consensus       308 ~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~  387 (889)
T KOG4658|consen  308 VDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLA  387 (889)
T ss_pred             CCccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHcccccccc
Confidence            88999999999999999999999543  3445589999999999999999999999999999988889999999877644


Q ss_pred             CcchhhhhhHHHHHHhhHhccCchhHHHHHHhcCCCCCCCChh--hHHHHHhhccccccc-cHHHHHHHHHHHHHHHHHc
Q 042822          155 NNFHRELGKAYTAIKLSYDALKGEQLKKIFQLCSLMPKSFFAS--DLFKYCIGLGIFRGI-NMEDARNTLYTLVHELKDS  231 (775)
Q Consensus       155 ~~~~~~~~~~~~~l~~sy~~L~~~~lk~cf~~~~~fp~~~~~~--~li~~w~a~g~i~~~-~~~~~~~~~~~~~~~L~~~  231 (775)
                      .+.....+.+++++++|||.||++ +|.||+|||+||+|+.|+  +|+.+||||||+.+. ..+.+++.+++++.+|+++
T Consensus       388 ~~~~~~~~~i~~iLklSyd~L~~~-lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~  466 (889)
T KOG4658|consen  388 ADFSGMEESILPILKLSYDNLPEE-LKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRA  466 (889)
T ss_pred             CCCCchhhhhHHhhhccHhhhhHH-HHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHH
Confidence            444333458999999999999965 999999999999999998  999999999999885 5666899999999999999


Q ss_pred             cceeccc---ccceEEehHHHHHHHHHHHh-----ccCceEEeecCCccCCCCcccccceeEEEEEcCCCCCCCCCCCCC
Q 042822          232 CLLLEGY---SCREFSMHDVVHDVAILIAC-----GEQKEFLVRNGDVWEWPDKDALKKCYAISWIDSSGGELPEGLECP  303 (775)
Q Consensus       232 sl~~~~~---~~~~~~mHdlv~~l~~~~~~-----~e~~~~~~~~~~~~~~~~~~~~~~~~~l~l~~~~~~~lp~~~~~~  303 (775)
                      +++..+.   ...+|+|||+||++|.+++.     +++.+.... ......+....+..+|++++.++.+..++....++
T Consensus       467 ~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~-~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~  545 (889)
T KOG4658|consen  467 SLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDG-VGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENP  545 (889)
T ss_pred             HHHhhcccccceeEEEeeHHHHHHHHHHhccccccccceEEECC-cCccccccccchhheeEEEEeccchhhccCCCCCC
Confidence            9998765   34679999999999999998     666433322 24444566677889999999999999999999999


Q ss_pred             CccEEEcccCCC-CCccccChhhhhCCCcccEEEecCCC-CCCCCcccccccCccEEEcCCCCCCC-ccccccCCcccEE
Q 042822          304 QLELLLLSSKHS-SVDVNIPRSFFTGMRELKVVDLTNMQ-LFSLPSSIDLLLNLRTLCLDHGTLGD-ITIIGELKNLEIL  380 (775)
Q Consensus       304 ~Lr~L~l~~~~~-~~~~~l~~~~~~~l~~L~~L~l~~~~-~~~lp~~i~~l~~L~~L~L~~~~l~~-p~~i~~l~~L~~L  380 (775)
                      +|++|.+.+|.. ..  .++..+|..++.||+|||++|. +.++|.+|++|.|||||+++++.++. |.++++|+.|++|
T Consensus       546 ~L~tLll~~n~~~l~--~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~L  623 (889)
T KOG4658|consen  546 KLRTLLLQRNSDWLL--EISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYL  623 (889)
T ss_pred             ccceEEEeecchhhh--hcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhhee
Confidence            999999999863 22  6788889999999999999764 55899999999999999999998888 8888888888888


Q ss_pred             EecCC-CCcccchhhhccCCCCEecccCCccccccchHHhhccccccEEEcCCCcccceecccCCccccccccccccCCC
Q 042822          381 SLIGS-DIVEFPEELGKLTKLRLLDLTNCFHLKVIAANLIASFTRLEELYMSNCFVEWKVEDEGSSSKRSKASLDELMPL  459 (775)
Q Consensus       381 ~l~~~-~l~~lp~~i~~l~~L~~L~l~~~~~l~~~p~~~l~~L~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~l~~l~~l  459 (775)
                      ++..+ .+..+|..+..|++||+|.+.... . ......++.+.+|++|..-.+....            ...++.+..+
T Consensus       624 nl~~~~~l~~~~~i~~~L~~Lr~L~l~~s~-~-~~~~~~l~el~~Le~L~~ls~~~~s------------~~~~e~l~~~  689 (889)
T KOG4658|consen  624 NLEVTGRLESIPGILLELQSLRVLRLPRSA-L-SNDKLLLKELENLEHLENLSITISS------------VLLLEDLLGM  689 (889)
T ss_pred             ccccccccccccchhhhcccccEEEeeccc-c-ccchhhHHhhhcccchhhheeecch------------hHhHhhhhhh
Confidence            88887 344555556668888888876532 1 1111113333333333322221110            0112223333


Q ss_pred             CCCCEEEE----EeeCCCCCCC-ccccccccceEEEecCCCCCCccccccccccccccccccccccccceEEEeccCccc
Q 042822          460 PRLTTLEI----AVENDNALPE-GFFVRELERFKILIGDRSFEPPVILSKDWFRISRSHFLILDHQSLRMLKLKLNCKTI  534 (775)
Q Consensus       460 ~~L~~L~l----~~~~~~~~~~-~~~~~~L~~L~l~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~  534 (775)
                      ++|+++..    .+......+. ...                                      +.+|+.|.+..+....
T Consensus       690 ~~L~~~~~~l~~~~~~~~~~~~~~~~--------------------------------------l~~L~~L~i~~~~~~e  731 (889)
T KOG4658|consen  690 TRLRSLLQSLSIEGCSKRTLISSLGS--------------------------------------LGNLEELSILDCGISE  731 (889)
T ss_pred             HHHHHHhHhhhhcccccceeeccccc--------------------------------------ccCcceEEEEcCCCch
Confidence            33332111    1111111111 112                                      4444444444433221


Q ss_pred             ccc-cc-----c-ccccceEEeecccCCcccccccccccccccCcEEEeecCCCccccccCCCcc-----cCCcccccce
Q 042822          535 CSR-KL-----Q-GIRKVEYLCLDKFQGVKNILFELDTQGFSQLKHLLVQNNPDLLFIVDSREIV-----DCDAFPLLEL  602 (775)
Q Consensus       535 ~~~-~l-----~-~l~~L~~L~l~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~i~~~~~~~-----~~~~~p~L~~  602 (775)
                      ... +.     . .++++..+.+.+|....+..+...   .|+|+.|.+..|..++.+.+.....     ....|.+++.
T Consensus       732 ~~~~~~~~~~~~~~f~~l~~~~~~~~~~~r~l~~~~f---~~~L~~l~l~~~~~~e~~i~~~k~~~~l~~~i~~f~~~~~  808 (889)
T KOG4658|consen  732 IVIEWEESLIVLLCFPNLSKVSILNCHMLRDLTWLLF---APHLTSLSLVSCRLLEDIIPKLKALLELKELILPFNKLEG  808 (889)
T ss_pred             hhcccccccchhhhHHHHHHHHhhccccccccchhhc---cCcccEEEEecccccccCCCHHHHhhhcccEEeccccccc
Confidence            100 10     0 145555555666655554433322   3667777777766666553322111     1234566666


Q ss_pred             e-ecccccccccccccccCcccccCCCeEEeccCCCCCccccchhhcCCCCccEEEEecc-cchHHHh
Q 042822          603 L-SLQNLINLKTICVDRLSTESFAELRTMKVENCDELSNIFVLSTTKCLPSLQRIAVIKC-NKMKEIF  668 (775)
Q Consensus       603 L-~l~~~~~l~~~~~~~~~~~~~~~L~~L~l~~C~~L~~l~~~~~~~~l~~L~~L~l~~C-~~L~~l~  668 (775)
                      + .+.+.+.+.++...+..   ++.|+.+.+..||++..+         |.+.++.+.+| +.+...+
T Consensus       809 l~~~~~l~~l~~i~~~~l~---~~~l~~~~ve~~p~l~~~---------P~~~~~~i~~~~~~~~~~~  864 (889)
T KOG4658|consen  809 LRMLCSLGGLPQLYWLPLS---FLKLEELIVEECPKLGKL---------PLLSTLTIVGCEEKLKEYP  864 (889)
T ss_pred             ceeeecCCCCceeEecccC---ccchhheehhcCcccccC---------ccccccceeccccceeecC
Confidence            6 46666667766544443   556888888888887764         44566666675 5555443

>PLN03210 Resistant to P Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query775
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 3e-36
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 2e-25
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-25
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-09
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-09
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-07
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-06
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-04
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
 Score =  143 bits (362), Expect = 3e-36
 Identities = 37/265 (13%), Positives = 82/265 (30%), Gaps = 17/265 (6%)

Query: 11  LDKETEHARASMLYAQLKKSRKILVILDNVWTELHLKDVGIPFGDEHKGCKVLLTTRGRD 70
           ++  T      M+   L      L + D+V  E  ++        +    + L+TTR  +
Sbjct: 223 VEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWA------QELRLRCLVTTRDVE 276

Query: 71  LLSRMGSEAD-VRMDILNEEEAWRLFEVKLGNDGLIRRMKSTATQIVKQCGGLPIALEPI 129
           + +      + + +  L  +E +   E       +  + +    + ++   G P  L   
Sbjct: 277 ISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMF 336

Query: 130 AKALRNKTESECWKNALHELRMPTENNFHRELGKAY----TAIKLSYDALKGEQLKKIFQ 185
            K+   KT  +      ++L              +Y     A++   + L  E  +    
Sbjct: 337 FKSCEPKTFEK-MAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVLSDE-DRSALA 394

Query: 186 LCSLMPKSF-FASDLFKYCIGLGIFRGINMEDARNTLYTLVHELKDSCLLLEG--YSCRE 242
              +MP        L+   I + I      E   + +   +  L     LL G       
Sbjct: 395 FAVVMPPGVDIPVKLWSCVIPVDIC-SNEEEQLDDEVADRLKRLSKRGALLSGKRMPVLT 453

Query: 243 FSMHDVVHDVAILIACGEQKEFLVR 267
           F +  ++H     +   +     + 
Sbjct: 454 FKIDHIIHMFLKHVVDAQTIANGIS 478
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query775
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.96
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.95
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.94
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.94
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.94
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.91
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.9
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.9
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.89
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.88
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.88
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.87
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.87
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.87
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.87
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.86
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.86
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.85
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.84
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.83
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.82
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.82
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.82
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.81
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.8
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.8
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.79
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.79
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.79
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.79
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.78
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.78
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.78
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.78
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.78
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.76
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.74
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.74
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.74
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.73
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.73
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.73
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.73
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.73
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.73
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.72
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.72
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.72
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.72
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.71
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.71
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.7
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.69
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.69
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.68
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.65
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.65
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.64
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.63
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.62
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.62
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.61
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.6
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.6
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.6
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.59
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.59
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.58
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.58
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.58
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.57
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.57
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.57
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.56
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.55
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.55
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.54
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.53
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.52
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.51
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.51
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.51
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.51
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.5
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.5
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.49
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.44
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.43
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.42
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.4
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.4
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.38
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.38
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.37
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.37
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.36
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.32
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.29
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.29
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.28
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.28
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.28
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.2
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.17
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.16
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.1
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.02
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.98
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.87
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.85
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.74
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.68
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.66
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.63
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.62
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.38
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.35
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.25
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.23
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.17
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.16
2fna_A357 Conserved hypothetical protein; structural genomic 98.1
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.08
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.92
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.86
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 97.84
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.79
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.65
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.59
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 97.08
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 96.78
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.59
2v1u_A387 Cell division control protein 6 homolog; DNA repli 96.36
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.94
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 95.86
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 95.34
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.16
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.88
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 94.66
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.07
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 93.62
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.37
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 92.83
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 91.48
2chq_A319 Replication factor C small subunit; DNA-binding pr 89.64
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 88.73
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 84.33
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=100.00  E-value=1.7e-34  Score=323.58  Aligned_cols=240  Identities=16%  Similarity=0.148  Sum_probs=182.8

Q ss_pred             hHHHHhCCCC--------ccccHHHHHHHHHHHHhcCC-cEEEEEEcCCCchhhhhccccCCCCCCCcEEEEEeCChHHH
Q 042822            2 EIAEQIGLTL--------DKETEHARASMLYAQLKKSR-KILVILDNVWTELHLKDVGIPFGDEHKGCKVLLTTRGRDLL   72 (775)
Q Consensus         2 ~i~~~l~~~~--------~~~~~~~~~~~l~~~l~~~k-r~LlVlDdv~~~~~~~~l~~~~~~~~~gs~iivTTR~~~v~   72 (775)
                      +|+++++...        +..+..+++..+++.|. +| ||||||||||+.+++ .+    + ..+||+||||||++.|+
T Consensus       206 ~il~~l~~~~~~~~~~~~~~~~~~~l~~~l~~~L~-~~kr~LlVLDdv~~~~~~-~~----~-~~~gs~ilvTTR~~~v~  278 (549)
T 2a5y_B          206 DILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALI-DRPNTLFVFDDVVQEETI-RW----A-QELRLRCLVTTRDVEIS  278 (549)
T ss_dssp             HHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHT-TSTTEEEEEEEECCHHHH-HH----H-HHTTCEEEEEESBGGGG
T ss_pred             HHHHHHhcCcccccccccccccHHHHHHHHHHHHc-CCCcEEEEEECCCCchhh-cc----c-ccCCCEEEEEcCCHHHH
Confidence            5777887642        12345677889999998 65 999999999998865 11    1 12799999999999999


Q ss_pred             hhcC-CCceEEcCCCCHHHHHHHHHHHhCCCCCcchhhHHHHHHHHHhCCCchhHHHHHHHHhcCCcHHHHHHHHHH-hc
Q 042822           73 SRMG-SEADVRMDILNEEEAWRLFEVKLGNDGLIRRMKSTATQIVKQCGGLPIALEPIAKALRNKTESECWKNALHE-LR  150 (775)
Q Consensus        73 ~~~~-~~~~~~l~~L~~~~~~~Lf~~~a~~~~~~~~~~~~~~~i~~~c~glPLai~~~g~~L~~~~~~~~w~~~l~~-l~  150 (775)
                      ..++ ...+|+|++|+.+|||+||.++|+....++++.+++++|+++|+|+||||+++|+.|+.+ .++ |.+.+.. +.
T Consensus       279 ~~~~~~~~~~~l~~L~~~ea~~Lf~~~a~~~~~~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~-~w~-~~~~l~~~l~  356 (549)
T 2a5y_B          279 NAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPK-TFE-KMAQLNNKLE  356 (549)
T ss_dssp             GGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS-SHH-HHHHHHHHHH
T ss_pred             HHcCCCCeEEECCCCCHHHHHHHHHHHhcCCCCchhHHHHHHHHHHHhCCChHHHHHHHHHhccc-hHH-HHHHhHHHhh
Confidence            9876 446899999999999999999996544457888999999999999999999999999877 333 3333322 11


Q ss_pred             CCCcCcchhhhhhHHHHHHhhHhccCchhHHHHHH-----------hcCCCCCCCChhhHHHHHhhc--ccccccc-HHH
Q 042822          151 MPTENNFHRELGKAYTAIKLSYDALKGEQLKKIFQ-----------LCSLMPKSFFASDLFKYCIGL--GIFRGIN-MED  216 (775)
Q Consensus       151 ~~~~~~~~~~~~~~~~~l~~sy~~L~~~~lk~cf~-----------~~~~fp~~~~~~~li~~w~a~--g~i~~~~-~~~  216 (775)
                      ..       ....+.+++.+||++||++ +|.||+           |||+||+++.++  ++.|+|+  ||+.... ...
T Consensus       357 ~~-------~~~~i~~~l~~Sy~~L~~~-lk~~f~~Ls~~er~l~~~ls~fp~~~~i~--i~~w~a~~~G~i~~~~~~~~  426 (549)
T 2a5y_B          357 SR-------GLVGVECITPYSYKSLAMA-LQRCVEVLSDEDRSALAFAVVMPPGVDIP--VKLWSCVIPVDICSNEEEQL  426 (549)
T ss_dssp             HH-------CSSTTCCCSSSSSSSHHHH-HHHHHHTSCHHHHHHTTGGGSSCTTCCEE--HHHHHHHSCC-------CCC
T ss_pred             cc-------cHHHHHHHHhcccccccHH-HHHHHhccchhhhhHhhheeeeCCCCeee--eeeeeeeccceeccCCCCCC
Confidence            10       1125777999999999998 899999           999999999999  8999999  9997653 112


Q ss_pred             HHHHHHHHHHHHHHccceeccc--ccceEEehHHHHHHHHHHHhccC
Q 042822          217 ARNTLYTLVHELKDSCLLLEGY--SCREFSMHDVVHDVAILIACGEQ  261 (775)
Q Consensus       217 ~~~~~~~~~~~L~~~sl~~~~~--~~~~~~mHdlv~~l~~~~~~~e~  261 (775)
                      .++.+. ++++|+++||++...  ...+|+|||++|++|+.++.+++
T Consensus       427 ~~~~~~-~l~~L~~rsLl~~~~~~~~~~~~mHdlv~~~a~~~~~~~~  472 (549)
T 2a5y_B          427 DDEVAD-RLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQT  472 (549)
T ss_dssp             THHHHH-HHHHTTTBSSCSEEECSSSCEEECCHHHHHHHHTTSCTHH
T ss_pred             HHHHHH-HHHHHHHcCCeeEecCCCceEEEeChHHHHHHHHHHHHHH
Confidence            233333 799999999998653  34579999999999998876654
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 775
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 2e-19
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-04
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 86.8 bits (214), Expect = 2e-19
 Identities = 24/186 (12%), Positives = 57/186 (30%), Gaps = 17/186 (9%)

Query: 2   EIAEQIGLTLDKETEHARASMLYAQLKKSRKILVILDNVWTELHLKDVGIPFGDEHKGCK 61
           +            +   +  +  A +      L + D+V  E  ++        +    +
Sbjct: 107 DDLLNFPSVEHVTSVVLKRMICNALID-RPNTLFVFDDVVQEETIRW------AQELRLR 159

Query: 62  VLLTTRGRDLLSRMGSEADV-RMDILNEEEAWRLFEVKLGNDGLIRRMKSTATQIVKQCG 120
            L+TTR  ++ +      +   +  L  +E +   E       +  + +    + ++   
Sbjct: 160 CLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSS 219

Query: 121 GLPIALEPIAKALRNKTESECWKNALHELRMPTENNFHRELGKAYTAIKLSYDALKGEQL 180
           G P  L    K+   KT  E      ++L                     SY +L    L
Sbjct: 220 GNPATLMMFFKSCEPKTF-EKMAQLNNKLESRGLVGVEC-------ITPYSYKSL-AMAL 270

Query: 181 KKIFQL 186
           ++  ++
Sbjct: 271 QRCVEV 276
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query775
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.83
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.82
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.74
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.74
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.73
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.69
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.69
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.68
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.68
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.67
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.58
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.55
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.54
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.5
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.43
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.42
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.41
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.39
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.38
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.31
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.3
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.26
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.16
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.14
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.94
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.82
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.77
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.67
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.62
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.5
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.62
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.49
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.96
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.82
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.52
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.74
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 93.6
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 87.64
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 80.05
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 80.02
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.93  E-value=2.3e-26  Score=230.51  Aligned_cols=155  Identities=15%  Similarity=0.136  Sum_probs=127.1

Q ss_pred             HHHHHHHHHHHhcCCcEEEEEEcCCCchhhhhccccCCCCCCCcEEEEEeCChHHHhhcCCC-ceEEcCCCCHHHHHHHH
Q 042822           17 HARASMLYAQLKKSRKILVILDNVWTELHLKDVGIPFGDEHKGCKVLLTTRGRDLLSRMGSE-ADVRMDILNEEEAWRLF   95 (775)
Q Consensus        17 ~~~~~~l~~~l~~~kr~LlVlDdv~~~~~~~~l~~~~~~~~~gs~iivTTR~~~v~~~~~~~-~~~~l~~L~~~~~~~Lf   95 (775)
                      ......+.+.+. +||+|+||||||+.++|+.+.      ..|||||||||+++|+..+... +.|+|++|+.+|||+||
T Consensus       122 ~~~~~~~~~~L~-~kr~LlVLDDv~~~~~~~~~~------~~~srilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf  194 (277)
T d2a5yb3         122 VLKRMICNALID-RPNTLFVFDDVVQEETIRWAQ------ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFL  194 (277)
T ss_dssp             HHHHHHHHHHTT-STTEEEEEEEECCHHHHHHHH------HTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHH
T ss_pred             HHHHHHHHHHhc-cCCeeEecchhhHHhhhhhhc------ccCceEEEEeehHHHHHhcCCCCceEECCCCCHHHHHHHH
Confidence            334445666665 799999999999999988543      2479999999999999886544 78999999999999999


Q ss_pred             HHHhCCCCCcchhhHHHHHHHHHhCCCchhHHHHHHHHhcCCcHHHHHHHHHHhcCCCcCcchhhhhhHHHHHHhhHhcc
Q 042822           96 EVKLGNDGLIRRMKSTATQIVKQCGGLPIALEPIAKALRNKTESECWKNALHELRMPTENNFHRELGKAYTAIKLSYDAL  175 (775)
Q Consensus        96 ~~~a~~~~~~~~~~~~~~~i~~~c~glPLai~~~g~~L~~~~~~~~w~~~l~~l~~~~~~~~~~~~~~~~~~l~~sy~~L  175 (775)
                      +++|+.....+..++++++|+++|+|+||||+++|+.|+.++. ++|.+..+.++.....       .+.+++.+||++|
T Consensus       195 ~~~~~~~~~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~-~~~~~~~~~L~~~~~~-------~v~~il~~sY~~L  266 (277)
T d2a5yb3         195 EAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTF-EKMAQLNNKLESRGLV-------GVECITPYSYKSL  266 (277)
T ss_dssp             HHTSCCCC--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSH-HHHHHHHHHHHHHCSS-------TTCCCSSSSSSSH
T ss_pred             HHHhCCccCchhhHHHHHHHHHHhCCCHHHHHHHHHHhccCCH-HHHHHHHHHHhcCcHH-------HHHHHHHHHHhcc
Confidence            9999766666677899999999999999999999999988764 4599888887543222       5667999999999


Q ss_pred             CchhHHHHHHhc
Q 042822          176 KGEQLKKIFQLC  187 (775)
Q Consensus       176 ~~~~lk~cf~~~  187 (775)
                      |++ +|+||.++
T Consensus       267 ~~~-lk~c~~~l  277 (277)
T d2a5yb3         267 AMA-LQRCVEVL  277 (277)
T ss_dssp             HHH-HHHHHHTS
T ss_pred             cHH-HHHHHHhC
Confidence            998 99999864
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure