Citrus Sinensis ID: 042849

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------102
MGSRGKLLFDLNEPPAEDDEENDRIFSSQPQKALPSANPHTSELFVASAAPQGIINNNAFSHAPSVSGFQPFNRAKAAQGHGVEVEPKKAEDQNRRVASSSSKPGNGEDIKAASSSVPGSENAAADEREEGEWSDAEGSVDAYASNLLNEQGKASQGQGVSEVVDTATGVDIKVPESSQDGSNSHGVLGSDQDPSDQKRNRSRHSEANIKGEKSVDGQEEPCLLPKQREIKGTEASHTTKGANNLGKRKIDQQKEAMLGKKRNRQTVFLNLEDVKQAGSLKTSTPRRQNPPVVTRTVKEARTIPSPAERGGEKQSQAINKDQKQYDVSSCNEGGTSVEALEPKPECNGDMNFGLPGSTDPKLGTKKHPPAKKQTATANLYQDTSVERLIREVTNEKFWHHPVVHVPPIRTLLRIVTLKGHGKIYDASEESELQCVPGRFESVEEYVRVFEPLLFEECRAQLYSTWEELTETGSRDTHVMVRIRNIERRERGWYDVIVLPVNECKWSFKEGDVAVLSTPRPGSVRGKRNHSLAAEDDEEAEVSGRVAGTVRRHFPVDARDPPGAILHFYVGDSYDPSSSMDDDDHILRKLQPKGIWYLTVLGSLATTQREYVALHAFCRLNSQMQTAILKPSPEHFPKYEHQTPTMPECFTQNFIDHLHRTFNGPQLAAIQWAAIHTAAGTSSGMTKSPWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQHYYNSLLKKLAPESYKQPNESNSDNVSMGSIDEVLQNMDQNLLRTLPKLCPKPRMLVCAPSNAATDELLTRVLDRGFIDGEMKVYRPDVARVGVDSQTRAAQAVSVERRTEQLLVKSREEVIGWMHNLKGREAVLSQQIANLQRELNAAAFAVRSQGSVGVDPDVLMARDQNRDTLLQNLAAAVENRDKVLVEMSRFHILEGRFRPGSNFNLEEARASLEASFANEAEIVFTTVSSSGRKLFSRLTHGFDMVVIDEAAQASEVGVLPPLSLGAARCVLGGGSSAAPCNSYQQGSRHLDVQ
ccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEcccccEEEEEEEEccccccccccccEEEEccccccccccccccccccccccccccccEEEEEEEEccccccccccccEEEEEEccccccccccccHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHHHHHccHHHHHHccccccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccEEEEEccccccccEEEEcHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHcccHHHHcccccccccccccccccccHHHHHHHHHHHHccccccccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccEEEEccccccHHHHHHccccccEEEEccccccccccccccccccccEEEEEcccccccccccccccHHcccc
ccccccEcEcccccccccHHHHccEEEEcccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccEcccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccHccccccccccccccccccccHHHHHcccccccHHHcccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccHHcccHHHHHccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEEccccEEEEEEcccHHHccccccccEEEEEccccccccccccccccccccccccHHHHHHHHHEEcccccccccccEEEEEEccccccEEEEEcccccHHHHcccccEEEEEEEccccHHHHHHHHHHHHcccccHHHHEEccccccccccccccccccHHHccHHHHHHHHHHccHHHHHHHHHHHHcccccccccEEcccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHcccccccccccccccccccEEEEEcccHHHHHHHHHHHHHcccccccccccccEEEEEccHHHcHHHHcccHHHHHHHHHHHccHHHcccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccEEEEEccccHHHHHHHccccccEEEEEHHHHHHcHHHHcHHHccccEEEEEcccccccccHHHHHHHHcccc
mgsrgkllfdlneppaeddeendrifssqpqkalpsanphtselfvasaapqgiinnnafshapsvsgfqpfnrakaaqghgvevepkkaedqnrrvasssskpgngedikaasssvpgsenaaadereegewsdaegsVDAYASNLLneqgkasqgqgvsevvdtatgvdikvpessqdgsnshgvlgsdqdpsdqkrnrsrhseanikgeksvdgqeepcllpkqreikgteashttkgannlgkrkIDQQKEAMLGKKRNRQTVFLNLEdvkqagslktstprrqnppvvtrtvkeartipspaerggekqsqainkdqkqydvsscneggtsvealepkpecngdmnfglpgstdpklgtkkhppakkqtatanlyqdtSVERLIREVTnekfwhhpvvhvppirtLLRIVTLKghgkiydaseeselqcvpgrfeSVEEYVRVFEPLLFEECRAQLYSTWEELtetgsrdtHVMVRIRNIERRERGWYDVIVLPVNeckwsfkegdvavlstprpgsvrgkrnhslaaeddeeaevsgrvagtvrrhfpvdardppgailhfyvgdsydpsssmddddhilrklqpkgiWYLTVLGSLATTQREYVALHAFCRLNSQMQTailkpspehfpkyehqtptmpecftQNFIDHLhrtfngpqLAAIQWAAIHTaagtssgmtkspwpftlvqgppgtgkthtVWGMLNVIHLVQYQHYYNSLLKklapesykqpnesnsdnvsmgSIDEVLQNMDQNLLrtlpklcpkprmlvcapsnaatDELLTRVLDrgfidgemkvyrpdvarvgvdsQTRAAQAVSVERRTEQLLVKSREEVIGWMHNLKGREAVLSQQIANLQRELNAAAFAVRsqgsvgvdpdvlmarDQNRDTLLQNLAAAVENRDKVLVEMSRFHilegrfrpgsnfnlEEARASLEASFANEAEIVFTTVSSSGRKLFSRLTHGFDMVVIDEaaqasevgvlpplslgaarcvlgggssaapcnsyqqgsrhldvq
mgsrgkllfdlneppaedDEENDRIFSSQPQKALPSANPHTSELFVASAAPQGIINNNAFSHAPSVSGFQPFNRAKAAQGHGvevepkkaedqnrrvasssskpgngedikaasssvpgsenaaadereegewSDAEGSVDAYASNLLNEqgkasqgqgvSEVVDTATGVDIKvpessqdgsnshgvlgsdqdpsdqkrnrsrhseanikgeksvdgqeepcLLPKqreikgteashttkgannlgkrkidQQKEAmlgkkrnrqtvflnledvkqagslktstprrqnppvvtrtvkeartipspaerggekqsqainkdqkqydVSSCNEGGTSVEALEPKPECNGDMNFGLPGSTDPKLGTKKhppakkqtatanlyqdtsVERLIREVTnekfwhhpvvhvppirtLLRIVTLKGHGKiydaseeselqcvPGRFESVEEYVRVFEPLLFEECRAQLYSTWEeltetgsrdthvmvrirnierrergwydvIVLPVNECKWSFKEGdvavlstprpgsvrgkrnhslaaeddeeaevsgrvagtvrrhfpvdardppGAILHFYVGDSYDPSSSMDDDDHILRKLQPKGIWYLTVLGSLATTQREYVALHAFCRLNSQMQTAILKPSPEHFPKYEHQTPTMPECFTQNFIDHLHRTFNGPQLAAIQWAAIHTAAGTSSGMTKSPWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQHYYNSLLKKLAPESYKQPNESNSDNVSMGSIDEVLQNMDQNLLRTLPKLCPKPRMLVCAPSNAATDELLTRVLDRGFIDGEMKvyrpdvarvgvdsqtraaqavsverrteqllvKSREEVIGWMHNLKGREAVLSQQIANLQRELNAAAFAVRSQGSVGVDPDVLMARDQNRDTLLQNLAAAVENRDKVLVEMSRFHilegrfrpgsnFNLEEARASLEASFANEAEIVFTTVSSSGRKLFSRLTHGFDMVVIDEAAQASEVGVLPPLSLGAARCVLGGGSSaapcnsyqqgsrhldvq
MGSRGKLLFdlneppaeddeendRIFSSQPQKALPSANPHTSELFVASAAPQGIINNNAFSHAPSVSGFQPFNRAKAAQGHGVEVEPKKAEDQNRRVASSSSKPGNGEDIKAASSSVPGSENAAADEREEGEWSDAEGSVDAYASNLLNEQGKASQGQGVSEVVDTATGVDIKVPESSQDGSNSHGVLGSDQDPSDQKRNRSRHSEANIKGEKSVDGQEEPCLLPKQREIKGTEASHTTKGANNLGKRKIDQQKEAMLGKKRNRQTVFLNLEDVKQAGSLKTSTPRRQNPPVVTRTVKEARTIPSPAERGGEKQSQAINKDQKQYDVSSCNEGGTSVEALEPKPECNGDMNFGLPGSTDPKLGTKKHPPAKKQTATANLYQDTSVERLIREVTNEKFWHHPVVHVPPIRTLLRIVTLKGHGKIYDASEESELQCVPGRFESVEEYVRVFEPLLFEECRAQLYSTWEELTETGSRDTHVMVRIRNIERRERGWYDVIVLPVNECKWSFKEGDVAVLSTPRPGSVRGKRNHSLAAEDDEEAEVSGRVAGTVRRHFPVDARDPPGAILHFYVGdsydpsssmddddHILRKLQPKGIWYLTVLGSLATTQREYVALHAFCRLNSQMQTAILKPSPEHFPKYEHQTPTMPECFTQNFIDHLHRTFNGPQLaaiqwaaihtaaGTSSGMTKSPWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQHYYNSLLKKLAPESYKQPNESNSDNVSMGSIDEVLQNMDQNLLRTLPKLCPKPRMLVCAPSNAATDELLTRVLDRGFIDGEMKVYRPDVARVGVDSQTRAAQAVSVERRTEQLLVKSREEVIGWMHNLKGREAVLSQQIANLQRELNAAAFAVRSQGSVGVDPDVLMARDQNRDTLLQNLAAAVENRDKVLVEMSRFHILEGRFRPGSNFNLEEARASLEASFANEAEIVFTTVSSSGRKLFSRLTHGFDMVVIDEAAQASEVGVLPPLSLGAARCVLGGGSSAAPCNSYQQGSRHLDVQ
******************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************LYQDTSVERLIREVTNEKFWHHPVVHVPPIRTLLRIVTLKGHGKIYDASEESELQCVPGRFESVEEYVRVFEPLLFEECRAQLYSTWEELTETGSRDTHVMVRIRNIERRERGWYDVIVLPVNECKWSFKEGDVAVL***********************************RHFPVDARDPPGAILHFYVGDS***********HILRKLQPKGIWYLTVLGSLATTQREYVALHAFCRLNSQMQTAIL***************TMPECFTQNFIDHLHRTFNGPQLAAIQWAAIHTAAGTSSGMTKSPWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQHYYNSLLKKL****************************DQNLLRTLPKLCPKPRMLVCAPSNAATDELLTRVLDRGFIDGEMKVYRPDVARVGVDS******AVSV**RTEQLLVKSREEVIGWMHNLKGREAVLSQQIANLQRELNAAAFAVRSQGSVGVDPDVLMARDQNRDTLLQNLAAAVENRDKVLVEMSRFHILEGRFRPGSNFNLEEARASLEASFANEAEIVFTTVSSSGRKLFSRLTHGFDMVVIDEAAQASEVGVLPPLSLGAARCVLGG********************
****GKL**DLNEPP*****************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************VPPIRTLLRIVTLKGHGK**************GRFESVEEYVRVFEPLLFEECRAQLYSTWEELTETGSRDTHVMVRIRNIERRERGWYDVIVLPVNECKWSFKEGDVAVLSTPRPGSV*GKRNHSLAAEDDEEAEVSGRVAGTVRRHFPVDARDPPGAILHFYVGDSYDPSSSMDDDDHILRKLQPKGIWYLTVLGSLATTQREYVALHAFCRLNSQMQTAILKPSPEHFPKYEHQTPTMPECFTQNFIDHLHRTFNGPQLAAIQWAAIHTAAGTSSGMTKSPWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQHYYNSL*******************VSMGSIDEVLQNMDQNLLRTLPKLCPKPRMLVCAPSNAATDELLTRVLDRGFIDGEMKVYRPDVARVGVDSQTRAAQAVSVERRTEQLLVKSRE**IGWMHNLKGREAVLSQQIANLQRELNAAAFAVRSQGSVGVDPDVLMARDQN*************************************FNLEEARASLEASFANEAEIVFTTVSSSGRKLFSRLTHGFDMVVIDEAAQASEVGVLPPLSLGAARCVLGGGSSAAPCNSYQQGSRHLD**
MGSRGKLLFDLNE**************************HTSELFVASAAPQGIINNNAFSHAPSVSGFQPFNRA*************************************************************EGSVDAYASNLLNE***********EVVDTATGVDIKVPE******************************************EEPCLLPKQREIKGTEASHTTKGANNLGKRKIDQQKEAMLGKKRNRQTVFLNLEDVKQAGSLKTSTPRRQNPPVVTRTVKEARTIPS******************************SVEALEPKPECNGDMNFGLPGSTDPK**************TANLYQDTSVERLIREVTNEKFWHHPVVHVPPIRTLLRIVTLKGHGKIYDASEESELQCVPGRFESVEEYVRVFEPLLFEECRAQLYSTWEELTETGSRDTHVMVRIRNIERRERGWYDVIVLPVNECKWSFKEGDVAVLST***************************VAGTVRRHFPVDARDPPGAILHFYVGDSYDPSSSMDDDDHILRKLQPKGIWYLTVLGSLATTQREYVALHAFCRLNSQMQTAILKPSPEHFPKYEHQTPTMPECFTQNFIDHLHRTFNGPQLAAIQWAAIHTAAGTSSGMTKSPWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQHYYNSLLKKLAPE***********NVSMGSIDEVLQNMDQNLLRTLPKLCPKPRMLVCAPSNAATDELLTRVLDRGFIDGEMKVYRPDVARVGVDSQTRAAQAVSVERRTEQLLVKSREEVIGWMHNLKGREAVLSQQIANLQRELNAAAFAVRSQGSVGVDPDVLMARDQNRDTLLQNLAAAVENRDKVLVEMSRFHILEGRFRPGSNFNLEEARASLEASFANEAEIVFTTVSSSGRKLFSRLTHGFDMVVIDEAAQASEVGVLPPLSLGAARCVLGGGSSAAP**************
*****KLLFDLNEPPAEDDEENDRIFSSQPQKAL*********************************G************************************************************************************************************************************************************************************************************************************************************************************************************************QDTSVERLIREVTNEKFWHHPVVHVPPIRTLLRIVTLKGHGKI***SEESELQCVPGRFESVEEYVRVFEPLLFEECRAQLYSTWEELTETGSRDTHVMVRIRNIERRERGWYDVIVLPVNECKWSFKEGDVAVLSTPR******************EAEVSGRVAGTVRRHFPVDARDPPGAILHFYVGDSYDPSSSMDDDDHILRKLQPKGIWYLTVLGSLATTQREYVALHAFCRLNSQMQTAILKPSPEHFPKYEHQTPTMPECFTQNFIDHLHRTFNGPQLAAIQWAAIHTAAGTSSGMTKSPWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQHYYNSL********************************DQNLLRTLPKLCPKPRMLVCAPSNAATDELLTRVLDRGFIDGEMKVYRPDVARVGVDSQTRAAQAVSVERRTEQLLVKSREEVIGWMHNLKGREAVLSQQIANLQRELNAAAFAVRSQ*SVGVDPDVLMARDQNRDTLLQNLAAAVENRDKVLVEMSRFHILEGRFRPGSNFNLEEARASLEASFANEAEIVFTTVSSSGRKLFSRLTHGFDMVVIDEAAQASEVGVLPPLSLGAARCVLGGGSSAAPCNSYQQGSRHLDV*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSRGKLLFDLNEPPAEDDEENDRIFSSQPQKALPSANPHTSELFVASAAPQGIINNNAFSHAPSVSGFQPFNRAKAAQGHGVEVEPKKAEDQNRRVASSSSKPGNGEDIKAASSSVPGSENAAADEREEGEWSDAEGSVDAYASNLLNEQGKASQGQGVSEVVDTATGVDIKVPESSQDGSNSHGVLGSDQDPSDQKRNRSRHSEANIKGEKSVDGQEEPCLLPKQREIKGTEASHTTKGANNLGKRKIDQQKEAMLGKKRNRQTVFLNLEDVKQAGSLKTSTPRRQNPPVVTRTVKEARTIPSPAERGGEKQSQAINKDQKQYDVSSCNEGGTSVEALEPKPECNGDMNFGLPGSTDPKLGTKKHPPAKKQTATANLYQDTSVERLIREVTNEKFWHHPVVHVPPIRTLLRIVTLKGHGKIYDASEESELQCVPGRFESVEEYVRVFEPLLFEECRAQLYSTWEELTETGSRDTHVMVRIRNIERRERGWYDVIVLPVNECKWSFKEGDVAVLSTPRPGSVRGKRNHSLAAEDDEEAEVSGRVAGTVRRHFPVDARDPPGAILHFYVGDSYDPSSSMDDDDHILRKLQPKGIWYLTVLGSLATTQREYVALHAFCRLNSQMQTAILKPSPEHFPKYEHQTPTMPECFTQNFIDHLHRTFNGPQLAAIQWAAIHTAAGTSSGMTKSPWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQHYYNSLLKKLAPESYKQPNESNSDNVSMGSIDEVLQNMDQNLLRTLPKLCPKPRMLVCAPSNAATDELLTRVLDRGFIDGEMKVYRPDVARVGVDSQTRAAQAVSVERRTEQLLVKSREEVIGWxxxxxxxxxxxxxxxxxxxxxLNAAAFAVRSQGSVGVDPDVLMARDQNRDTLLQNLAAAVENRDKVLVEMSRFHILEGRFRPGSNFNLEEARASLEASFANEAEIVFTTVSSSGRKLFSRLTHGFDMVVIDEAAQASEVGVLPPLSLGAARCVLGGGSSAAPCNSYQQGSRHLDVQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1019 2.2.26 [Sep-21-2011]
Q92355 1687 Helicase sen1 OS=Schizosa yes no 0.330 0.199 0.269 8e-22
O94387 1944 Uncharacterized ATP-depen no no 0.447 0.234 0.241 2e-21
Q00416 2231 Helicase SEN1 OS=Saccharo yes no 0.259 0.118 0.258 9e-18
Q86AS0 967 Probable helicase DDB_G02 no no 0.210 0.222 0.260 2e-13
A2AKX3 2646 Probable helicase senatax yes no 0.435 0.167 0.227 8e-13
Q7Z333 2677 Probable helicase senatax yes no 0.316 0.120 0.239 1e-12
B6SFA4 818 Probable helicase MAGATAM no no 0.137 0.171 0.293 6e-08
P30771 971 ATP-dependent helicase NA no no 0.165 0.174 0.244 0.0004
>sp|Q92355|SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen1 PE=1 SV=1 Back     alignment and function desciption
 Score =  106 bits (265), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 116/430 (26%), Positives = 193/430 (44%), Gaps = 93/430 (21%)

Query: 585  ILRKLQPK-GIWYLTVLGSLATTQREYVALHAFCRLNSQMQTAILKPSPEHFPKYEHQTP 643
            IL KLQ    +W+L  L +LAT  R+Y  +      +  +   I++  P   P  +H + 
Sbjct: 1064 ILNKLQGNCALWFLK-LTNLATFTRQYAGIRGLPYFH--LADDIIRARPCSQP-VKHSSS 1119

Query: 644  TMPECFTQNFIDHLHRTFNGPQLAAIQWAAIHTAAGTSSGMTKSPWPFTLVQGPPGTGKT 703
             +     +  +       N PQ  AI        A  ++G       FTL+QGPPGTGKT
Sbjct: 1120 EIKAAMKRYQV-------NEPQAKAIM------CALDNNG-------FTLIQGPPGTGKT 1159

Query: 704  HTVWGMLNVIHLVQYQHYYNSLLKKLAPESYKQPNESNSDNVSMGSIDEVLQNMDQNLLR 763
             T+ G+++            +LL  L+     +PN+ +    S                 
Sbjct: 1160 KTIIGIIS------------ALLVDLSRYHITRPNQQSKSTES----------------- 1190

Query: 764  TLPKLCPKPRMLVCAPSNAATDELLTRVLDRGFIDGEMKVYRPDVARVGV-DSQTRAAQA 822
                   K ++L+CAPSNAA DE+L R L RGF+    + Y P V R+G  ++   + + 
Sbjct: 1191 -------KQQILLCAPSNAAVDEVLLR-LKRGFLLENGEKYIPRVVRIGNPETINVSVRD 1242

Query: 823  VSVERRTEQLLVKSREEVI--GWMHNL-KGREAVLS--QQIANLQRELNAAAFAVRSQGS 877
            +S+E +TE+ L++  +  I  G +  L + R+      Q+I  L+++++           
Sbjct: 1243 LSLEYQTEKQLLEVNQGAIDLGSLQELTRWRDTFYDCIQKIEELEKQID----------- 1291

Query: 878  VGVDPDVLMARDQNRDTLLQNLAAAVENR--DKVLVEMSRFHILEGRFRPGSNFNLEEAR 935
                    +ARD   DT  ++L   ++N+  +K L E     +    F      +L   +
Sbjct: 1292 --------VARDVAEDT--KSLGKELQNKINEKNLAEQKVEELQSQSFTKNKEVDLLRKK 1341

Query: 936  ASLEASFANEAEIVFTTVSSSGRKLFSRLTHGFDMVVIDEAAQASEVGVLPPLSLGAARC 995
            A  + +   +A++V  T+S SG  L +  +  F  V+IDEAAQA E+  + PL  GA +C
Sbjct: 1342 A--QKAILKQADVVCATLSGSGHDLVAHSSLNFSTVIIDEAAQAVELDTIIPLRYGAKKC 1399

Query: 996  VLGGGSSAAP 1005
            +L G  +  P
Sbjct: 1400 ILVGDPNQLP 1409
ATP-dependent 5'->3' DNA/RNA helicase required for the expression and maturation of diverse classes of non-protein-coding RNAs like precursor tRNAs, rRNAs and small nuclear (snRNA) and nucleolar (snoRNA) RNAs. Directs RNA polymerase II transcription termination on snoRNAs as well as on several short protein-coding genes. May also play a role in transcription-coupled nucleotide excision repair.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: -
>sp|O94387|YGSA_SCHPO Uncharacterized ATP-dependent helicase C29A10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.10c PE=3 SV=1 Back     alignment and function description
>sp|Q00416|SEN1_YEAST Helicase SEN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN1 PE=1 SV=2 Back     alignment and function description
>sp|Q86AS0|Y4399_DICDI Probable helicase DDB_G0274399 OS=Dictyostelium discoideum GN=DDB_G0274399 PE=3 SV=1 Back     alignment and function description
>sp|A2AKX3|SETX_MOUSE Probable helicase senataxin OS=Mus musculus GN=Setx PE=2 SV=1 Back     alignment and function description
>sp|Q7Z333|SETX_HUMAN Probable helicase senataxin OS=Homo sapiens GN=SETX PE=1 SV=4 Back     alignment and function description
>sp|B6SFA4|MAA3_ARATH Probable helicase MAGATAMA 3 OS=Arabidopsis thaliana GN=MAA3 PE=2 SV=1 Back     alignment and function description
>sp|P30771|NAM7_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM7 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1019
147779903 1408 hypothetical protein VITISV_009619 [Viti 0.974 0.705 0.694 0.0
225459354 1375 PREDICTED: uncharacterized ATP-dependent 0.946 0.701 0.686 0.0
255545656 1352 splicing endonuclease positive effector 0.932 0.702 0.672 0.0
356522392 1388 PREDICTED: probable helicase senataxin-l 0.936 0.687 0.661 0.0
449465617 1363 PREDICTED: uncharacterized ATP-dependent 0.941 0.703 0.661 0.0
449529064 1363 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.941 0.703 0.660 0.0
356558781 1328 PREDICTED: uncharacterized ATP-dependent 0.911 0.699 0.658 0.0
357513937 1516 Helicase sen1 [Medicago truncatula] gi|3 0.974 0.655 0.634 0.0
224082154 1147 predicted protein [Populus trichocarpa] 0.731 0.649 0.706 0.0
15234617 1311 tRNA-splicing endonuclease positive effe 0.902 0.701 0.591 0.0
>gi|147779903|emb|CAN65841.1| hypothetical protein VITISV_009619 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1453 bits (3761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 747/1076 (69%), Positives = 832/1076 (77%), Gaps = 83/1076 (7%)

Query: 1    MGSRGKLLFDLNEPPAEDDEENDRIFSSQPQKALPSANPHTSELFVASAAPQGIINNNAF 60
            MGSRG+ LFDLNEPPAED+EEND +FS QPQKALPS N HT +LF  S+ PQ I+NN+AF
Sbjct: 1    MGSRGRPLFDLNEPPAEDEEENDGVFSFQPQKALPSLNSHTPDLFSTSSGPQRILNNHAF 60

Query: 61   SHAPSVSGFQPFNRAKAAQGHGVEVEPKKAEDQNRRVASSSSKPGNGEDIKAASSSVPGS 120
            +HA SVSGFQPF R K A      VE K+A +QN + ASSS+  GNG++  A    V   
Sbjct: 61   THASSVSGFQPFVRPKGANVSEEPVEQKRAGNQNSKFASSSNA-GNGDETNAGLQLVSSP 119

Query: 121  ENAAADEREEGEWSDAEGSVDAYASNLLNEQGKASQG--QGVSEVVDT--------ATGV 170
             +A A EREEGEWSD E S + Y S+ + EQ  +  G  Q +SE +D             
Sbjct: 120  ADAQAVEREEGEWSDDESSANVYGSSSMQEQSVSGSGKAQAMSEQMDYHASSVAAETLSC 179

Query: 171  DIKVPESSQDGSNSHGVLGSDQDPSDQKRNRSRHSEANIKGEKS-VDGQEEPCLLPKQRE 229
            DIKV ES+++ +NSH  +  D D  DQ+ N SR+SE N KG+   +DGQEEP L+PK +E
Sbjct: 180  DIKVFESTKEENNSHASVTLDPDTHDQRSNSSRNSEGNGKGDVGPMDGQEEPGLVPKLKE 239

Query: 230  IKGTEASHTTKGANNLGKR-KIDQQKEAMLGKKRNRQTVFLNLEDVKQAGSLKTSTPRRQ 288
            +KG EAS   K ANN GK+ K+DQ KEAMLGKKR RQTVFLNLEDVKQAG +KTSTPRRQ
Sbjct: 240  VKGVEASFAVKCANNPGKKHKLDQHKEAMLGKKRTRQTVFLNLEDVKQAGPMKTSTPRRQ 299

Query: 289  N--PPVVTRTVKEARTIPSPAERGGEKQSQAINKDQKQYDVSSCNEGGTS--VEALEPKP 344
            N   P+ TR VKE R++P PAER GEKQ+ ++ KDQKQ D+SS NEGG    VE+ EPK 
Sbjct: 300  NFPAPITTRIVKEIRSVPPPAERIGEKQNHSMIKDQKQVDLSS-NEGGGGNLVESNEPKS 358

Query: 345  ECNGDMNFGLPG------------------------------------------------ 356
            E N DMN GL G                                                
Sbjct: 359  ESNNDMNSGLLGRPRRLNSANDISAEVHPPTIPRQSSWKPTDSRQFKNSQFSGRKPSMIN 418

Query: 357  STDPKLGTKKHPPAKKQTATANLYQDTSVERLIREVTNEKFWHHPVVHVPPIRTLLRIVT 416
             ++ KL  KKHPPAK QT  ++ YQDTSVERLIREVTNEKFWHHP +     R +L +  
Sbjct: 419  QSESKLVNKKHPPAKMQTTVSSQYQDTSVERLIREVTNEKFWHHPDIS----RFVLNVAV 474

Query: 417  LKGHGKIYDAS----EESELQCVPGRFESVEEYVRVFEPLLFEECRAQLYSTWEELTETG 472
            L      YD S     E+ELQCVPGRFESVEEY+RVFEPLLFEECRAQLYSTWEELTET 
Sbjct: 475  LS-----YDISMFLNHETELQCVPGRFESVEEYIRVFEPLLFEECRAQLYSTWEELTETV 529

Query: 473  SRDTHVMVRIRNIERRERGWYDVIVLPVNECKWSFKEGDVAVLSTPRPGSVRGKRNHSLA 532
            SRD H MVRI++IERRERGWYDVIVLP NECKW+FKEGDVA+LS PRPGSVR KRN++ +
Sbjct: 530  SRDLHAMVRIKSIERRERGWYDVIVLPANECKWTFKEGDVAILSAPRPGSVRSKRNNTSS 589

Query: 533  AEDDEEAEVSGRVAGTVRRHFPVDARDPPGAILHFYVGDSYDPSSSMDDDDHILRKLQPK 592
             EDDEEAE+SGRVAGTVRRH P+D RDP GAILHFYVGDSYDP+S +DD  HILRKL PK
Sbjct: 590  IEDDEEAEISGRVAGTVRRHNPIDTRDPVGAILHFYVGDSYDPNSKVDD--HILRKLHPK 647

Query: 593  GIWYLTVLGSLATTQREYVALHAFCRLNSQMQTAILKPSPEHFPKYEHQTPTMPECFTQN 652
            GIWYLTVLGSLATTQREY+ALHAF RLN QMQTAIL PSPEHFPKYE Q P MPECFT N
Sbjct: 648  GIWYLTVLGSLATTQREYIALHAFRRLNLQMQTAILHPSPEHFPKYEEQPPAMPECFTPN 707

Query: 653  FIDHLHRTFNGPQLAAIQWAAIHTAAGTSSGMTK--SPWPFTLVQGPPGTGKTHTVWGML 710
            F+++LH+TFNGPQLAAIQWAA+HTAAGTSSG+TK   PWPFTLVQGPPGTGKTHTVWGML
Sbjct: 708  FVEYLHKTFNGPQLAAIQWAAMHTAAGTSSGVTKRQDPWPFTLVQGPPGTGKTHTVWGML 767

Query: 711  NVIHLVQYQHYYNSLLKKLAPESYKQPNESNSDNVSMGSIDEVLQNMDQNLLRTLPKLCP 770
            NVIHLVQYQHYY +LLKK+APESYKQ NES SDNVSMGSIDEVLQ+MDQNL RTLPKLCP
Sbjct: 768  NVIHLVQYQHYYTALLKKVAPESYKQTNESTSDNVSMGSIDEVLQSMDQNLFRTLPKLCP 827

Query: 771  KPRMLVCAPSNAATDELLTRVLDRGFIDGEMKVYRPDVARVGVDSQTRAAQAVSVERRTE 830
            KPRMLVCAPSNAATDELL RVLDRGFIDGEMKVYRPDVARVGVDSQTRAAQAVSVERRTE
Sbjct: 828  KPRMLVCAPSNAATDELLARVLDRGFIDGEMKVYRPDVARVGVDSQTRAAQAVSVERRTE 887

Query: 831  QLLVKSREEVIGWMHNLKGREAVLSQQIANLQRELNAAAFAVRSQGSVGVDPDVLMARDQ 890
            QLLVK+R+E++GWMH LK R+A L QQ+  LQRELNAAA AVRSQGSVGVDPDVL+ARDQ
Sbjct: 888  QLLVKNRDEILGWMHQLKVRDAQLFQQMLCLQRELNAAAAAVRSQGSVGVDPDVLVARDQ 947

Query: 891  NRDTLLQNLAAAVENRDKVLVEMSRFHILEGRFRPGSNFNLEEARASLEASFANEAEIVF 950
            NRDTLLQNLAA VE+RDK+LVEM+R  ILE RFR GSNFNLEEARA+LEASFANEAEIVF
Sbjct: 948  NRDTLLQNLAAVVESRDKILVEMNRLVILESRFRSGSNFNLEEARANLEASFANEAEIVF 1007

Query: 951  TTVSSSGRKLFSRLTHGFDMVVIDEAAQASEVGVLPPLSLGAARCVLGGGSSAAPC 1006
            TTVSSSGRKLFSRLTHGFDMVVIDEAAQASEV VLPPLSLGAARCVL G     P 
Sbjct: 1008 TTVSSSGRKLFSRLTHGFDMVVIDEAAQASEVAVLPPLSLGAARCVLVGDPQQLPA 1063

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225459354|ref|XP_002284214.1| PREDICTED: uncharacterized ATP-dependent helicase C29A10.10c-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255545656|ref|XP_002513888.1| splicing endonuclease positive effector sen1, putative [Ricinus communis] gi|223546974|gb|EEF48471.1| splicing endonuclease positive effector sen1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356522392|ref|XP_003529830.1| PREDICTED: probable helicase senataxin-like [Glycine max] Back     alignment and taxonomy information
>gi|449465617|ref|XP_004150524.1| PREDICTED: uncharacterized ATP-dependent helicase C29A10.10c-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449529064|ref|XP_004171521.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized ATP-dependent helicase C29A10.10c-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356558781|ref|XP_003547681.1| PREDICTED: uncharacterized ATP-dependent helicase C29A10.10c-like [Glycine max] Back     alignment and taxonomy information
>gi|357513937|ref|XP_003627257.1| Helicase sen1 [Medicago truncatula] gi|355521279|gb|AET01733.1| Helicase sen1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|224082154|ref|XP_002306584.1| predicted protein [Populus trichocarpa] gi|222856033|gb|EEE93580.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15234617|ref|NP_194739.1| tRNA-splicing endonuclease positive effector-related protein [Arabidopsis thaliana] gi|4938486|emb|CAB43845.1| putative protein [Arabidopsis thaliana] gi|7269910|emb|CAB81003.1| putative protein [Arabidopsis thaliana] gi|332660321|gb|AEE85721.1| tRNA-splicing endonuclease positive effector-related protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1019
TAIR|locus:2126480 1311 AT4G30100 [Arabidopsis thalian 0.899 0.699 0.569 1e-258
TAIR|locus:2059088 1090 AT2G19120 "AT2G19120" [Arabido 0.757 0.708 0.644 5.8e-256
DICTYBASE|DDB_G0274399 967 DDB_G0274399 "DNA2/NAM7 helica 0.077 0.081 0.4 1.2e-27
DICTYBASE|DDB_G0285243 2069 DDB_G0285243 "putative splicin 0.219 0.108 0.266 3.4e-20
TAIR|locus:2130384 818 MAA3 "MAGATAMA 3" [Arabidopsis 0.067 0.084 0.420 1.5e-17
POMBASE|SPBC29A10.10c 1944 SPBC29A10.10c "tRNA-splicing e 0.127 0.066 0.291 1.8e-14
POMBASE|SPAC6G9.10c 1687 sen1 "ATP-dependent 5' to 3' D 0.211 0.128 0.298 1.8e-14
UNIPROTKB|G4NIZ8 2037 MGG_02784 "DNA-binding protein 0.212 0.106 0.296 2.7e-12
SGD|S000004422 2231 SEN1 "Presumed helicase and su 0.216 0.099 0.273 1.9e-10
UNIPROTKB|F1S0U6 2661 SETX "Uncharacterized protein" 0.097 0.037 0.330 3e-09
TAIR|locus:2126480 AT4G30100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2490 (881.6 bits), Expect = 1.0e-258, P = 1.0e-258
 Identities = 564/991 (56%), Positives = 667/991 (67%)

Query:    53 GIINNNAFSHAPSVSGFQPFNRAKAAQGHGVEVEPKKAEDQ--NRRVASSSSKPGNGEDI 110
             GI N N F+  P V+     N + +A    +   P  ++D   N RV S +S     +  
Sbjct:    21 GIDNVN-FNQQPQVT-IPSSNPSSSA----LLATPSSSQDNVNNNRVFSHASTVSGFQPF 74

Query:   111 KAASSSVPGSENAAADEREEGEWSDAEGSVDAYASNLLNEQGKASQGQGVSEVVDTATGV 170
                   V       A ER+  E S  E  V +    + N+ G   + +G  E  ++    
Sbjct:    75 VRP---VAAQHTDVAVERKVDEGSLEEAKVTSL--KVPNDVGAPEREEG--EWTESEVPA 127

Query:   171 DIKVPESSQDGS---NSHGVLGSD--QDPSDQKRNRSRHSEANIKGEKSVDGQEEPCLLP 225
             +  V  SS   +     +G LG D   D + QK+N +  SE++ K   S+D  +E  L  
Sbjct:   128 NDNVHSSSDYSTVTEKDNGTLGLDINSDSALQKKNVNHISESSGKDSGSIDSPQEQGLTV 187

Query:   226 KQREIKGTEASHTTKGANNLGKRKIDQQKEAMLGKKRNRQTVFLNLEDVKQAGSLKTSTP 285
             + RE KG EASH  K AN   KRK+D QKE MLGKKR+RQT+FLNL+DV+QAG +KT+TP
Sbjct:   188 RPRETKGVEASHAIKCANTTVKRKMDHQKETMLGKKRHRQTMFLNLDDVRQAGPIKTTTP 247

Query:   286 RRQN-P-PVVTRTVKEARTIPSPAERGGEKQSQAINKDQKQYDVSSCNEGGTSVEALEPK 343
             RRQN P PVVTRTV+E+R  P  AE+ G      + +DQK  D+ +   GG   E  EPK
Sbjct:   248 RRQNFPQPVVTRTVRESRAGPPTAEQAGGVPGHVVYRDQKPIDIPN---GGIHPETSEPK 304

Query:   344 PECNGDMNFGLPGST-------DP----------KLGTKKHPPAKKQTATAN-------L 379
              E NG+   G  G T        P          + G+ K P   +Q  + +       L
Sbjct:   305 LESNGESQSGSAGKTRRMNGEAGPSAEATSTSVSRQGSWKQPINSRQLKSGHSSNRQVPL 364

Query:   380 YQDTSVERLIREVTNEKF--WHHPVVHVPPIR--TLLRIVTLKGHGKIYDASEESELQCV 435
                TS +    +  N+KF  +     +    +  ++ R++    + K +   E+++LQ V
Sbjct:   365 CSQTSADS---KFGNKKFTSFKKQATNSTQYQDTSVERLLREVTNEKFWHHPEDTDLQSV 421

Query:   436 PGRFESVEEYVRVFEPLLFEECRAQLYSTWEELTETGSRDTHVMVRIRNIERRERGWYDV 495
             P RFES++EYVRVFEPLLFEECRAQLYSTWEEL E  S   ++ VRI+ IERRERGWYDV
Sbjct:   422 PERFESMDEYVRVFEPLLFEECRAQLYSTWEELAEANS---YMKVRIKFIERRERGWYDV 478

Query:   496 IVLPVNECKWSFKEGDVAVLSTPRPGSVRGKRNHSLAAEDDEEAEVSGRVAGTVRRHFPV 555
             I+  VNECKW+FKEGDVAVLS P P S  G+  H     DD      GRVAGTVRR+ PV
Sbjct:   479 ILNSVNECKWAFKEGDVAVLSNPVPES-EGE--H-----DDV-----GRVAGTVRRYIPV 525

Query:   556 DARDPPGAILHFYVGXXXXXXXXXXXXXHILRKLQPKGIWYLTVLGSLATTQREYVALHA 615
             D RDP GAILHFYVG             HILRKL+PK IW+LTVLGS+ATTQREYVALHA
Sbjct:   526 DTRDPHGAILHFYVGDAYDSGSKIDDN-HILRKLKPKEIWHLTVLGSIATTQREYVALHA 584

Query:   616 FCRLNSQMQTAILKPSPEHFPKYEHQTPTMPECFTQNFIDHLHRTFNGPQLXXXXXXXXX 675
             F +LN QMQ AILKPSPE FP Y  QTPT+P+CFT +F  HLHR+FN PQL         
Sbjct:   585 FSQLNPQMQNAILKPSPEQFPNYGEQTPTVPDCFTPSFAGHLHRSFNAPQLAAIHWAAMH 644

Query:   676 XXXGTSSGMTKS-PWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQHYYNSLLKKLAPESY 734
                GTSSG+ +  PWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQ YY SLLKKLAPESY
Sbjct:   645 TAAGTSSGVKRQDPWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQQYYTSLLKKLAPESY 704

Query:   735 KQPNESNSDNVSMGSIDEVLQNMDQNLLRTLPKLCPKPRMLVCAPSNAATDELLTRVLDR 794
             KQ NES+SDN+  GSIDEVLQNMDQNL RTLPKLC KPRMLVCAPSNAATDELL+RVLDR
Sbjct:   705 KQVNESSSDNIVSGSIDEVLQNMDQNLFRTLPKLCAKPRMLVCAPSNAATDELLSRVLDR 764

Query:   795 GFIDGEMKVYRPDVARVGVDSQTRAAQAVSVERRTEQLLVKSREEVIGWMHNLKGREAVL 854
             GFIDGEM+VYRPDVARVGVD+QT+AAQAVSVERR++ LL KSREE++G +HNL+ R+A L
Sbjct:   765 GFIDGEMRVYRPDVARVGVDTQTKAAQAVSVERRSDLLLAKSREEILGHIHNLRVRDAQL 824

Query:   855 SQQIANLQRELNAAAFAVRSQGSVGVDPDVLMARDQNRDTLLQNLAAAVENRDKVLVEMS 914
             SQ IA L+REL AAAFA RSQGSVGVDPDVLM RDQ RD +LQ L+A VE RDK LVEMS
Sbjct:   825 SQDIAGLKRELTAAAFANRSQGSVGVDPDVLMVRDQTRDAMLQRLSAVVEARDKDLVEMS 884

Query:   915 RFHILEGRFRPGSNFNLEEARASLEASFANEAEIVFTTVSSSGRKLFSRLTHGFDMVVID 974
             R  I+EG+FR G++FNLEEARASLEASFANEAEIVFTTVSSSGRKLFSRLTHGFDMVVID
Sbjct:   885 RLLIVEGKFRAGTSFNLEEARASLEASFANEAEIVFTTVSSSGRKLFSRLTHGFDMVVID 944

Query:   975 EAAQASEVGVLPPLSLGAARCVLGGGSSAAP 1005
             EAAQASEVGVLPPL+LGAARCVL G     P
Sbjct:   945 EAAQASEVGVLPPLALGAARCVLVGDPQQLP 975
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0009506 "plasmodesma" evidence=IDA
TAIR|locus:2059088 AT2G19120 "AT2G19120" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0274399 DDB_G0274399 "DNA2/NAM7 helicase family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0285243 DDB_G0285243 "putative splicing endonuclease" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2130384 MAA3 "MAGATAMA 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPBC29A10.10c SPBC29A10.10c "tRNA-splicing endonuclease positive effector (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
POMBASE|SPAC6G9.10c sen1 "ATP-dependent 5' to 3' DNA/RNA helicase Sen1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|G4NIZ8 MGG_02784 "DNA-binding protein SMUBP-2" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
SGD|S000004422 SEN1 "Presumed helicase and subunit of the Nrd1 complex (Nrd1p-Nab3p-Sen1p)" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|F1S0U6 SETX "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1019
pfam13086220 pfam13086, AAA_11, AAA domain 1e-30
TIGR00376 637 TIGR00376, TIGR00376, DNA helicase, putative 8e-08
COG1112 767 COG1112, COG1112, Superfamily I DNA and RNA helica 8e-05
>gnl|CDD|221912 pfam13086, AAA_11, AAA domain Back     alignment and domain information 
 Score =  120 bits (302), Expect = 1e-30
 Identities = 74/340 (21%), Positives = 112/340 (32%), Gaps = 134/340 (39%)

Query: 661 FNGPQLAAIQWAAIHTAAGTSSGMTKSPWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQH 720
            N  Q  AI+             ++ S    TL+QGPPGTGKT T+  ++  +       
Sbjct: 2   LNDSQREAIK-----------KALSSSD--ITLIQGPPGTGKTTTIVEIIKQLLSNA--- 45

Query: 721 YYNSLLKKLAPESYKQPNESNSDNVSMGSIDEVLQNMDQNLLRTLPKLCPKPRMLVCAPS 780
                                                            P  ++LVCAPS
Sbjct: 46  -------------------------------------------------PGKKVLVCAPS 56

Query: 781 NAATDELLTRVLDRGFIDGEMKVYRPDVARVGVDSQTRAAQAVSVERRTEQLLVKSREEV 840
           N+A D +L R+L++         +   + R+G                       S    
Sbjct: 57  NSAVDNILERLLEQ--------KFGLKIVRIG-----------------------SPARE 85

Query: 841 IGWMHNLKGREAVLSQQIAN-LQRELNAAAFAVRSQGSVGVDPDVLMARDQNRDTLLQNL 899
           I         E VL   +   L+ +       +R   S+  +   L    +   + ++ L
Sbjct: 86  I--------HEDVLQYSLEYLLEAKFEQLLKRIRKLKSLLEEKSKLKRERRKLRSEIKKL 137

Query: 900 AAAVENRDKVLVEMSRFHILEGRFRPGSNFNLEEARASLEASFANEAEIVFTTVSSSGRK 959
                                          LE  R S+     +EA++V TT+S +G  
Sbjct: 138 ----------------------------KKELERLRKSIRKEILDEADVVCTTLSGAGSS 169

Query: 960 LFSRLTHGFDMVVIDEAAQASEVGVLPPLSLGAARCVLGG 999
           L   L   FD+V+IDEAAQA+E   L PL LG  + VL G
Sbjct: 170 LLEGLKK-FDVVIIDEAAQATEPETLIPLLLGCKKVVLVG 208

This family of domains contain a P-loop motif that is characteristic of the AAA superfamily. Many of the proteins in this family are conjugative transfer proteins. Length = 220
>gnl|CDD|232945 TIGR00376, TIGR00376, DNA helicase, putative Back     alignment and domain information
>gnl|CDD|224037 COG1112, COG1112, Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1019
KOG1802 935 consensus RNA helicase nonsense mRNA reducing fact 100.0
TIGR00376 637 DNA helicase, putative. The gene product may repre 100.0
KOG1803 649 consensus DNA helicase [Replication, recombination 100.0
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 100.0
KOG1805 1100 consensus DNA replication helicase [Replication, r 99.95
KOG1801 827 consensus tRNA-splicing endonuclease positive effe 99.9
KOG1807 1025 consensus Helicases [Replication, recombination an 99.88
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 99.63
COG1112 767 Superfamily I DNA and RNA helicases and helicase s 99.61
PRK10875 615 recD exonuclease V subunit alpha; Provisional 99.43
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 99.42
KOG1806 1320 consensus DEAD box containing helicases [Replicati 99.42
KOG1804 775 consensus RNA helicase [RNA processing and modific 99.32
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 99.31
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 99.2
PRK13889 988 conjugal transfer relaxase TraA; Provisional 99.14
PRK13826 1102 Dtr system oriT relaxase; Provisional 99.09
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 99.06
PF1324576 AAA_19: Part of AAA domain 99.05
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 99.02
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 98.93
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 98.86
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 98.83
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 98.77
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 98.51
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 98.44
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 98.43
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 98.42
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 98.39
PRK11054 684 helD DNA helicase IV; Provisional 98.39
PRK10536262 hypothetical protein; Provisional 98.21
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 98.2
PF01443 234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 97.91
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.65
smart00487201 DEXDc DEAD-like helicases superfamily. 97.56
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 97.42
PF04851184 ResIII: Type III restriction enzyme, res subunit; 97.38
PHA02558501 uvsW UvsW helicase; Provisional 97.33
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 97.29
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 97.2
TIGR00643630 recG ATP-dependent DNA helicase RecG. 97.2
PTZ00424401 helicase 45; Provisional 97.19
PRK05580 679 primosome assembly protein PriA; Validated 97.06
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 97.05
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 96.89
COG0507696 RecD ATP-dependent exoDNAse (exonuclease V), alpha 96.79
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 96.78
PRK09401 1176 reverse gyrase; Reviewed 96.76
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 96.75
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 96.72
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 96.68
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 96.63
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 96.61
PRK02362 737 ski2-like helicase; Provisional 96.56
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.48
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 96.48
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 96.45
PRK10689 1147 transcription-repair coupling factor; Provisional 96.44
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 96.39
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 96.31
PRK14701 1638 reverse gyrase; Provisional 96.24
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 96.2
smart00382148 AAA ATPases associated with a variety of cellular 96.17
PF00004132 AAA: ATPase family associated with various cellula 96.14
TIGR02928365 orc1/cdc6 family replication initiation protein. M 96.04
PRK06851367 hypothetical protein; Provisional 96.04
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 96.04
TIGR00595 505 priA primosomal protein N'. All proteins in this f 96.04
cd01124187 KaiC KaiC is a circadian clock protein primarily f 96.0
PRK13766 773 Hef nuclease; Provisional 95.95
COG0210 655 UvrD Superfamily I DNA and RNA helicases [DNA repl 95.92
PTZ00110545 helicase; Provisional 95.8
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 95.65
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 95.6
PF00176 299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 95.58
PLN03025319 replication factor C subunit; Provisional 95.57
PRK08181269 transposase; Validated 95.55
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 95.5
PRK06893229 DNA replication initiation factor; Validated 95.43
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 95.38
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 95.36
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 95.31
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 95.29
PRK08084235 DNA replication initiation factor; Provisional 95.27
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 95.26
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 95.1
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 95.06
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 94.99
PRK00411394 cdc6 cell division control protein 6; Reviewed 94.95
TIGR00609 1087 recB exodeoxyribonuclease V, beta subunit. All pro 94.92
PRK12377248 putative replication protein; Provisional 94.92
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 94.92
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 94.92
PRK06526254 transposase; Provisional 94.66
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 94.64
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 94.61
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 94.6
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 94.59
PTZ001121164 origin recognition complex 1 protein; Provisional 94.58
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 94.51
PRK07952244 DNA replication protein DnaC; Validated 94.49
PRK12402337 replication factor C small subunit 2; Reviewed 94.4
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 94.36
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 94.27
COG2256436 MGS1 ATPase related to the helicase subunit of the 94.25
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 94.23
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 94.21
PRK13531 498 regulatory ATPase RavA; Provisional 94.14
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 94.12
PRK09183259 transposase/IS protein; Provisional 94.12
PRK08903227 DnaA regulatory inactivator Hda; Validated 93.96
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 93.96
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 93.94
PHA00729226 NTP-binding motif containing protein 93.9
TIGR02533486 type_II_gspE general secretory pathway protein E. 93.87
CHL00181287 cbbX CbbX; Provisional 93.84
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 93.84
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 93.75
PRK10876 1181 recB exonuclease V subunit beta; Provisional 93.73
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 93.72
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 93.72
PF07726131 AAA_3: ATPase family associated with various cellu 93.69
PF05729166 NACHT: NACHT domain 93.62
KOG2028554 consensus ATPase related to the helicase subunit o 93.6
PRK04195 482 replication factor C large subunit; Provisional 93.6
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 93.59
PRK08116268 hypothetical protein; Validated 93.55
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 93.54
PRK05973237 replicative DNA helicase; Provisional 93.53
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 93.52
PRK06620214 hypothetical protein; Validated 93.49
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 93.45
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 93.44
PRK13342413 recombination factor protein RarA; Reviewed 93.4
PRK06921266 hypothetical protein; Provisional 93.4
PRK00440319 rfc replication factor C small subunit; Reviewed 93.39
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 93.26
PRK06835329 DNA replication protein DnaC; Validated 93.19
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 93.18
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 93.17
PRK01172 674 ski2-like helicase; Provisional 93.14
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 93.13
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 93.07
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 93.06
PRK06067234 flagellar accessory protein FlaH; Validated 93.02
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 93.01
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 93.01
PRK11331459 5-methylcytosine-specific restriction enzyme subun 92.98
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 92.97
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 92.96
PRK13407334 bchI magnesium chelatase subunit I; Provisional 92.95
PRK08533230 flagellar accessory protein FlaH; Reviewed 92.94
PRK14974336 cell division protein FtsY; Provisional 92.91
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 92.88
PRK10436462 hypothetical protein; Provisional 92.81
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 92.8
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 92.8
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 92.71
PRK08727233 hypothetical protein; Validated 92.68
COG0714329 MoxR-like ATPases [General function prediction onl 92.65
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 92.65
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 92.58
PRK08939306 primosomal protein DnaI; Reviewed 92.49
PRK03992389 proteasome-activating nucleotidase; Provisional 92.46
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 92.45
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 92.43
PRK13833323 conjugal transfer protein TrbB; Provisional 92.34
PRK04328249 hypothetical protein; Provisional 92.31
PRK05642234 DNA replication initiation factor; Validated 92.3
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 92.29
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 92.24
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 92.2
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 92.17
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 92.13
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 92.09
PHA02544316 44 clamp loader, small subunit; Provisional 92.08
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 92.05
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 92.05
PRK00254 720 ski2-like helicase; Provisional 92.04
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 92.04
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 91.94
PF1355562 AAA_29: P-loop containing region of AAA domain 91.89
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 91.86
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 91.83
PRK09361225 radB DNA repair and recombination protein RadB; Pr 91.78
COG1484254 DnaC DNA replication protein [DNA replication, rec 91.76
PRK13894319 conjugal transfer ATPase TrbB; Provisional 91.74
PHA02624647 large T antigen; Provisional 91.57
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 91.53
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 91.47
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 91.37
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 91.35
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 91.34
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 91.22
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 91.22
cd01394218 radB RadB. The archaeal protein radB shares simila 91.19
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 91.15
PRK04296190 thymidine kinase; Provisional 91.14
TIGR02237209 recomb_radB DNA repair and recombination protein R 91.12
TIGR02773 1158 addB_Gpos ATP-dependent nuclease subunit B. DNA re 91.03
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 91.0
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 90.97
PHA02244383 ATPase-like protein 90.95
CHL00195489 ycf46 Ycf46; Provisional 90.93
COG0606490 Predicted ATPase with chaperone activity [Posttran 90.84
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 90.83
PRK13341 725 recombination factor protein RarA/unknown domain f 90.79
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 90.77
PF13476202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 90.74
COG3973 747 Superfamily I DNA and RNA helicases [General funct 90.71
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 90.7
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 90.69
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 90.69
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 90.67
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 90.64
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 90.63
TIGR00362405 DnaA chromosomal replication initiator protein Dna 90.62
TIGR02784 1141 addA_alphas double-strand break repair helicase Ad 90.6
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 90.44
smart00488289 DEXDc2 DEAD-like helicases superfamily. 90.38
smart00489289 DEXDc3 DEAD-like helicases superfamily. 90.38
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 90.34
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 90.33
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 90.33
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 90.3
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 90.2
cd03115173 SRP The signal recognition particle (SRP) mediates 90.17
PRK00149450 dnaA chromosomal replication initiation protein; R 90.08
COG0470325 HolB ATPase involved in DNA replication [DNA repli 89.96
PRK11823446 DNA repair protein RadA; Provisional 89.94
PRK13767 876 ATP-dependent helicase; Provisional 89.91
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 89.9
PF13173128 AAA_14: AAA domain 89.87
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 89.68
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 89.63
CHL00176638 ftsH cell division protein; Validated 89.54
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 89.51
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 89.5
cd01393226 recA_like RecA is a bacterial enzyme which has rol 89.47
PRK09087226 hypothetical protein; Validated 89.39
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 89.38
COG1936180 Predicted nucleotide kinase (related to CMP and AM 89.36
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 89.31
PRK14088440 dnaA chromosomal replication initiation protein; P 89.21
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 89.19
PRK10867433 signal recognition particle protein; Provisional 89.1
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 89.03
PHA02774613 E1; Provisional 89.02
PRK12422445 chromosomal replication initiation protein; Provis 88.99
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 88.91
PRK08233182 hypothetical protein; Provisional 88.89
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 88.89
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 88.89
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 88.85
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 88.64
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 88.64
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 88.62
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 88.56
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 88.53
PRK00131175 aroK shikimate kinase; Reviewed 88.5
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 88.37
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 88.34
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 88.32
TIGR00763775 lon ATP-dependent protease La. This protein is ind 88.28
PHA02653 675 RNA helicase NPH-II; Provisional 88.27
PRK15455 644 PrkA family serine protein kinase; Provisional 88.2
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 88.19
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 88.13
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 88.06
PRK06851367 hypothetical protein; Provisional 88.01
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 88.0
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 87.96
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 87.93
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 87.91
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 87.88
COG4096 875 HsdR Type I site-specific restriction-modification 87.85
TIGR00235207 udk uridine kinase. Model contains a number of lon 87.85
CHL00095821 clpC Clp protease ATP binding subunit 87.78
PRK04040188 adenylate kinase; Provisional 87.76
PF13479213 AAA_24: AAA domain 87.67
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 87.61
PRK04301317 radA DNA repair and recombination protein RadA; Va 87.54
KOG0734752 consensus AAA+-type ATPase containing the peptidas 87.53
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 87.44
PRK14087450 dnaA chromosomal replication initiation protein; P 87.43
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 87.42
KOG0731774 consensus AAA+-type ATPase containing the peptidas 87.42
PRK10865857 protein disaggregation chaperone; Provisional 87.36
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 87.34
PRK14527191 adenylate kinase; Provisional 87.3
TIGR02236310 recomb_radA DNA repair and recombination protein R 87.25
PRK13851344 type IV secretion system protein VirB11; Provision 87.23
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 87.08
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 87.07
COG2255332 RuvB Holliday junction resolvasome, helicase subun 87.07
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 87.02
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 87.01
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 86.97
KOG1132 945 consensus Helicase of the DEAD superfamily [Replic 86.91
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 86.9
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 86.87
PRK14531183 adenylate kinase; Provisional 86.74
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 86.74
TIGR02012321 tigrfam_recA protein RecA. This model describes or 86.73
PRK13909 910 putative recombination protein RecB; Provisional 86.72
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 86.71
PRK05541176 adenylylsulfate kinase; Provisional 86.64
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 86.59
PRK05480209 uridine/cytidine kinase; Provisional 86.57
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 86.56
PRK06762166 hypothetical protein; Provisional 86.55
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 86.53
PRK08118167 topology modulation protein; Reviewed 86.5
CHL00206 2281 ycf2 Ycf2; Provisional 86.48
PRK09302 509 circadian clock protein KaiC; Reviewed 86.43
PRK03839180 putative kinase; Provisional 86.43
PRK13765 637 ATP-dependent protease Lon; Provisional 86.42
PRK13947171 shikimate kinase; Provisional 86.4
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 86.37
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 86.3
KOG0354 746 consensus DEAD-box like helicase [General function 86.27
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 86.25
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 86.24
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 86.17
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 86.16
KOG1804 775 consensus RNA helicase [RNA processing and modific 86.15
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 86.12
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 86.01
PRK10416318 signal recognition particle-docking protein FtsY; 85.98
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 85.95
PRK14532188 adenylate kinase; Provisional 85.9
PRK00771437 signal recognition particle protein Srp54; Provisi 85.89
PRK09302509 circadian clock protein KaiC; Reviewed 85.79
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 85.61
PRK13768253 GTPase; Provisional 85.51
TIGR00064272 ftsY signal recognition particle-docking protein F 85.49
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 85.46
cd00983325 recA RecA is a bacterial enzyme which has roles in 85.31
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 85.21
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 85.21
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 85.19
PF00005137 ABC_tran: ABC transporter This structure is on hol 85.16
PRK00889175 adenylylsulfate kinase; Provisional 85.13
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 85.11
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 85.05
PRK14530215 adenylate kinase; Provisional 85.04
PRK07261171 topology modulation protein; Provisional 85.01
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 84.95
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 84.95
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 84.87
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 84.85
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 84.81
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 84.78
cd03112158 CobW_like The function of this protein family is u 84.74
PLN02200234 adenylate kinase family protein 84.72
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 84.69
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 84.69
PRK14528186 adenylate kinase; Provisional 84.68
PRK07940394 DNA polymerase III subunit delta'; Validated 84.65
PRK13764602 ATPase; Provisional 84.64
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 84.63
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 84.56
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 84.51
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 84.47
PRK02496184 adk adenylate kinase; Provisional 84.46
PLN02459261 probable adenylate kinase 84.45
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 84.44
PTZ00202550 tuzin; Provisional 84.43
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 84.39
PRK01184184 hypothetical protein; Provisional 84.39
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 84.34
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 84.28
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 84.27
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 84.25
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 84.24
PRK10865 857 protein disaggregation chaperone; Provisional 84.23
PF07088 484 GvpD: GvpD gas vesicle protein; InterPro: IPR00978 84.15
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 84.11
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 84.06
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 84.01
PRK09354349 recA recombinase A; Provisional 83.99
COG4098441 comFA Superfamily II DNA/RNA helicase required for 83.95
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 83.91
PRK00300205 gmk guanylate kinase; Provisional 83.83
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta s 83.79
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 83.78
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 83.77
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 83.73
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 83.72
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 83.64
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 83.48
TIGR02688449 conserved hypothetical protein TIGR02688. Members 83.31
COG1618179 Predicted nucleotide kinase [Nucleotide transport 83.24
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 83.23
KOG1970 634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 83.22
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 83.17
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 83.11
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 83.1
PRK06547172 hypothetical protein; Provisional 82.9
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 82.8
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 82.8
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 82.74
PRK12608380 transcription termination factor Rho; Provisional 82.73
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 82.71
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 82.67
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 82.59
PTZ00035337 Rad51 protein; Provisional 82.59
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 82.59
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 82.45
TIGR00665434 DnaB replicative DNA helicase. This model describe 82.44
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 82.43
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 82.38
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 82.34
KOG0736953 consensus Peroxisome assembly factor 2 containing 82.34
PRK06696223 uridine kinase; Validated 82.29
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 82.28
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 82.23
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 82.2
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 82.13
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 82.1
PRK14086617 dnaA chromosomal replication initiation protein; P 82.01
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 82.0
cd00876160 Ras Ras family. The Ras family of the Ras superfam 81.95
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 81.95
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 81.9
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 81.81
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 81.79
PHA02530300 pseT polynucleotide kinase; Provisional 81.79
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 81.72
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 81.54
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 81.44
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 81.34
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 81.34
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 81.31
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 81.29
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 81.29
CHL00095 821 clpC Clp protease ATP binding subunit 81.26
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 81.25
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 81.24
PRK14737186 gmk guanylate kinase; Provisional 81.17
PRK14738206 gmk guanylate kinase; Provisional 81.08
TIGR00959428 ffh signal recognition particle protein. This mode 81.04
PRK09435332 membrane ATPase/protein kinase; Provisional 81.01
PRK00279215 adk adenylate kinase; Reviewed 81.0
PRK07667193 uridine kinase; Provisional 80.96
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 80.77
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 80.75
KOG1969 877 consensus DNA replication checkpoint protein CHL12 80.63
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 80.51
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 80.49
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 80.46
COG0552340 FtsY Signal recognition particle GTPase [Intracell 80.41
PF00519432 PPV_E1_C: Papillomavirus helicase; InterPro: IPR00 80.32
PRK09112351 DNA polymerase III subunit delta'; Validated 80.29
PRK09825176 idnK D-gluconate kinase; Provisional 80.25
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 80.15
PRK09694 878 helicase Cas3; Provisional 80.01
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=4.1e-40  Score=377.19  Aligned_cols=386  Identities=25%  Similarity=0.309  Sum_probs=236.9

Q ss_pred             cccccCcccCCHHHHHHhhhHHHHHHHHHHHHHhHHHhhccCCCCceeEEE--EEEeeeccCCeEEEEEcccCccccCCC
Q 042849          431 ELQCVPGRFESVEEYVRVFEPLLFEECRAQLYSTWEELTETGSRDTHVMVR--IRNIERRERGWYDVIVLPVNECKWSFK  508 (1019)
Q Consensus       431 ~lk~IP~tF~S~~eY~~sFePLLLEE~rAqL~ss~ee~~~~~sr~~~~~v~--I~sve~~~~~fydV~v~~~~~~~~~~~  508 (1019)
                      +...|-.+|.+..+|.++|-||.-.||.-+=  .+.|...    ...+.|+  +--.++ ..-||.   .+.-.......
T Consensus       228 ~~~hv~~ry~da~~y~~vf~pliklea~ydk--~~Kes~~----q~~~tvRW~~gLnkk-~~a~f~---~~k~~~e~kl~  297 (935)
T KOG1802|consen  228 EPPHVQLRYEDAYEYQNVFSPLIKLEADYDK--RLKESQT----QENGTVRWDIGLNKK-RLAYFT---LPKLDSELKLA  297 (935)
T ss_pred             CCCcccccccchHHHhhhcchhhhhhhhhhh--hhhhhcc----cccceEEeeeccccc-eEEEEe---cCCCcchhccc
Confidence            5678889999999999999999999997653  2333221    1122222  111111 111221   11112234567


Q ss_pred             CCCEEEEecCCCCCCCCcCCCCccccccccccccceEeeeeeeccccCCCCCCceEEEEEecccCCCCCCCCchhHHHhh
Q 042849          509 EGDVAVLSTPRPGSVRGKRNHSLAAEDDEEAEVSGRVAGTVRRHFPVDARDPPGAILHFYVGDSYDPSSSMDDDDHILRK  588 (1019)
Q Consensus       509 egDLVLLS~~kP~~~~~~~~~~~~~~d~~~~~~~g~v~g~v~~~~~v~~~~~~~~~vr~~v~~s~d~~~k~~~~~~~l~~  588 (1019)
                      .||-+.|....-...              .=..+|+|+.....+     .+...+.+++..    ++.            
T Consensus       298 ~GdE~~L~y~~~~~~--------------~w~~~g~v~~~pd~~-----~dE~~lEl~~~~----~~p------------  342 (935)
T KOG1802|consen  298 IGDEIRLTYSGGLVL--------------PWNGIGSVLKIPDNN-----GDEVKLELEFSQ----DPP------------  342 (935)
T ss_pred             cCCeeEEEecCCcCC--------------cccccceEEecCCCC-----cceeEEEeecCC----CCC------------
Confidence            788888876421100              001133444322211     122223333321    111            


Q ss_pred             cCCCceEEEEEecChhhHHHHHHHHhhcccCChHHHHhh-----cCCCCCCCCCcCCCCCCCCcccchhhHhhhccCCCh
Q 042849          589 LQPKGIWYLTVLGSLATTQREYVALHAFCRLNSQMQTAI-----LKPSPEHFPKYEHQTPTMPECFTQNFIDHLHRTFNG  663 (1019)
Q Consensus       589 L~~~s~w~l~kL~nLtT~~RE~~AL~~l~~~~~~l~~~I-----L~ps~~~~~~~~~~~~~~~~~~~~~l~~~L~~~LNe  663 (1019)
                      +....-+.+-++.+-+++.|++.||..|..-...+-.++     ..|....+     .....|.    .|...--.+||.
T Consensus       343 ~e~~~~Ftvd~vwk~ts~drm~~alk~la~D~~~vs~y~y~klLgh~~~~~~-----~k~~LP~----~~s~~~lpkLN~  413 (935)
T KOG1802|consen  343 IEVTHGFTVDFVWKSTSFDRMQLALKLLAVDEKKVSGYLYHKLLGHPVEDSS-----LKKLLPR----RFSVPNLPKLNA  413 (935)
T ss_pred             cccccceEEEEEEcCccHHHHHHHHHHhhhccccchhhhhhHHhcCcchhhh-----hcccCch----hhcCCCchhhch
Confidence            123345777889999999999999998764332222222     22221110     0111222    111111257999


Q ss_pred             HHHHHHHHHHHHhhcCCCCCCCCCCCCeeEEeCCCCCChhHHHHHHHHHHHHHhhhhhhhhhhhhcCcccccCCCCCCCC
Q 042849          664 PQLAAIQWAAIHTAAGTSSGMTKSPWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQHYYNSLLKKLAPESYKQPNESNSD  743 (1019)
Q Consensus       664 SQ~eAI~~Al~~~~~g~s~~~~k~~~~fsLIQGPPGTGKTkTI~~LL~~Lll~~~q~~~~sLlk~l~~~~~kq~~~~~s~  743 (1019)
                      ||..||..+|              +++++|||||||||||-|++.||..+  +          +                
T Consensus       414 SQ~~AV~~VL--------------~rplsLIQGPPGTGKTvtsa~IVyhl--~----------~----------------  451 (935)
T KOG1802|consen  414 SQSNAVKHVL--------------QRPLSLIQGPPGTGKTVTSATIVYHL--A----------R----------------  451 (935)
T ss_pred             HHHHHHHHHH--------------cCCceeeecCCCCCceehhHHHHHHH--H----------H----------------
Confidence            9999999887              46999999999999999999998632  1          0                


Q ss_pred             cccCCchhHHhhhhhhhhhccCCCCCCCCcEEEEecCchhHHHHHHHHHhcCcccCcccccCCcEEEEcCchhhhHHhhh
Q 042849          744 NVSMGSIDEVLQNMDQNLLRTLPKLCPKPRMLVCAPSNAATDELLTRVLDRGFIDGEMKVYRPDVARVGVDSQTRAAQAV  823 (1019)
Q Consensus       744 ~~~~g~~~e~~~~~~~n~~r~~~k~~~k~RILVCAPSNaAVDEll~RLl~~Gi~d~~g~~y~p~VVRiG~~s~~~~v~~v  823 (1019)
                                               ....+||||||||.|||+|+++|.+.|+          +|||+-..++...-.++
T Consensus       452 -------------------------~~~~~VLvcApSNiAVDqLaeKIh~tgL----------KVvRl~aksRE~~~S~v  496 (935)
T KOG1802|consen  452 -------------------------QHAGPVLVCAPSNIAVDQLAEKIHKTGL----------KVVRLCAKSREDIESDV  496 (935)
T ss_pred             -------------------------hcCCceEEEcccchhHHHHHHHHHhcCc----------eEeeeehhhhhhccCCc
Confidence                                     0256899999999999999999998876          89999877654322222


Q ss_pred             cHHHHHHHHHHhhHHHHHhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHhhhcCCCCCChhhhhhhhhhHHHHHHHHHHHH
Q 042849          824 SVERRTEQLLVKSREEVIGWMHNLKGREAVLSQQIANLQRELNAAAFAVRSQGSVGVDPDVLMARDQNRDTLLQNLAAAV  903 (1019)
Q Consensus       824 sLd~rv~~lL~k~~~~~~~~~~~L~~~~~~l~~~i~~L~~~L~~~~~a~rs~~s~~~d~~~l~~~d~~r~~Llq~L~~~~  903 (1019)
                      +.-.....               ++....---+.+..++++-.+                 +...               
T Consensus       497 s~L~lh~~---------------~~~~~~pELq~l~klkde~ge-----------------lS~s---------------  529 (935)
T KOG1802|consen  497 SFLSLHEQ---------------LRNMDKPELQKLLKLKDEGGE-----------------LSSS---------------  529 (935)
T ss_pred             cHHHHHHH---------------HhccCcHHHHHHHhhhhhccc-----------------ccch---------------
Confidence            21111000               000000000111111111000                 0000               


Q ss_pred             HhHHHHHHHHhhhhhhccccCCCCCchhHHHHHHHHHHHhccCcEEEEecccchhHHHhhhcCCCCEEEEcCCCCCCccc
Q 042849          904 ENRDKVLVEMSRFHILEGRFRPGSNFNLEEARASLEASFANEAEIVFTTVSSSGRKLFSRLTHGFDMVVIDEAAQASEVG  983 (1019)
Q Consensus       904 ~~r~k~L~elsrl~~l~~r~r~~~~~~l~~~r~~l~~~iL~eA~IV~sTlSssg~~ll~~l~~~FDvVIIDEAAQa~E~s  983 (1019)
                                             ....+.+..+..+..+|+.|+||||||.++|...+...  .|.+|+||||.|++||+
T Consensus       530 -----------------------D~~k~~~lk~~~e~ell~~AdVIccTcv~Agd~rl~~~--kfr~VLiDEaTQatEpe  584 (935)
T KOG1802|consen  530 -----------------------DEKKYRKLKRAAEKELLNQADVICCTCVGAGDRRLSKF--KFRTVLIDEATQATEPE  584 (935)
T ss_pred             -----------------------hhHHHHHHHHHHHHHHHhhcCEEEEecccccchhhccc--cccEEEEecccccCCcc
Confidence                                   00112344566788899999999999999998888774  89999999999999999


Q ss_pred             cccccccCCCeEEEecCCCCCCCcccCccccccCCC
Q 042849          984 VLPPLSLGAARCVLGGGSSAAPCNSYQQGSRHLDVQ 1019 (1019)
Q Consensus       984 tLIPL~~g~kr~ILVGDpkQLPPtV~S~~Ak~lg~~ 1019 (1019)
                      +||||.+|+|++||||||+||-|+|+.+.|...||+
T Consensus       585 ~LiPlvlG~kq~VlVGDh~QLgpvi~~kK~a~Agl~  620 (935)
T KOG1802|consen  585 CLIPLVLGAKQLVLVGDHKQLGPVIMCKKAATAGLS  620 (935)
T ss_pred             hhhhhhhcceeEEEeccccccCceeeeHHHHHhHHH
Confidence            999999999999999999999999999999888863

>TIGR00376 DNA helicase, putative Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG1801 consensus tRNA-splicing endonuclease positive effector (SEN1) [RNA processing and modification] Back     alignment and domain information
>KOG1807 consensus Helicases [Replication, recombination and repair] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>KOG1806 consensus DEAD box containing helicases [Replication, recombination and repair] Back     alignment and domain information
>KOG1804 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR00609 recB exodeoxyribonuclease V, beta subunit Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK10876 recB exonuclease V subunit beta; Provisional Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>TIGR02773 addB_Gpos ATP-dependent nuclease subunit B Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK13909 putative recombination protein RecB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1804 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PF07088 GvpD: GvpD gas vesicle protein; InterPro: IPR009788 This family consists of several archaeal GvpD gas vesicle proteins Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00519 PPV_E1_C: Papillomavirus helicase; InterPro: IPR001177 Papillomaviruses are a large family of DNA tumour viruses which give rise to warts in their host species Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1019
2xzl_A 802 Upf1-Rna Complex Length = 802 2e-04
>pdb|2XZL|A Chain A, Upf1-Rna Complex Length = 802 Back     alignment and structure 
Iteration: 1

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 77/315 (24%), Positives = 104/315 (33%), Gaps = 146/315 (46%)
Query: 690 PFTLVQGPPGTGKTHTVWGMLNVIHLVQYQHYYNSLLKKLAPESYKQPNESNSDNVSMGS 749
           P +L+QGPPGTGK  TV     V HL +                                
Sbjct: 376 PLSLIQGPPGTGK--TVTSATIVYHLSKIH------------------------------ 403
Query: 750 IDEVLQNMDQNLLRTLPKLCPKPRMLVCAPSNAATDELLTRVLDRGFIDGEMKVYRPDVA 809
                                K R+LVCAPSN A D L  ++ D G     +KV R    
Sbjct: 404 ---------------------KDRILVCAPSNVAVDHLAAKLRDLG-----LKVVR---- 433
Query: 810 RVGVDSQTRAAQAVSVERRTEQLLVKSREEVIG-----WMHNLKGREAVLSQQIANLQRE 864
                                 L  KSRE+V        +HNL GR              
Sbjct: 434 ----------------------LTAKSREDVESSVSNLALHNLVGR-------------- 457
Query: 865 LNAAAFAVRSQGSVGVDPDVLMARDQNRDTLLQNLAAAVENRDKVLVEMSRFHILEGRFR 924
                      G+ G   ++L  +D+     +  L+A+   R   LV  +   IL     
Sbjct: 458 -----------GAKGELKNLLKLKDE-----VGELSASDTKRFVKLVRKTEAEIL----- 496
Query: 925 PGSNFNLEEARASLEASFANEAEIVFTTVSSSGRKLFSRLTHGFDMVVIDEAAQASEVGV 984
                              N+A++V  T   +G K   RL   F  V+IDE+ QASE   
Sbjct: 497 -------------------NKADVVCCTCVGAGDK---RLDTKFRTVLIDESTQASEPEC 534
Query: 985 LPPLSLGAARCVLGG 999
           L P+  GA + +L G
Sbjct: 535 LIPIVKGAKQVILVG 549

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1019
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 3e-26
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 1e-13
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 2e-24
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 4e-13
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 6e-22
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 1e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 Back     alignment and structure
 Score =  114 bits (286), Expect = 3e-26
 Identities = 70/429 (16%), Positives = 127/429 (29%), Gaps = 119/429 (27%)

Query: 435 VPGRFESVEEYVRVFEPLLFEECRAQLYSTWEELTETGSRDTHVMVRIRNIERRERGWYD 494
           +  R+E   +Y  +F PL+  E         ++L E+ ++D ++ VR      ++R  Y 
Sbjct: 2   LGSRYEDAYQYQNIFGPLVKLEADYD-----KKLKESQTQD-NITVRWDLGLNKKRIAY- 54

Query: 495 VIVLPVNECKWSFKEGDVAVLSTPRPGSVRGKRNHSLAAEDDEEAEVSGRVAGTVRRHFP 554
              LP  +      +GD   L                  +     +  G V        P
Sbjct: 55  -FTLPKTDSDMRLMQGDEICLRYK--------------GDLAPLWKGIGHV-----IKVP 94

Query: 555 VDARDPPGAILHFYVGDSYDPSSSMDDDDHILRKLQPKGIWYLTVLGSLATTQREYVALH 614
            +  D     L   VG   + + +                + +  +    +  R   AL 
Sbjct: 95  DNYGDEIAIELRSSVGAPVEVTHN----------------FQVDFVWKSTSFDRMQSALK 138

Query: 615 AFCRLNSQMQTAILKPSPEHFPKYEHQTPTMPECFTQNFIDHLHRTFNGPQLAAIQWAAI 674
            F    + +   I      H  +       +P+ FT   +  L    N  Q+ A++    
Sbjct: 139 TFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDL----NHSQVYAVKTVLQ 194

Query: 675 HTAAGTSSGMTKSPWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQHYYNSLLKKLAPESY 734
                          P +L+QGPPGTGKT T                             
Sbjct: 195 R--------------PLSLIQGPPGTGKTVTS---------------------------- 212

Query: 735 KQPNESNSDNVSMGSIDEVLQNMDQNLLRTLPKLCPKPRMLVCAPSNAATDELLTRVLDR 794
                             V     Q     L          VCAPSN A D+L  ++   
Sbjct: 213 ---------------ATIVYHLARQGNGPVL----------VCAPSNIAVDQLTEKIHQT 247

Query: 795 G-----FIDGEMKVYRPDVARVGVDSQTRAAQAVSVERRTEQLLVKSREEVIGWMHNLKG 849
           G           +     V+ + + +Q R   ++   ++ +QL  ++ E         + 
Sbjct: 248 GLKVVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSSADEKRYRA 307

Query: 850 REAVLSQQI 858
            +    +++
Sbjct: 308 LKRTAEREL 316
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1019
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 100.0
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 100.0
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 100.0
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 100.0
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 99.46
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 99.43
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 99.27
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 99.17
3vkw_A 446 Replicase large subunit; alpha/beta domain, helica 99.09
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 98.65
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 98.51
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 98.19
3b6e_A216 Interferon-induced helicase C domain-containing P; 98.11
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 98.04
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 97.98
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 97.96
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 97.91
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 97.87
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 97.86
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 97.81
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 97.81
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 97.81
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 97.79
3bor_A237 Human initiation factor 4A-II; translation initiat 97.73
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 97.72
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 97.71
3h1t_A590 Type I site-specific restriction-modification syst 97.71
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 97.68
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 97.63
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 97.62
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 97.6
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 97.57
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 97.53
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 97.51
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 97.51
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 97.44
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 97.43
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 97.41
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 97.4
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 97.39
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 97.32
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 97.31
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 97.31
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 97.21
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 97.19
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 97.12
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 97.11
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 97.09
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 97.09
4gl2_A 699 Interferon-induced helicase C domain-containing P; 97.03
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 97.03
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 96.99
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 96.96
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 96.91
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 96.88
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 96.87
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 96.8
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 96.78
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 96.66
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 96.62
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 96.61
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 96.6
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 96.52
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 96.46
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.44
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 96.35
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 96.31
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 96.31
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 96.28
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 96.04
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.04
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 95.96
3bos_A242 Putative DNA replication factor; P-loop containing 95.9
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 95.81
1tue_A212 Replication protein E1; helicase, replication, E1E 95.65
3co5_A143 Putative two-component system transcriptional RES 95.64
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 95.62
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 95.58
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.37
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 95.36
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 95.32
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 95.32
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 95.12
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 95.11
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 95.02
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 94.94
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 94.87
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 94.86
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 94.78
2v1u_A387 Cell division control protein 6 homolog; DNA repli 94.74
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 94.71
2r44_A331 Uncharacterized protein; putative ATPase, structur 94.66
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 94.63
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 94.61
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 94.57
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 94.55
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 94.55
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 94.52
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 94.51
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 94.48
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 94.43
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 94.43
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.37
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 94.29
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 94.23
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 94.18
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 94.15
2qgz_A308 Helicase loader, putative primosome component; str 94.15
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 94.12
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 94.11
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 94.1
2r62_A268 Cell division protease FTSH homolog; ATPase domain 94.1
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 94.08
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 94.05
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 94.03
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 93.99
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 93.84
2kjq_A149 DNAA-related protein; solution structure, NESG, st 93.83
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 93.81
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 93.8
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 93.71
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 93.67
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 93.65
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 93.64
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 93.57
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 93.55
3pvs_A447 Replication-associated recombination protein A; ma 93.54
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 93.51
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 93.5
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 93.49
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 93.48
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 93.46
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 93.45
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 93.43
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 93.4
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 93.35
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 93.34
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 93.33
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 93.29
1w36_B 1180 RECB, exodeoxyribonuclease V beta chain; recombina 93.2
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 93.16
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 93.1
1ojl_A304 Transcriptional regulatory protein ZRAR; response 93.06
2chq_A319 Replication factor C small subunit; DNA-binding pr 93.05
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 93.01
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 92.98
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 92.94
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 92.8
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 92.77
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 92.69
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 92.39
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 92.31
1yks_A 440 Genome polyprotein [contains: flavivirin protease 92.27
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 92.09
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 92.03
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 91.98
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 91.87
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 91.76
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 91.71
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 91.5
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 91.27
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 91.11
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 91.06
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 91.02
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 90.9
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 90.88
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 90.86
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 90.83
2cvh_A220 DNA repair and recombination protein RADB; filamen 90.76
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 90.7
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 90.64
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 90.55
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 90.46
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 90.42
1p9r_A418 General secretion pathway protein E; bacterial typ 90.39
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 90.37
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 90.15
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 90.14
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 90.13
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 90.01
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 89.87
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 89.64
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 89.64
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 89.52
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 89.48
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 89.39
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 89.38
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 89.35
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 89.31
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 89.17
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 89.17
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 89.13
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 89.03
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 89.0
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 88.94
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 88.89
2gno_A305 DNA polymerase III, gamma subunit-related protein; 88.81
2r6a_A454 DNAB helicase, replicative helicase; replication, 88.79
1kag_A173 SKI, shikimate kinase I; transferase, structural g 88.61
3vaa_A199 Shikimate kinase, SK; structural genomics, center 88.54
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 88.53
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 88.52
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 88.51
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 88.47
4a74_A231 DNA repair and recombination protein RADA; hydrola 88.45
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 88.45
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 88.41
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 88.35
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 88.35
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 88.34
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 88.31
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 88.3
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 88.3
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 88.28
2fna_A357 Conserved hypothetical protein; structural genomic 88.26
3io5_A333 Recombination and repair protein; storage dimer, i 88.11
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 88.01
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 88.0
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 87.88
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 87.87
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 87.84
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 87.56
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 87.46
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 87.32
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 87.27
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 87.25
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 87.12
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 86.92
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 86.84
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 86.83
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 86.72
2z43_A324 DNA repair and recombination protein RADA; archaea 86.7
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 86.55
1via_A175 Shikimate kinase; structural genomics, transferase 86.46
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 86.38
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 86.38
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 86.37
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 86.34
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 86.19
1u94_A356 RECA protein, recombinase A; homologous recombinat 86.18
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 86.05
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 86.0
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 85.99
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 85.98
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 85.97
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 85.97
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 85.62
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 85.55
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 85.54
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 85.46
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 85.44
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 85.41
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 85.27
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 85.26
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 85.07
2eyu_A261 Twitching motility protein PILT; pilus retraction 85.01
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 85.0
1xjc_A169 MOBB protein homolog; structural genomics, midwest 84.99
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 84.92
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 84.88
2ewv_A372 Twitching motility protein PILT; pilus retraction 84.88
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 84.87
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 84.87
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 84.83
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 84.75
2vli_A183 Antibiotic resistance protein; transferase, tunica 84.71
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 84.71
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 84.5
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 84.44
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 84.41
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 84.19
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 84.19
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 84.18
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 84.13
1vma_A306 Cell division protein FTSY; TM0570, structural gen 84.11
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 84.1
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 83.92
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 83.74
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 83.66
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 83.65
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 83.61
3u4q_B 1166 ATP-dependent helicase/deoxyribonuclease subunit; 83.52
1xp8_A366 RECA protein, recombinase A; recombination, radior 83.51
3kta_A182 Chromosome segregation protein SMC; structural mai 83.48
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 83.36
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 83.36
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 83.18
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 83.17
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 82.87
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 82.67
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 82.4
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 82.29
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 82.2
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 82.13
3tlx_A243 Adenylate kinase 2; structural genomics, structura 82.05
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 82.02
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 81.77
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 81.76
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 81.57
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 81.5
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 81.45
2oap_1511 GSPE-2, type II secretion system protein; hexameri 81.43
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 80.85
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 80.69
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 80.66
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 80.56
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 80.33
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 80.06
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
Probab=100.00  E-value=2.1e-40  Score=400.07  Aligned_cols=395  Identities=22%  Similarity=0.267  Sum_probs=235.7

Q ss_pred             CHHHHHHhhhHHHHHHHHHHHHHhHHHhhccC-----CCCcee-EEEEEEeeeccCCeEEEEEcccC--c----cccCCC
Q 042849          441 SVEEYVRVFEPLLFEECRAQLYSTWEELTETG-----SRDTHV-MVRIRNIERRERGWYDVIVLPVN--E----CKWSFK  508 (1019)
Q Consensus       441 S~~eY~~sFePLLLEE~rAqL~ss~ee~~~~~-----sr~~~~-~v~I~sve~~~~~fydV~v~~~~--~----~~~~~~  508 (1019)
                      |+++|++.|.+||-.|..+++....+......     .+..++ .+.+...+....|-+.+.+....  .    ....|.
T Consensus         3 ~~~~~~~~~~~Ll~~E~~~e~~~~~~~~~~~~~~~~~~~G~~~~~l~~~~~~~~~~g~~~~~~~~~~~~~~~~l~~~~~~   82 (646)
T 4b3f_X            3 AVESFVTKQLDLLELERDAEVEERRSWQENISLKELQSRGVCLLKLQVSSQRTGLYGRLLVTFEPRRYGSAAALPSNSFT   82 (646)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSCHHHHGGGTSEEEEEEEEEEEECSSSCEEEEEEESCC---CCCCCCCCC
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCHHHHHhCCceecceEEEEEEecCCCeEEEEEEecCCCCCCCCccCCCC
Confidence            68999999999999999998877665543221     112221 23333333222343444443211  1    123689


Q ss_pred             CCCEEEEecCCCCCCCCcCCCCccccccccccccceEeeeeeeccccCCCCCCceEEEEEecccCCCCCCCCchhHHHhh
Q 042849          509 EGDVAVLSTPRPGSVRGKRNHSLAAEDDEEAEVSGRVAGTVRRHFPVDARDPPGAILHFYVGDSYDPSSSMDDDDHILRK  588 (1019)
Q Consensus       509 egDLVLLS~~kP~~~~~~~~~~~~~~d~~~~~~~g~v~g~v~~~~~v~~~~~~~~~vr~~v~~s~d~~~k~~~~~~~l~~  588 (1019)
                      .||+|+|+...+..               ...    ..|.|.+...      ..+.|.+  ....+.          ...
T Consensus        83 ~Gd~v~~~~~~~~~---------------~~~----~~g~v~~~~~------~~i~v~~--~~~~~~----------~~~  125 (646)
T 4b3f_X           83 SGDIVGLYDAANEG---------------SQL----ATGILTRVTQ------KSVTVAF--DESHDF----------QLS  125 (646)
T ss_dssp             TTCEEEEEETTTTS---------------CCC----EEEEEEEEET------TEEEEEC--C-----------------C
T ss_pred             CCCEEEEEecCCCC---------------Cce----EEEEEEEEeC------CEEEEEE--CCcccc----------ccc
Confidence            99999998765431               011    1233332110      1123332  111110          012


Q ss_pred             cCCCceEEEEEecChhhHHHHHHHHhhcccCC----hHHHHhhcCCCCCCCCCcCCCCCCCCcccchhhHhhhccCCChH
Q 042849          589 LQPKGIWYLTVLGSLATTQREYVALHAFCRLN----SQMQTAILKPSPEHFPKYEHQTPTMPECFTQNFIDHLHRTFNGP  664 (1019)
Q Consensus       589 L~~~s~w~l~kL~nLtT~~RE~~AL~~l~~~~----~~l~~~IL~ps~~~~~~~~~~~~~~~~~~~~~l~~~L~~~LNeS  664 (1019)
                      +.....|.+.++.|.+|+.|++.||..+....    ..+.+.||.-.+..+.   .  ...       ...++...||++
T Consensus       126 ~~~~~~~~~~~~~~~~~~~r~~~al~~l~~~~~~~~~~l~~~l~~~~~p~~~---~--~~~-------~~~~~~~~LN~~  193 (646)
T 4b3f_X          126 LDRENSYRLLKLANDVTYRRLKKALIALKKYHSGPASSLIEVLFGRSAPSPA---S--EIH-------PLTFFNTCLDTS  193 (646)
T ss_dssp             CCSSCCEEEEEECCHHHHHHHHHHHHHHHTCCSSTTHHHHHHHTTSSCCCCC---C--CCC-------CCCCSSTTCCHH
T ss_pred             cCCCCcEEEEEeccchHHHHHHHHHHHhhhcccCchHHHHHHHcCCCCCCCc---c--ccC-------cccccCCCCCHH
Confidence            33456799999999999999999999986543    2355666643211100   0  000       022345789999


Q ss_pred             HHHHHHHHHHHhhcCCCCCCCCCCCCeeEEeCCCCCChhHHHHHHHHHHHHHhhhhhhhhhhhhcCcccccCCCCCCCCc
Q 042849          665 QLAAIQWAAIHTAAGTSSGMTKSPWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQHYYNSLLKKLAPESYKQPNESNSDN  744 (1019)
Q Consensus       665 Q~eAI~~Al~~~~~g~s~~~~k~~~~fsLIQGPPGTGKTkTI~~LL~~Lll~~~q~~~~sLlk~l~~~~~kq~~~~~s~~  744 (1019)
                      |.+||..|+.             ..+++|||||||||||+||+.+|..++            +                 
T Consensus       194 Q~~AV~~al~-------------~~~~~lI~GPPGTGKT~ti~~~I~~l~------------~-----------------  231 (646)
T 4b3f_X          194 QKEAVLFALS-------------QKELAIIHGPPGTGKTTTVVEIILQAV------------K-----------------  231 (646)
T ss_dssp             HHHHHHHHHH-------------CSSEEEEECCTTSCHHHHHHHHHHHHH------------H-----------------
T ss_pred             HHHHHHHHhc-------------CCCceEEECCCCCCHHHHHHHHHHHHH------------h-----------------
Confidence            9999999883             247999999999999999999886431            1                 


Q ss_pred             ccCCchhHHhhhhhhhhhccCCCCCCCCcEEEEecCchhHHHHHHHHHhcCcccCcccccCCcEEEEcCchhh-hHHhhh
Q 042849          745 VSMGSIDEVLQNMDQNLLRTLPKLCPKPRMLVCAPSNAATDELLTRVLDRGFIDGEMKVYRPDVARVGVDSQT-RAAQAV  823 (1019)
Q Consensus       745 ~~~g~~~e~~~~~~~n~~r~~~k~~~k~RILVCAPSNaAVDEll~RLl~~Gi~d~~g~~y~p~VVRiG~~s~~-~~v~~v  823 (1019)
                                               .+.+||||||||.|||++++||...          ..+++|+|...+. ..+...
T Consensus       232 -------------------------~~~~ILv~a~TN~AvD~i~erL~~~----------~~~ilRlG~~~r~~~~~~~~  276 (646)
T 4b3f_X          232 -------------------------QGLKVLCCAPSNIAVDNLVERLALC----------KQRILRLGHPARLLESIQQH  276 (646)
T ss_dssp             -------------------------TTCCEEEEESSHHHHHHHHHHHHHT----------TCCEEECSCCSSCCHHHHTT
T ss_pred             -------------------------CCCeEEEEcCchHHHHHHHHHHHhc----------CCceEEecchhhhhhhhhhh
Confidence                                     2579999999999999999999754          3489999998764 345556


Q ss_pred             cHHHHHHHHHHhhHHHHHhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHhhhcCCCCCChhhhhhhhhhHHHHHHHHHHHH
Q 042849          824 SVERRTEQLLVKSREEVIGWMHNLKGREAVLSQQIANLQRELNAAAFAVRSQGSVGVDPDVLMARDQNRDTLLQNLAAAV  903 (1019)
Q Consensus       824 sLd~rv~~lL~k~~~~~~~~~~~L~~~~~~l~~~i~~L~~~L~~~~~a~rs~~s~~~d~~~l~~~d~~r~~Llq~L~~~~  903 (1019)
                      +++..+...      +       ..       ..+..+++++....    .......+.   ......+.. +..+.+  
T Consensus       277 ~l~~~~~~~------~-------~~-------~~~~~~~~~~~~~~----~~~~~~~~~---~~~~~~~~~-~~~l~~--  326 (646)
T 4b3f_X          277 SLDAVLARS------D-------SA-------QIVADIRKDIDQVF----VKNKKTQDK---REKSNFRNE-IKLLRK--  326 (646)
T ss_dssp             BHHHHHTTT------T-------CS-------STHHHHHHHHTTSS----TTTTC---------CCSSHHH-HHHHHH--
T ss_pred             hHHHHHhhc------h-------HH-------HHHHHHHHHHHHHH----HhhhhhhhH---HHHHHHHHH-HHHHHH--
Confidence            666533210      0       00       00111111111100    000000000   000000000 000000  


Q ss_pred             HhHHHHHHHHhhhhhhccccCCCCCchhHHHHHHHHHHHhccCcEEEEecccchhHHHhh--hcCCCCEEEEcCCCCCCc
Q 042849          904 ENRDKVLVEMSRFHILEGRFRPGSNFNLEEARASLEASFANEAEIVFTTVSSSGRKLFSR--LTHGFDMVVIDEAAQASE  981 (1019)
Q Consensus       904 ~~r~k~L~elsrl~~l~~r~r~~~~~~l~~~r~~l~~~iL~eA~IV~sTlSssg~~ll~~--l~~~FDvVIIDEAAQa~E  981 (1019)
                                                .+...+......++..++|||+|+++++......  ....||+||||||+|+.|
T Consensus       327 --------------------------~l~~~~~~~~~~~l~~~~vv~~t~~~a~~~~~~~~~~~~~Fd~vIIDEAsQ~~e  380 (646)
T 4b3f_X          327 --------------------------ELKEREEAAMLESLTSANVVLATNTGASADGPLKLLPESYFDVVVIDECAQALE  380 (646)
T ss_dssp             --------------------------HHHHHHHHHHHHHHHHCSEEEEETTTTCSSSGGGGSCTTCCSEEEETTGGGSCH
T ss_pred             --------------------------HHHHHHHHHHHHHHhhcceeeeehhhhhhhhHHHhhhhccCCEEEEcCccccch
Confidence                                      0111223344457889999999999987643221  135799999999999999


Q ss_pred             cccccccccCCCeEEEecCCCCCCCcccCccccccCC
Q 042849          982 VGVLPPLSLGAARCVLGGGSSAAPCNSYQQGSRHLDV 1018 (1019)
Q Consensus       982 ~stLIPL~~g~kr~ILVGDpkQLPPtV~S~~Ak~lg~ 1018 (1019)
                      +++|+||. +++|+||||||+||||+|.|..|...|+
T Consensus       381 ~~~lipL~-~~~~~ILVGD~~QLpP~v~~~~a~~~gl  416 (646)
T 4b3f_X          381 ASCWIPLL-KARKCILAGDHKQLPPTTVSHKAALAGL  416 (646)
T ss_dssp             HHHTTTGG-GSSEEEEEECTTSCCCCCSCHHHHHTTT
T ss_pred             HHHHhhcc-ccceEEEcCCccccCceecchhhhhccc
Confidence            99999995 5799999999999999999999988776
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1019
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 99.74
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 99.34
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 99.02
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 98.13
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 98.06
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 98.04
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 97.98
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 97.67
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 97.57
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 97.41
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.99
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 96.98
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 96.93
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 96.88
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 96.81
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 96.67
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 96.46
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.44
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.43
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 96.41
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.33
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.3
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 96.23
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.07
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 96.02
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 95.97
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 95.85
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 95.84
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.77
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 95.56
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.38
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 95.38
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.29
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.24
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.17
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 95.11
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 94.85
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 94.78
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 94.76
d1svma_362 Papillomavirus large T antigen helicase domain {Si 94.73
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.71
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 94.7
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 94.65
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 94.5
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 94.48
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 94.48
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 94.45
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 94.42
d1okkd2207 GTPase domain of the signal recognition particle r 94.3
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 94.27
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 94.27
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 93.99
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 93.95
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 93.63
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 93.61
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 93.61
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 93.49
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 93.47
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 93.34
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 93.32
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 93.24
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 93.2
d1ls1a2207 GTPase domain of the signal sequence recognition p 93.19
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 93.16
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 93.15
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 92.87
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 92.76
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 92.73
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 92.65
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 92.55
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 92.46
d2qy9a2211 GTPase domain of the signal recognition particle r 92.45
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 92.39
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 92.1
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 92.09
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 92.02
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 91.98
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 91.89
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 91.7
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 91.29
d1vmaa2213 GTPase domain of the signal recognition particle r 91.13
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 91.11
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 91.07
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 90.85
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 90.8
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 90.72
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 90.62
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 90.57
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 90.56
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 90.49
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 89.91
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 89.91
d1j8yf2211 GTPase domain of the signal sequence recognition p 89.89
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 89.87
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 89.49
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 89.41
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 88.85
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 88.72
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 88.64
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 88.55
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 88.11
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 87.59
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 87.43
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 86.84
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 86.74
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 86.62
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 86.52
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 86.36
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 86.16
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 85.73
d1tuea_205 Replication protein E1 helicase domain {Human papi 85.51
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 85.41
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 84.6
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 83.9
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 83.17
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 82.3
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 81.54
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 81.33
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 81.17
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 80.99
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 80.66
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 80.57
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 80.47
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Exodeoxyribonuclease V alpha chain (RecD)
species: Escherichia coli [TaxId: 562]

Probab=99.74  E-value=8.9e-19  Score=195.35  Aligned_cols=69  Identities=26%  Similarity=0.249  Sum_probs=56.1

Q ss_pred             CCChHHHHHHHHHHHHhhcCCCCCCCCCCCCeeEEeCCCCCChhHHHHHHHHHHHHHhhhhhhhhhhhhcCcccccCCCC
Q 042849          660 TFNGPQLAAIQWAAIHTAAGTSSGMTKSPWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQHYYNSLLKKLAPESYKQPNE  739 (1019)
Q Consensus       660 ~LNeSQ~eAI~~Al~~~~~g~s~~~~k~~~~fsLIQGPPGTGKTkTI~~LL~~Lll~~~q~~~~sLlk~l~~~~~kq~~~  739 (1019)
                      .+++.|..||..|+              .++|++|+||||||||+|+..++..|...                       
T Consensus       148 ~~~~~Q~~A~~~al--------------~~~~~vI~G~pGTGKTt~i~~~l~~l~~~-----------------------  190 (359)
T d1w36d1         148 DEINWQKVAAAVAL--------------TRRISVISGGPGTGKTTTVAKLLAALIQM-----------------------  190 (359)
T ss_dssp             TSCCHHHHHHHHHH--------------TBSEEEEECCTTSTHHHHHHHHHHHHHHT-----------------------
T ss_pred             ccccHHHHHHHHHH--------------cCCeEEEEcCCCCCceehHHHHHHHHHHH-----------------------
Confidence            46889999999887              24899999999999999999988754210                       


Q ss_pred             CCCCcccCCchhHHhhhhhhhhhccCCCCCCCCcEEEEecCchhHHHHHHHHH
Q 042849          740 SNSDNVSMGSIDEVLQNMDQNLLRTLPKLCPKPRMLVCAPSNAATDELLTRVL  792 (1019)
Q Consensus       740 ~~s~~~~~g~~~e~~~~~~~n~~r~~~k~~~k~RILVCAPSNaAVDEll~RLl  792 (1019)
                                                 ....+.+|++|||||.|++++.+++.
T Consensus       191 ---------------------------~~~~~~~I~l~ApTgkAA~~L~e~~~  216 (359)
T d1w36d1         191 ---------------------------ADGERCRIRLAAPTGKAAARLTESLG  216 (359)
T ss_dssp             ---------------------------CSSCCCCEEEEBSSHHHHHHHHHHHT
T ss_pred             ---------------------------HhccCCeEEEecCcHHHHHHHHHHHH
Confidence                                       01236799999999999999988874
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure