Citrus Sinensis ID: 042849
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1019 | ||||||
| 147779903 | 1408 | hypothetical protein VITISV_009619 [Viti | 0.974 | 0.705 | 0.694 | 0.0 | |
| 225459354 | 1375 | PREDICTED: uncharacterized ATP-dependent | 0.946 | 0.701 | 0.686 | 0.0 | |
| 255545656 | 1352 | splicing endonuclease positive effector | 0.932 | 0.702 | 0.672 | 0.0 | |
| 356522392 | 1388 | PREDICTED: probable helicase senataxin-l | 0.936 | 0.687 | 0.661 | 0.0 | |
| 449465617 | 1363 | PREDICTED: uncharacterized ATP-dependent | 0.941 | 0.703 | 0.661 | 0.0 | |
| 449529064 | 1363 | PREDICTED: LOW QUALITY PROTEIN: uncharac | 0.941 | 0.703 | 0.660 | 0.0 | |
| 356558781 | 1328 | PREDICTED: uncharacterized ATP-dependent | 0.911 | 0.699 | 0.658 | 0.0 | |
| 357513937 | 1516 | Helicase sen1 [Medicago truncatula] gi|3 | 0.974 | 0.655 | 0.634 | 0.0 | |
| 224082154 | 1147 | predicted protein [Populus trichocarpa] | 0.731 | 0.649 | 0.706 | 0.0 | |
| 15234617 | 1311 | tRNA-splicing endonuclease positive effe | 0.902 | 0.701 | 0.591 | 0.0 |
| >gi|147779903|emb|CAN65841.1| hypothetical protein VITISV_009619 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1453 bits (3761), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 747/1076 (69%), Positives = 832/1076 (77%), Gaps = 83/1076 (7%)
Query: 1 MGSRGKLLFDLNEPPAEDDEENDRIFSSQPQKALPSANPHTSELFVASAAPQGIINNNAF 60
MGSRG+ LFDLNEPPAED+EEND +FS QPQKALPS N HT +LF S+ PQ I+NN+AF
Sbjct: 1 MGSRGRPLFDLNEPPAEDEEENDGVFSFQPQKALPSLNSHTPDLFSTSSGPQRILNNHAF 60
Query: 61 SHAPSVSGFQPFNRAKAAQGHGVEVEPKKAEDQNRRVASSSSKPGNGEDIKAASSSVPGS 120
+HA SVSGFQPF R K A VE K+A +QN + ASSS+ GNG++ A V
Sbjct: 61 THASSVSGFQPFVRPKGANVSEEPVEQKRAGNQNSKFASSSNA-GNGDETNAGLQLVSSP 119
Query: 121 ENAAADEREEGEWSDAEGSVDAYASNLLNEQGKASQG--QGVSEVVDT--------ATGV 170
+A A EREEGEWSD E S + Y S+ + EQ + G Q +SE +D
Sbjct: 120 ADAQAVEREEGEWSDDESSANVYGSSSMQEQSVSGSGKAQAMSEQMDYHASSVAAETLSC 179
Query: 171 DIKVPESSQDGSNSHGVLGSDQDPSDQKRNRSRHSEANIKGEKS-VDGQEEPCLLPKQRE 229
DIKV ES+++ +NSH + D D DQ+ N SR+SE N KG+ +DGQEEP L+PK +E
Sbjct: 180 DIKVFESTKEENNSHASVTLDPDTHDQRSNSSRNSEGNGKGDVGPMDGQEEPGLVPKLKE 239
Query: 230 IKGTEASHTTKGANNLGKR-KIDQQKEAMLGKKRNRQTVFLNLEDVKQAGSLKTSTPRRQ 288
+KG EAS K ANN GK+ K+DQ KEAMLGKKR RQTVFLNLEDVKQAG +KTSTPRRQ
Sbjct: 240 VKGVEASFAVKCANNPGKKHKLDQHKEAMLGKKRTRQTVFLNLEDVKQAGPMKTSTPRRQ 299
Query: 289 N--PPVVTRTVKEARTIPSPAERGGEKQSQAINKDQKQYDVSSCNEGGTS--VEALEPKP 344
N P+ TR VKE R++P PAER GEKQ+ ++ KDQKQ D+SS NEGG VE+ EPK
Sbjct: 300 NFPAPITTRIVKEIRSVPPPAERIGEKQNHSMIKDQKQVDLSS-NEGGGGNLVESNEPKS 358
Query: 345 ECNGDMNFGLPG------------------------------------------------ 356
E N DMN GL G
Sbjct: 359 ESNNDMNSGLLGRPRRLNSANDISAEVHPPTIPRQSSWKPTDSRQFKNSQFSGRKPSMIN 418
Query: 357 STDPKLGTKKHPPAKKQTATANLYQDTSVERLIREVTNEKFWHHPVVHVPPIRTLLRIVT 416
++ KL KKHPPAK QT ++ YQDTSVERLIREVTNEKFWHHP + R +L +
Sbjct: 419 QSESKLVNKKHPPAKMQTTVSSQYQDTSVERLIREVTNEKFWHHPDIS----RFVLNVAV 474
Query: 417 LKGHGKIYDAS----EESELQCVPGRFESVEEYVRVFEPLLFEECRAQLYSTWEELTETG 472
L YD S E+ELQCVPGRFESVEEY+RVFEPLLFEECRAQLYSTWEELTET
Sbjct: 475 LS-----YDISMFLNHETELQCVPGRFESVEEYIRVFEPLLFEECRAQLYSTWEELTETV 529
Query: 473 SRDTHVMVRIRNIERRERGWYDVIVLPVNECKWSFKEGDVAVLSTPRPGSVRGKRNHSLA 532
SRD H MVRI++IERRERGWYDVIVLP NECKW+FKEGDVA+LS PRPGSVR KRN++ +
Sbjct: 530 SRDLHAMVRIKSIERRERGWYDVIVLPANECKWTFKEGDVAILSAPRPGSVRSKRNNTSS 589
Query: 533 AEDDEEAEVSGRVAGTVRRHFPVDARDPPGAILHFYVGDSYDPSSSMDDDDHILRKLQPK 592
EDDEEAE+SGRVAGTVRRH P+D RDP GAILHFYVGDSYDP+S +DD HILRKL PK
Sbjct: 590 IEDDEEAEISGRVAGTVRRHNPIDTRDPVGAILHFYVGDSYDPNSKVDD--HILRKLHPK 647
Query: 593 GIWYLTVLGSLATTQREYVALHAFCRLNSQMQTAILKPSPEHFPKYEHQTPTMPECFTQN 652
GIWYLTVLGSLATTQREY+ALHAF RLN QMQTAIL PSPEHFPKYE Q P MPECFT N
Sbjct: 648 GIWYLTVLGSLATTQREYIALHAFRRLNLQMQTAILHPSPEHFPKYEEQPPAMPECFTPN 707
Query: 653 FIDHLHRTFNGPQLAAIQWAAIHTAAGTSSGMTK--SPWPFTLVQGPPGTGKTHTVWGML 710
F+++LH+TFNGPQLAAIQWAA+HTAAGTSSG+TK PWPFTLVQGPPGTGKTHTVWGML
Sbjct: 708 FVEYLHKTFNGPQLAAIQWAAMHTAAGTSSGVTKRQDPWPFTLVQGPPGTGKTHTVWGML 767
Query: 711 NVIHLVQYQHYYNSLLKKLAPESYKQPNESNSDNVSMGSIDEVLQNMDQNLLRTLPKLCP 770
NVIHLVQYQHYY +LLKK+APESYKQ NES SDNVSMGSIDEVLQ+MDQNL RTLPKLCP
Sbjct: 768 NVIHLVQYQHYYTALLKKVAPESYKQTNESTSDNVSMGSIDEVLQSMDQNLFRTLPKLCP 827
Query: 771 KPRMLVCAPSNAATDELLTRVLDRGFIDGEMKVYRPDVARVGVDSQTRAAQAVSVERRTE 830
KPRMLVCAPSNAATDELL RVLDRGFIDGEMKVYRPDVARVGVDSQTRAAQAVSVERRTE
Sbjct: 828 KPRMLVCAPSNAATDELLARVLDRGFIDGEMKVYRPDVARVGVDSQTRAAQAVSVERRTE 887
Query: 831 QLLVKSREEVIGWMHNLKGREAVLSQQIANLQRELNAAAFAVRSQGSVGVDPDVLMARDQ 890
QLLVK+R+E++GWMH LK R+A L QQ+ LQRELNAAA AVRSQGSVGVDPDVL+ARDQ
Sbjct: 888 QLLVKNRDEILGWMHQLKVRDAQLFQQMLCLQRELNAAAAAVRSQGSVGVDPDVLVARDQ 947
Query: 891 NRDTLLQNLAAAVENRDKVLVEMSRFHILEGRFRPGSNFNLEEARASLEASFANEAEIVF 950
NRDTLLQNLAA VE+RDK+LVEM+R ILE RFR GSNFNLEEARA+LEASFANEAEIVF
Sbjct: 948 NRDTLLQNLAAVVESRDKILVEMNRLVILESRFRSGSNFNLEEARANLEASFANEAEIVF 1007
Query: 951 TTVSSSGRKLFSRLTHGFDMVVIDEAAQASEVGVLPPLSLGAARCVLGGGSSAAPC 1006
TTVSSSGRKLFSRLTHGFDMVVIDEAAQASEV VLPPLSLGAARCVL G P
Sbjct: 1008 TTVSSSGRKLFSRLTHGFDMVVIDEAAQASEVAVLPPLSLGAARCVLVGDPQQLPA 1063
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225459354|ref|XP_002284214.1| PREDICTED: uncharacterized ATP-dependent helicase C29A10.10c-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255545656|ref|XP_002513888.1| splicing endonuclease positive effector sen1, putative [Ricinus communis] gi|223546974|gb|EEF48471.1| splicing endonuclease positive effector sen1, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356522392|ref|XP_003529830.1| PREDICTED: probable helicase senataxin-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449465617|ref|XP_004150524.1| PREDICTED: uncharacterized ATP-dependent helicase C29A10.10c-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449529064|ref|XP_004171521.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized ATP-dependent helicase C29A10.10c-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356558781|ref|XP_003547681.1| PREDICTED: uncharacterized ATP-dependent helicase C29A10.10c-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357513937|ref|XP_003627257.1| Helicase sen1 [Medicago truncatula] gi|355521279|gb|AET01733.1| Helicase sen1 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224082154|ref|XP_002306584.1| predicted protein [Populus trichocarpa] gi|222856033|gb|EEE93580.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|15234617|ref|NP_194739.1| tRNA-splicing endonuclease positive effector-related protein [Arabidopsis thaliana] gi|4938486|emb|CAB43845.1| putative protein [Arabidopsis thaliana] gi|7269910|emb|CAB81003.1| putative protein [Arabidopsis thaliana] gi|332660321|gb|AEE85721.1| tRNA-splicing endonuclease positive effector-related protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1019 | ||||||
| TAIR|locus:2126480 | 1311 | AT4G30100 [Arabidopsis thalian | 0.899 | 0.699 | 0.569 | 1e-258 | |
| TAIR|locus:2059088 | 1090 | AT2G19120 "AT2G19120" [Arabido | 0.757 | 0.708 | 0.644 | 5.8e-256 | |
| DICTYBASE|DDB_G0274399 | 967 | DDB_G0274399 "DNA2/NAM7 helica | 0.077 | 0.081 | 0.4 | 1.2e-27 | |
| DICTYBASE|DDB_G0285243 | 2069 | DDB_G0285243 "putative splicin | 0.219 | 0.108 | 0.266 | 3.4e-20 | |
| TAIR|locus:2130384 | 818 | MAA3 "MAGATAMA 3" [Arabidopsis | 0.067 | 0.084 | 0.420 | 1.5e-17 | |
| POMBASE|SPBC29A10.10c | 1944 | SPBC29A10.10c "tRNA-splicing e | 0.127 | 0.066 | 0.291 | 1.8e-14 | |
| POMBASE|SPAC6G9.10c | 1687 | sen1 "ATP-dependent 5' to 3' D | 0.211 | 0.128 | 0.298 | 1.8e-14 | |
| UNIPROTKB|G4NIZ8 | 2037 | MGG_02784 "DNA-binding protein | 0.212 | 0.106 | 0.296 | 2.7e-12 | |
| SGD|S000004422 | 2231 | SEN1 "Presumed helicase and su | 0.216 | 0.099 | 0.273 | 1.9e-10 | |
| UNIPROTKB|F1S0U6 | 2661 | SETX "Uncharacterized protein" | 0.097 | 0.037 | 0.330 | 3e-09 |
| TAIR|locus:2126480 AT4G30100 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2490 (881.6 bits), Expect = 1.0e-258, P = 1.0e-258
Identities = 564/991 (56%), Positives = 667/991 (67%)
Query: 53 GIINNNAFSHAPSVSGFQPFNRAKAAQGHGVEVEPKKAEDQ--NRRVASSSSKPGNGEDI 110
GI N N F+ P V+ N + +A + P ++D N RV S +S +
Sbjct: 21 GIDNVN-FNQQPQVT-IPSSNPSSSA----LLATPSSSQDNVNNNRVFSHASTVSGFQPF 74
Query: 111 KAASSSVPGSENAAADEREEGEWSDAEGSVDAYASNLLNEQGKASQGQGVSEVVDTATGV 170
V A ER+ E S E V + + N+ G + +G E ++
Sbjct: 75 VRP---VAAQHTDVAVERKVDEGSLEEAKVTSL--KVPNDVGAPEREEG--EWTESEVPA 127
Query: 171 DIKVPESSQDGS---NSHGVLGSD--QDPSDQKRNRSRHSEANIKGEKSVDGQEEPCLLP 225
+ V SS + +G LG D D + QK+N + SE++ K S+D +E L
Sbjct: 128 NDNVHSSSDYSTVTEKDNGTLGLDINSDSALQKKNVNHISESSGKDSGSIDSPQEQGLTV 187
Query: 226 KQREIKGTEASHTTKGANNLGKRKIDQQKEAMLGKKRNRQTVFLNLEDVKQAGSLKTSTP 285
+ RE KG EASH K AN KRK+D QKE MLGKKR+RQT+FLNL+DV+QAG +KT+TP
Sbjct: 188 RPRETKGVEASHAIKCANTTVKRKMDHQKETMLGKKRHRQTMFLNLDDVRQAGPIKTTTP 247
Query: 286 RRQN-P-PVVTRTVKEARTIPSPAERGGEKQSQAINKDQKQYDVSSCNEGGTSVEALEPK 343
RRQN P PVVTRTV+E+R P AE+ G + +DQK D+ + GG E EPK
Sbjct: 248 RRQNFPQPVVTRTVRESRAGPPTAEQAGGVPGHVVYRDQKPIDIPN---GGIHPETSEPK 304
Query: 344 PECNGDMNFGLPGST-------DP----------KLGTKKHPPAKKQTATAN-------L 379
E NG+ G G T P + G+ K P +Q + + L
Sbjct: 305 LESNGESQSGSAGKTRRMNGEAGPSAEATSTSVSRQGSWKQPINSRQLKSGHSSNRQVPL 364
Query: 380 YQDTSVERLIREVTNEKF--WHHPVVHVPPIR--TLLRIVTLKGHGKIYDASEESELQCV 435
TS + + N+KF + + + ++ R++ + K + E+++LQ V
Sbjct: 365 CSQTSADS---KFGNKKFTSFKKQATNSTQYQDTSVERLLREVTNEKFWHHPEDTDLQSV 421
Query: 436 PGRFESVEEYVRVFEPLLFEECRAQLYSTWEELTETGSRDTHVMVRIRNIERRERGWYDV 495
P RFES++EYVRVFEPLLFEECRAQLYSTWEEL E S ++ VRI+ IERRERGWYDV
Sbjct: 422 PERFESMDEYVRVFEPLLFEECRAQLYSTWEELAEANS---YMKVRIKFIERRERGWYDV 478
Query: 496 IVLPVNECKWSFKEGDVAVLSTPRPGSVRGKRNHSLAAEDDEEAEVSGRVAGTVRRHFPV 555
I+ VNECKW+FKEGDVAVLS P P S G+ H DD GRVAGTVRR+ PV
Sbjct: 479 ILNSVNECKWAFKEGDVAVLSNPVPES-EGE--H-----DDV-----GRVAGTVRRYIPV 525
Query: 556 DARDPPGAILHFYVGXXXXXXXXXXXXXHILRKLQPKGIWYLTVLGSLATTQREYVALHA 615
D RDP GAILHFYVG HILRKL+PK IW+LTVLGS+ATTQREYVALHA
Sbjct: 526 DTRDPHGAILHFYVGDAYDSGSKIDDN-HILRKLKPKEIWHLTVLGSIATTQREYVALHA 584
Query: 616 FCRLNSQMQTAILKPSPEHFPKYEHQTPTMPECFTQNFIDHLHRTFNGPQLXXXXXXXXX 675
F +LN QMQ AILKPSPE FP Y QTPT+P+CFT +F HLHR+FN PQL
Sbjct: 585 FSQLNPQMQNAILKPSPEQFPNYGEQTPTVPDCFTPSFAGHLHRSFNAPQLAAIHWAAMH 644
Query: 676 XXXGTSSGMTKS-PWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQHYYNSLLKKLAPESY 734
GTSSG+ + PWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQ YY SLLKKLAPESY
Sbjct: 645 TAAGTSSGVKRQDPWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQQYYTSLLKKLAPESY 704
Query: 735 KQPNESNSDNVSMGSIDEVLQNMDQNLLRTLPKLCPKPRMLVCAPSNAATDELLTRVLDR 794
KQ NES+SDN+ GSIDEVLQNMDQNL RTLPKLC KPRMLVCAPSNAATDELL+RVLDR
Sbjct: 705 KQVNESSSDNIVSGSIDEVLQNMDQNLFRTLPKLCAKPRMLVCAPSNAATDELLSRVLDR 764
Query: 795 GFIDGEMKVYRPDVARVGVDSQTRAAQAVSVERRTEQLLVKSREEVIGWMHNLKGREAVL 854
GFIDGEM+VYRPDVARVGVD+QT+AAQAVSVERR++ LL KSREE++G +HNL+ R+A L
Sbjct: 765 GFIDGEMRVYRPDVARVGVDTQTKAAQAVSVERRSDLLLAKSREEILGHIHNLRVRDAQL 824
Query: 855 SQQIANLQRELNAAAFAVRSQGSVGVDPDVLMARDQNRDTLLQNLAAAVENRDKVLVEMS 914
SQ IA L+REL AAAFA RSQGSVGVDPDVLM RDQ RD +LQ L+A VE RDK LVEMS
Sbjct: 825 SQDIAGLKRELTAAAFANRSQGSVGVDPDVLMVRDQTRDAMLQRLSAVVEARDKDLVEMS 884
Query: 915 RFHILEGRFRPGSNFNLEEARASLEASFANEAEIVFTTVSSSGRKLFSRLTHGFDMVVID 974
R I+EG+FR G++FNLEEARASLEASFANEAEIVFTTVSSSGRKLFSRLTHGFDMVVID
Sbjct: 885 RLLIVEGKFRAGTSFNLEEARASLEASFANEAEIVFTTVSSSGRKLFSRLTHGFDMVVID 944
Query: 975 EAAQASEVGVLPPLSLGAARCVLGGGSSAAP 1005
EAAQASEVGVLPPL+LGAARCVL G P
Sbjct: 945 EAAQASEVGVLPPLALGAARCVLVGDPQQLP 975
|
|
| TAIR|locus:2059088 AT2G19120 "AT2G19120" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0274399 DDB_G0274399 "DNA2/NAM7 helicase family protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0285243 DDB_G0285243 "putative splicing endonuclease" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130384 MAA3 "MAGATAMA 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC29A10.10c SPBC29A10.10c "tRNA-splicing endonuclease positive effector (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC6G9.10c sen1 "ATP-dependent 5' to 3' DNA/RNA helicase Sen1" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4NIZ8 MGG_02784 "DNA-binding protein SMUBP-2" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| SGD|S000004422 SEN1 "Presumed helicase and subunit of the Nrd1 complex (Nrd1p-Nab3p-Sen1p)" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S0U6 SETX "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1019 | |||
| pfam13086 | 220 | pfam13086, AAA_11, AAA domain | 1e-30 | |
| TIGR00376 | 637 | TIGR00376, TIGR00376, DNA helicase, putative | 8e-08 | |
| COG1112 | 767 | COG1112, COG1112, Superfamily I DNA and RNA helica | 8e-05 |
| >gnl|CDD|221912 pfam13086, AAA_11, AAA domain | Back alignment and domain information |
|---|
Score = 120 bits (302), Expect = 1e-30
Identities = 74/340 (21%), Positives = 112/340 (32%), Gaps = 134/340 (39%)
Query: 661 FNGPQLAAIQWAAIHTAAGTSSGMTKSPWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQH 720
N Q AI+ ++ S TL+QGPPGTGKT T+ ++ +
Sbjct: 2 LNDSQREAIK-----------KALSSSD--ITLIQGPPGTGKTTTIVEIIKQLLSNA--- 45
Query: 721 YYNSLLKKLAPESYKQPNESNSDNVSMGSIDEVLQNMDQNLLRTLPKLCPKPRMLVCAPS 780
P ++LVCAPS
Sbjct: 46 -------------------------------------------------PGKKVLVCAPS 56
Query: 781 NAATDELLTRVLDRGFIDGEMKVYRPDVARVGVDSQTRAAQAVSVERRTEQLLVKSREEV 840
N+A D +L R+L++ + + R+G S
Sbjct: 57 NSAVDNILERLLEQ--------KFGLKIVRIG-----------------------SPARE 85
Query: 841 IGWMHNLKGREAVLSQQIAN-LQRELNAAAFAVRSQGSVGVDPDVLMARDQNRDTLLQNL 899
I E VL + L+ + +R S+ + L + + ++ L
Sbjct: 86 I--------HEDVLQYSLEYLLEAKFEQLLKRIRKLKSLLEEKSKLKRERRKLRSEIKKL 137
Query: 900 AAAVENRDKVLVEMSRFHILEGRFRPGSNFNLEEARASLEASFANEAEIVFTTVSSSGRK 959
LE R S+ +EA++V TT+S +G
Sbjct: 138 ----------------------------KKELERLRKSIRKEILDEADVVCTTLSGAGSS 169
Query: 960 LFSRLTHGFDMVVIDEAAQASEVGVLPPLSLGAARCVLGG 999
L L FD+V+IDEAAQA+E L PL LG + VL G
Sbjct: 170 LLEGLKK-FDVVIIDEAAQATEPETLIPLLLGCKKVVLVG 208
|
This family of domains contain a P-loop motif that is characteristic of the AAA superfamily. Many of the proteins in this family are conjugative transfer proteins. Length = 220 |
| >gnl|CDD|232945 TIGR00376, TIGR00376, DNA helicase, putative | Back alignment and domain information |
|---|
| >gnl|CDD|224037 COG1112, COG1112, Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1019 | |||
| KOG1802 | 935 | consensus RNA helicase nonsense mRNA reducing fact | 100.0 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 100.0 | |
| KOG1803 | 649 | consensus DNA helicase [Replication, recombination | 100.0 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 100.0 | |
| KOG1805 | 1100 | consensus DNA replication helicase [Replication, r | 99.95 | |
| KOG1801 | 827 | consensus tRNA-splicing endonuclease positive effe | 99.9 | |
| KOG1807 | 1025 | consensus Helicases [Replication, recombination an | 99.88 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 99.63 | |
| COG1112 | 767 | Superfamily I DNA and RNA helicases and helicase s | 99.61 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 99.43 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 99.42 | |
| KOG1806 | 1320 | consensus DEAD box containing helicases [Replicati | 99.42 | |
| KOG1804 | 775 | consensus RNA helicase [RNA processing and modific | 99.32 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 99.31 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 99.2 | |
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 99.14 | |
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 99.09 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 99.06 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 99.05 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 99.02 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 98.93 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 98.86 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 98.83 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 98.77 | |
| TIGR01075 | 715 | uvrD DNA helicase II. Designed to identify uvrD me | 98.51 | |
| TIGR01074 | 664 | rep ATP-dependent DNA helicase Rep. Designed to id | 98.44 | |
| PRK10919 | 672 | ATP-dependent DNA helicase Rep; Provisional | 98.43 | |
| PRK11773 | 721 | uvrD DNA-dependent helicase II; Provisional | 98.42 | |
| TIGR01073 | 726 | pcrA ATP-dependent DNA helicase PcrA. Designed to | 98.39 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 98.39 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 98.21 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 98.2 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 97.91 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 97.65 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 97.56 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 97.42 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 97.38 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 97.33 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 97.29 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 97.2 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 97.2 | |
| PTZ00424 | 401 | helicase 45; Provisional | 97.19 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 97.06 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 97.05 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 96.89 | |
| COG0507 | 696 | RecD ATP-dependent exoDNAse (exonuclease V), alpha | 96.79 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 96.78 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 96.76 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 96.75 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 96.72 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 96.68 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 96.63 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 96.61 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 96.56 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 96.48 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 96.48 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 96.45 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 96.44 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 96.39 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 96.31 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 96.24 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 96.2 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 96.17 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 96.14 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 96.04 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 96.04 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 96.04 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 96.04 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 96.0 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 95.95 | |
| COG0210 | 655 | UvrD Superfamily I DNA and RNA helicases [DNA repl | 95.92 | |
| PTZ00110 | 545 | helicase; Provisional | 95.8 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 95.65 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 95.6 | |
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 95.58 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 95.57 | |
| PRK08181 | 269 | transposase; Validated | 95.55 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 95.5 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 95.43 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 95.38 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 95.36 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 95.31 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 95.29 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 95.27 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 95.26 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 95.1 | |
| TIGR02785 | 1232 | addA_Gpos recombination helicase AddA, Firmicutes | 95.06 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 94.99 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 94.95 | |
| TIGR00609 | 1087 | recB exodeoxyribonuclease V, beta subunit. All pro | 94.92 | |
| PRK12377 | 248 | putative replication protein; Provisional | 94.92 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 94.92 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 94.92 | |
| PRK06526 | 254 | transposase; Provisional | 94.66 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 94.64 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 94.61 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 94.6 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 94.59 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 94.58 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 94.51 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 94.49 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 94.4 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 94.36 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 94.27 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 94.25 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 94.23 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 94.21 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 94.14 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 94.12 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 94.12 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 93.96 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 93.96 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 93.94 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 93.9 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 93.87 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 93.84 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 93.84 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 93.75 | |
| PRK10876 | 1181 | recB exonuclease V subunit beta; Provisional | 93.73 | |
| KOG0651 | 388 | consensus 26S proteasome regulatory complex, ATPas | 93.72 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 93.72 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 93.69 | |
| PF05729 | 166 | NACHT: NACHT domain | 93.62 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 93.6 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 93.6 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 93.59 | |
| PRK08116 | 268 | hypothetical protein; Validated | 93.55 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 93.54 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 93.53 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 93.52 | |
| PRK06620 | 214 | hypothetical protein; Validated | 93.49 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 93.45 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 93.44 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 93.4 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 93.4 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 93.39 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 93.26 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 93.19 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 93.18 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 93.17 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 93.14 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 93.13 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 93.07 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 93.06 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 93.02 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 93.01 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 93.01 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 92.98 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 92.97 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 92.96 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 92.95 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 92.94 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 92.91 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 92.88 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 92.81 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 92.8 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 92.8 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 92.71 | |
| PRK08727 | 233 | hypothetical protein; Validated | 92.68 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 92.65 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 92.65 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 92.58 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 92.49 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 92.46 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 92.45 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 92.43 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 92.34 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 92.31 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 92.3 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 92.29 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 92.24 | |
| COG5192 | 1077 | BMS1 GTP-binding protein required for 40S ribosome | 92.2 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 92.17 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 92.13 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 92.09 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 92.08 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 92.05 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 92.05 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 92.04 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 92.04 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 91.94 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 91.89 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 91.86 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 91.83 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 91.78 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 91.76 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 91.74 | |
| PHA02624 | 647 | large T antigen; Provisional | 91.57 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 91.53 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 91.47 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 91.37 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 91.35 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 91.34 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 91.22 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 91.22 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 91.19 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 91.15 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 91.14 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 91.12 | |
| TIGR02773 | 1158 | addB_Gpos ATP-dependent nuclease subunit B. DNA re | 91.03 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 91.0 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 90.97 | |
| PHA02244 | 383 | ATPase-like protein | 90.95 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 90.93 | |
| COG0606 | 490 | Predicted ATPase with chaperone activity [Posttran | 90.84 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 90.83 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 90.79 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 90.77 | |
| PF13476 | 202 | AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V | 90.74 | |
| COG3973 | 747 | Superfamily I DNA and RNA helicases [General funct | 90.71 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 90.7 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 90.69 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 90.69 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 90.67 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 90.64 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 90.63 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 90.62 | |
| TIGR02784 | 1141 | addA_alphas double-strand break repair helicase Ad | 90.6 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 90.44 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 90.38 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 90.38 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 90.34 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 90.33 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 90.33 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 90.3 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 90.2 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 90.17 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 90.08 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 89.96 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 89.94 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 89.91 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 89.9 | |
| PF13173 | 128 | AAA_14: AAA domain | 89.87 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 89.68 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 89.63 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 89.54 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 89.51 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 89.5 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 89.47 | |
| PRK09087 | 226 | hypothetical protein; Validated | 89.39 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 89.38 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 89.36 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 89.31 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 89.21 | |
| PF12774 | 231 | AAA_6: Hydrolytic ATP binding site of dynein motor | 89.19 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 89.1 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 89.03 | |
| PHA02774 | 613 | E1; Provisional | 89.02 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 88.99 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 88.91 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 88.89 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 88.89 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 88.89 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 88.85 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 88.64 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 88.64 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 88.62 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 88.56 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 88.53 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 88.5 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 88.37 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 88.34 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 88.32 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 88.28 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 88.27 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 88.2 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 88.19 | |
| PF02492 | 178 | cobW: CobW/HypB/UreG, nucleotide-binding domain; I | 88.13 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 88.06 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 88.01 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 88.0 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 87.96 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 87.93 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 87.91 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 87.88 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 87.85 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 87.85 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 87.78 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 87.76 | |
| PF13479 | 213 | AAA_24: AAA domain | 87.67 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 87.61 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 87.54 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 87.53 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 87.44 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 87.43 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 87.42 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 87.42 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 87.36 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 87.34 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 87.3 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 87.25 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 87.23 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 87.08 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 87.07 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 87.07 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 87.02 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 87.01 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 86.97 | |
| KOG1132 | 945 | consensus Helicase of the DEAD superfamily [Replic | 86.91 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 86.9 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 86.87 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 86.74 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 86.74 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 86.73 | |
| PRK13909 | 910 | putative recombination protein RecB; Provisional | 86.72 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 86.71 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 86.64 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 86.59 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 86.57 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 86.56 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 86.55 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 86.53 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 86.5 | |
| CHL00206 | 2281 | ycf2 Ycf2; Provisional | 86.48 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 86.43 | |
| PRK03839 | 180 | putative kinase; Provisional | 86.43 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 86.42 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 86.4 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 86.37 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 86.3 | |
| KOG0354 | 746 | consensus DEAD-box like helicase [General function | 86.27 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 86.25 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 86.24 | |
| KOG0652 | 424 | consensus 26S proteasome regulatory complex, ATPas | 86.17 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 86.16 | |
| KOG1804 | 775 | consensus RNA helicase [RNA processing and modific | 86.15 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 86.12 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 86.01 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 85.98 | |
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 85.95 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 85.9 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 85.89 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 85.79 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 85.61 | |
| PRK13768 | 253 | GTPase; Provisional | 85.51 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 85.49 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 85.46 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 85.31 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 85.21 | |
| KOG1942 | 456 | consensus DNA helicase, TBP-interacting protein [R | 85.21 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 85.19 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 85.16 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 85.13 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 85.11 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 85.05 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 85.04 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 85.01 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 84.95 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 84.95 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 84.87 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 84.85 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 84.81 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 84.78 | |
| cd03112 | 158 | CobW_like The function of this protein family is u | 84.74 | |
| PLN02200 | 234 | adenylate kinase family protein | 84.72 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 84.69 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 84.69 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 84.68 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 84.65 | |
| PRK13764 | 602 | ATPase; Provisional | 84.64 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 84.63 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 84.56 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 84.51 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 84.47 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 84.46 | |
| PLN02459 | 261 | probable adenylate kinase | 84.45 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 84.44 | |
| PTZ00202 | 550 | tuzin; Provisional | 84.43 | |
| PF01745 | 233 | IPT: Isopentenyl transferase; InterPro: IPR002648 | 84.39 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 84.39 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 84.34 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 84.28 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 84.27 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 84.25 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 84.24 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 84.23 | |
| PF07088 | 484 | GvpD: GvpD gas vesicle protein; InterPro: IPR00978 | 84.15 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 84.11 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 84.06 | |
| KOG0739 | 439 | consensus AAA+-type ATPase [Posttranslational modi | 84.01 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 83.99 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 83.95 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 83.91 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 83.83 | |
| COG1074 | 1139 | RecB ATP-dependent exoDNAse (exonuclease V) beta s | 83.79 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 83.78 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 83.77 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 83.73 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 83.72 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 83.64 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 83.48 | |
| TIGR02688 | 449 | conserved hypothetical protein TIGR02688. Members | 83.31 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 83.24 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 83.23 | |
| KOG1970 | 634 | consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 | 83.22 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 83.17 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 83.11 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 83.1 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 82.9 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 82.8 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 82.8 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 82.74 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 82.73 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 82.71 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 82.67 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 82.59 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 82.59 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 82.59 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 82.45 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 82.44 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 82.43 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 82.38 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 82.34 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 82.34 | |
| PRK06696 | 223 | uridine kinase; Validated | 82.29 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 82.28 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 82.23 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 82.2 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 82.13 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 82.1 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 82.01 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 82.0 | |
| cd00876 | 160 | Ras Ras family. The Ras family of the Ras superfam | 81.95 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 81.95 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 81.9 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 81.81 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 81.79 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 81.79 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 81.72 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 81.54 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 81.44 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 81.34 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 81.34 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 81.31 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 81.29 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 81.29 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 81.26 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 81.25 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 81.24 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 81.17 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 81.08 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 81.04 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 81.01 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 81.0 | |
| PRK07667 | 193 | uridine kinase; Provisional | 80.96 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 80.77 | |
| KOG0990 | 360 | consensus Replication factor C, subunit RFC5 [Repl | 80.75 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 80.63 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 80.51 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 80.49 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 80.46 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 80.41 | |
| PF00519 | 432 | PPV_E1_C: Papillomavirus helicase; InterPro: IPR00 | 80.32 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 80.29 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 80.25 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 80.15 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 80.01 |
| >KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.1e-40 Score=377.19 Aligned_cols=386 Identities=25% Similarity=0.309 Sum_probs=236.9
Q ss_pred cccccCcccCCHHHHHHhhhHHHHHHHHHHHHHhHHHhhccCCCCceeEEE--EEEeeeccCCeEEEEEcccCccccCCC
Q 042849 431 ELQCVPGRFESVEEYVRVFEPLLFEECRAQLYSTWEELTETGSRDTHVMVR--IRNIERRERGWYDVIVLPVNECKWSFK 508 (1019)
Q Consensus 431 ~lk~IP~tF~S~~eY~~sFePLLLEE~rAqL~ss~ee~~~~~sr~~~~~v~--I~sve~~~~~fydV~v~~~~~~~~~~~ 508 (1019)
+...|-.+|.+..+|.++|-||.-.||.-+= .+.|... ...+.|+ +--.++ ..-||. .+.-.......
T Consensus 228 ~~~hv~~ry~da~~y~~vf~pliklea~ydk--~~Kes~~----q~~~tvRW~~gLnkk-~~a~f~---~~k~~~e~kl~ 297 (935)
T KOG1802|consen 228 EPPHVQLRYEDAYEYQNVFSPLIKLEADYDK--RLKESQT----QENGTVRWDIGLNKK-RLAYFT---LPKLDSELKLA 297 (935)
T ss_pred CCCcccccccchHHHhhhcchhhhhhhhhhh--hhhhhcc----cccceEEeeeccccc-eEEEEe---cCCCcchhccc
Confidence 5678889999999999999999999997653 2333221 1122222 111111 111221 11112234567
Q ss_pred CCCEEEEecCCCCCCCCcCCCCccccccccccccceEeeeeeeccccCCCCCCceEEEEEecccCCCCCCCCchhHHHhh
Q 042849 509 EGDVAVLSTPRPGSVRGKRNHSLAAEDDEEAEVSGRVAGTVRRHFPVDARDPPGAILHFYVGDSYDPSSSMDDDDHILRK 588 (1019)
Q Consensus 509 egDLVLLS~~kP~~~~~~~~~~~~~~d~~~~~~~g~v~g~v~~~~~v~~~~~~~~~vr~~v~~s~d~~~k~~~~~~~l~~ 588 (1019)
.||-+.|....-... .=..+|+|+.....+ .+...+.+++.. ++.
T Consensus 298 ~GdE~~L~y~~~~~~--------------~w~~~g~v~~~pd~~-----~dE~~lEl~~~~----~~p------------ 342 (935)
T KOG1802|consen 298 IGDEIRLTYSGGLVL--------------PWNGIGSVLKIPDNN-----GDEVKLELEFSQ----DPP------------ 342 (935)
T ss_pred cCCeeEEEecCCcCC--------------cccccceEEecCCCC-----cceeEEEeecCC----CCC------------
Confidence 788888876421100 001133444322211 122223333321 111
Q ss_pred cCCCceEEEEEecChhhHHHHHHHHhhcccCChHHHHhh-----cCCCCCCCCCcCCCCCCCCcccchhhHhhhccCCCh
Q 042849 589 LQPKGIWYLTVLGSLATTQREYVALHAFCRLNSQMQTAI-----LKPSPEHFPKYEHQTPTMPECFTQNFIDHLHRTFNG 663 (1019)
Q Consensus 589 L~~~s~w~l~kL~nLtT~~RE~~AL~~l~~~~~~l~~~I-----L~ps~~~~~~~~~~~~~~~~~~~~~l~~~L~~~LNe 663 (1019)
+....-+.+-++.+-+++.|++.||..|..-...+-.++ ..|....+ .....|. .|...--.+||.
T Consensus 343 ~e~~~~Ftvd~vwk~ts~drm~~alk~la~D~~~vs~y~y~klLgh~~~~~~-----~k~~LP~----~~s~~~lpkLN~ 413 (935)
T KOG1802|consen 343 IEVTHGFTVDFVWKSTSFDRMQLALKLLAVDEKKVSGYLYHKLLGHPVEDSS-----LKKLLPR----RFSVPNLPKLNA 413 (935)
T ss_pred cccccceEEEEEEcCccHHHHHHHHHHhhhccccchhhhhhHHhcCcchhhh-----hcccCch----hhcCCCchhhch
Confidence 123345777889999999999999998764332222222 22221110 0111222 111111257999
Q ss_pred HHHHHHHHHHHHhhcCCCCCCCCCCCCeeEEeCCCCCChhHHHHHHHHHHHHHhhhhhhhhhhhhcCcccccCCCCCCCC
Q 042849 664 PQLAAIQWAAIHTAAGTSSGMTKSPWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQHYYNSLLKKLAPESYKQPNESNSD 743 (1019)
Q Consensus 664 SQ~eAI~~Al~~~~~g~s~~~~k~~~~fsLIQGPPGTGKTkTI~~LL~~Lll~~~q~~~~sLlk~l~~~~~kq~~~~~s~ 743 (1019)
||..||..+| +++++|||||||||||-|++.||..+ + +
T Consensus 414 SQ~~AV~~VL--------------~rplsLIQGPPGTGKTvtsa~IVyhl--~----------~---------------- 451 (935)
T KOG1802|consen 414 SQSNAVKHVL--------------QRPLSLIQGPPGTGKTVTSATIVYHL--A----------R---------------- 451 (935)
T ss_pred HHHHHHHHHH--------------cCCceeeecCCCCCceehhHHHHHHH--H----------H----------------
Confidence 9999999887 46999999999999999999998632 1 0
Q ss_pred cccCCchhHHhhhhhhhhhccCCCCCCCCcEEEEecCchhHHHHHHHHHhcCcccCcccccCCcEEEEcCchhhhHHhhh
Q 042849 744 NVSMGSIDEVLQNMDQNLLRTLPKLCPKPRMLVCAPSNAATDELLTRVLDRGFIDGEMKVYRPDVARVGVDSQTRAAQAV 823 (1019)
Q Consensus 744 ~~~~g~~~e~~~~~~~n~~r~~~k~~~k~RILVCAPSNaAVDEll~RLl~~Gi~d~~g~~y~p~VVRiG~~s~~~~v~~v 823 (1019)
....+||||||||.|||+|+++|.+.|+ +|||+-..++...-.++
T Consensus 452 -------------------------~~~~~VLvcApSNiAVDqLaeKIh~tgL----------KVvRl~aksRE~~~S~v 496 (935)
T KOG1802|consen 452 -------------------------QHAGPVLVCAPSNIAVDQLAEKIHKTGL----------KVVRLCAKSREDIESDV 496 (935)
T ss_pred -------------------------hcCCceEEEcccchhHHHHHHHHHhcCc----------eEeeeehhhhhhccCCc
Confidence 0256899999999999999999998876 89999877654322222
Q ss_pred cHHHHHHHHHHhhHHHHHhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHhhhcCCCCCChhhhhhhhhhHHHHHHHHHHHH
Q 042849 824 SVERRTEQLLVKSREEVIGWMHNLKGREAVLSQQIANLQRELNAAAFAVRSQGSVGVDPDVLMARDQNRDTLLQNLAAAV 903 (1019)
Q Consensus 824 sLd~rv~~lL~k~~~~~~~~~~~L~~~~~~l~~~i~~L~~~L~~~~~a~rs~~s~~~d~~~l~~~d~~r~~Llq~L~~~~ 903 (1019)
+.-..... ++....---+.+..++++-.+ +...
T Consensus 497 s~L~lh~~---------------~~~~~~pELq~l~klkde~ge-----------------lS~s--------------- 529 (935)
T KOG1802|consen 497 SFLSLHEQ---------------LRNMDKPELQKLLKLKDEGGE-----------------LSSS--------------- 529 (935)
T ss_pred cHHHHHHH---------------HhccCcHHHHHHHhhhhhccc-----------------ccch---------------
Confidence 21111000 000000000111111111000 0000
Q ss_pred HhHHHHHHHHhhhhhhccccCCCCCchhHHHHHHHHHHHhccCcEEEEecccchhHHHhhhcCCCCEEEEcCCCCCCccc
Q 042849 904 ENRDKVLVEMSRFHILEGRFRPGSNFNLEEARASLEASFANEAEIVFTTVSSSGRKLFSRLTHGFDMVVIDEAAQASEVG 983 (1019)
Q Consensus 904 ~~r~k~L~elsrl~~l~~r~r~~~~~~l~~~r~~l~~~iL~eA~IV~sTlSssg~~ll~~l~~~FDvVIIDEAAQa~E~s 983 (1019)
....+.+..+..+..+|+.|+||||||.++|...+... .|.+|+||||.|++||+
T Consensus 530 -----------------------D~~k~~~lk~~~e~ell~~AdVIccTcv~Agd~rl~~~--kfr~VLiDEaTQatEpe 584 (935)
T KOG1802|consen 530 -----------------------DEKKYRKLKRAAEKELLNQADVICCTCVGAGDRRLSKF--KFRTVLIDEATQATEPE 584 (935)
T ss_pred -----------------------hhHHHHHHHHHHHHHHHhhcCEEEEecccccchhhccc--cccEEEEecccccCCcc
Confidence 00112344566788899999999999999998888774 89999999999999999
Q ss_pred cccccccCCCeEEEecCCCCCCCcccCccccccCCC
Q 042849 984 VLPPLSLGAARCVLGGGSSAAPCNSYQQGSRHLDVQ 1019 (1019)
Q Consensus 984 tLIPL~~g~kr~ILVGDpkQLPPtV~S~~Ak~lg~~ 1019 (1019)
+||||.+|+|++||||||+||-|+|+.+.|...||+
T Consensus 585 ~LiPlvlG~kq~VlVGDh~QLgpvi~~kK~a~Agl~ 620 (935)
T KOG1802|consen 585 CLIPLVLGAKQLVLVGDHKQLGPVIMCKKAATAGLS 620 (935)
T ss_pred hhhhhhhcceeEEEeccccccCceeeeHHHHHhHHH
Confidence 999999999999999999999999999999888863
|
|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >KOG1803 consensus DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >KOG1805 consensus DNA replication helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1801 consensus tRNA-splicing endonuclease positive effector (SEN1) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1807 consensus Helicases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >KOG1806 consensus DEAD box containing helicases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1804 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >TIGR01075 uvrD DNA helicase II | Back alignment and domain information |
|---|
| >TIGR01074 rep ATP-dependent DNA helicase Rep | Back alignment and domain information |
|---|
| >PRK10919 ATP-dependent DNA helicase Rep; Provisional | Back alignment and domain information |
|---|
| >PRK11773 uvrD DNA-dependent helicase II; Provisional | Back alignment and domain information |
|---|
| >TIGR01073 pcrA ATP-dependent DNA helicase PcrA | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >TIGR00609 recB exodeoxyribonuclease V, beta subunit | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PRK10876 recB exonuclease V subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >TIGR02773 addB_Gpos ATP-dependent nuclease subunit B | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A | Back alignment and domain information |
|---|
| >COG3973 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >PHA02774 E1; Provisional | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK13909 putative recombination protein RecB; Provisional | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >CHL00206 ycf2 Ycf2; Provisional | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >KOG0354 consensus DEAD-box like helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG1804 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >cd03112 CobW_like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02459 probable adenylate kinase | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PF07088 GvpD: GvpD gas vesicle protein; InterPro: IPR009788 This family consists of several archaeal GvpD gas vesicle proteins | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02688 conserved hypothetical protein TIGR02688 | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >cd00876 Ras Ras family | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF00519 PPV_E1_C: Papillomavirus helicase; InterPro: IPR001177 Papillomaviruses are a large family of DNA tumour viruses which give rise to warts in their host species | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1019 | ||||
| 2xzl_A | 802 | Upf1-Rna Complex Length = 802 | 2e-04 |
| >pdb|2XZL|A Chain A, Upf1-Rna Complex Length = 802 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1019 | |||
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 3e-26 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 1e-13 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 2e-24 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 4e-13 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 6e-22 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 1e-13 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-04 |
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 | Back alignment and structure |
|---|
Score = 114 bits (286), Expect = 3e-26
Identities = 70/429 (16%), Positives = 127/429 (29%), Gaps = 119/429 (27%)
Query: 435 VPGRFESVEEYVRVFEPLLFEECRAQLYSTWEELTETGSRDTHVMVRIRNIERRERGWYD 494
+ R+E +Y +F PL+ E ++L E+ ++D ++ VR ++R Y
Sbjct: 2 LGSRYEDAYQYQNIFGPLVKLEADYD-----KKLKESQTQD-NITVRWDLGLNKKRIAY- 54
Query: 495 VIVLPVNECKWSFKEGDVAVLSTPRPGSVRGKRNHSLAAEDDEEAEVSGRVAGTVRRHFP 554
LP + +GD L + + G V P
Sbjct: 55 -FTLPKTDSDMRLMQGDEICLRYK--------------GDLAPLWKGIGHV-----IKVP 94
Query: 555 VDARDPPGAILHFYVGDSYDPSSSMDDDDHILRKLQPKGIWYLTVLGSLATTQREYVALH 614
+ D L VG + + + + + + + R AL
Sbjct: 95 DNYGDEIAIELRSSVGAPVEVTHN----------------FQVDFVWKSTSFDRMQSALK 138
Query: 615 AFCRLNSQMQTAILKPSPEHFPKYEHQTPTMPECFTQNFIDHLHRTFNGPQLAAIQWAAI 674
F + + I H + +P+ FT + L N Q+ A++
Sbjct: 139 TFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDL----NHSQVYAVKTVLQ 194
Query: 675 HTAAGTSSGMTKSPWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQHYYNSLLKKLAPESY 734
P +L+QGPPGTGKT T
Sbjct: 195 R--------------PLSLIQGPPGTGKTVTS---------------------------- 212
Query: 735 KQPNESNSDNVSMGSIDEVLQNMDQNLLRTLPKLCPKPRMLVCAPSNAATDELLTRVLDR 794
V Q L VCAPSN A D+L ++
Sbjct: 213 ---------------ATIVYHLARQGNGPVL----------VCAPSNIAVDQLTEKIHQT 247
Query: 795 G-----FIDGEMKVYRPDVARVGVDSQTRAAQAVSVERRTEQLLVKSREEVIGWMHNLKG 849
G + V+ + + +Q R ++ ++ +QL ++ E +
Sbjct: 248 GLKVVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSSADEKRYRA 307
Query: 850 REAVLSQQI 858
+ +++
Sbjct: 308 LKRTAEREL 316
|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1019 | |||
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 100.0 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 100.0 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 100.0 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 100.0 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 99.46 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 99.43 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 99.27 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 99.17 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 99.09 | |
| 1uaa_A | 673 | REP helicase, protein (ATP-dependent DNA helicase | 98.65 | |
| 1pjr_A | 724 | PCRA; DNA repair, DNA replication, SOS response, h | 98.51 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 98.19 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 98.11 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 98.04 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 97.98 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 97.96 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 97.91 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 97.87 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 97.86 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 97.81 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 97.81 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 97.81 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 97.79 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 97.73 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 97.72 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 97.71 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 97.71 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 97.68 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 97.63 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 97.62 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 97.6 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 97.57 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 97.53 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 97.51 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 97.51 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 97.44 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 97.43 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 97.41 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 97.4 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 97.39 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 97.32 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 97.31 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 97.31 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 97.21 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 97.19 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 97.12 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 97.11 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 97.09 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 97.09 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 97.03 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 97.03 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 96.99 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 96.96 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 96.91 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 96.88 | |
| 3u4q_A | 1232 | ATP-dependent helicase/nuclease subunit A; helicas | 96.87 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 96.8 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 96.78 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 96.66 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 96.62 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 96.61 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 96.6 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 96.52 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 96.46 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 96.44 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 96.35 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 96.31 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 96.31 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 96.28 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 96.04 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 96.04 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 95.96 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 95.9 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 95.81 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 95.65 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 95.64 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 95.62 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 95.58 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 95.37 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 95.36 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 95.32 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 95.32 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 95.12 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 95.11 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 95.02 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 94.94 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 94.87 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 94.86 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 94.78 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 94.74 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 94.71 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 94.66 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 94.63 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 94.61 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 94.57 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 94.55 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 94.55 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 94.52 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 94.51 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 94.48 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 94.43 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 94.43 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 94.37 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 94.29 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 94.23 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 94.18 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 94.15 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 94.15 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 94.12 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 94.11 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 94.1 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 94.1 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 94.08 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 94.05 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 94.03 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 93.99 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 93.84 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 93.83 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 93.81 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 93.8 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 93.71 | |
| 2zpa_A | 671 | Uncharacterized protein YPFI; RNA modification enz | 93.67 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 93.65 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 93.64 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 93.57 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 93.55 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 93.54 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 93.51 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 93.5 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 93.49 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 93.48 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 93.46 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 93.45 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 93.43 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 93.4 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 93.35 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 93.34 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 93.33 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 93.29 | |
| 1w36_B | 1180 | RECB, exodeoxyribonuclease V beta chain; recombina | 93.2 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 93.16 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 93.1 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 93.06 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 93.05 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 93.01 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 92.98 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 92.94 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 92.8 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 92.77 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 92.69 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 92.39 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 92.31 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 92.27 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 92.09 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 92.03 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 91.98 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 91.87 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 91.76 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 91.71 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 91.5 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 91.27 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 91.11 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 91.06 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 91.02 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 90.9 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 90.88 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 90.86 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 90.83 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 90.76 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 90.7 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 90.64 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 90.55 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 90.46 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 90.42 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 90.39 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 90.37 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 90.15 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 90.14 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 90.13 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 90.01 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 89.87 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 89.64 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 89.64 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 89.52 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 89.48 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 89.39 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 89.38 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 89.35 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 89.31 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 89.17 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 89.17 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 89.13 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 89.03 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 89.0 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 88.94 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 88.89 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 88.81 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 88.79 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 88.61 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 88.54 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 88.53 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 88.52 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 88.51 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 88.47 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 88.45 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 88.45 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 88.41 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 88.35 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 88.35 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 88.34 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 88.31 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 88.3 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 88.3 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 88.28 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 88.26 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 88.11 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 88.01 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 88.0 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 87.88 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 87.87 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 87.84 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 87.56 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 87.46 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 87.32 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 87.27 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 87.25 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 87.12 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 86.92 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 86.84 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 86.83 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 86.72 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 86.7 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 86.55 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 86.46 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 86.38 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 86.38 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 86.37 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 86.34 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 86.19 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 86.18 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 86.05 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 86.0 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 85.99 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 85.98 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 85.97 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 85.97 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 85.62 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 85.55 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 85.54 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 85.46 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 85.44 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 85.41 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 85.27 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 85.26 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 85.07 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 85.01 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 85.0 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 84.99 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 84.92 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 84.88 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 84.88 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 84.87 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 84.87 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 84.83 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 84.75 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 84.71 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 84.71 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 84.5 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 84.44 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 84.41 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 84.19 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 84.19 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 84.18 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 84.13 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 84.11 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 84.1 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 83.92 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 83.74 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 83.66 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 83.65 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 83.61 | |
| 3u4q_B | 1166 | ATP-dependent helicase/deoxyribonuclease subunit; | 83.52 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 83.51 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 83.48 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 83.36 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 83.36 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 83.18 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 83.17 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 82.87 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 82.67 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 82.4 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 82.29 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 82.2 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 82.13 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 82.05 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 82.02 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 81.77 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 81.76 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 81.57 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 81.5 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 81.45 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 81.43 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 80.85 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 80.69 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 80.66 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 80.56 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 80.33 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 80.06 |
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
Probab=100.00 E-value=2.1e-40 Score=400.07 Aligned_cols=395 Identities=22% Similarity=0.267 Sum_probs=235.7
Q ss_pred CHHHHHHhhhHHHHHHHHHHHHHhHHHhhccC-----CCCcee-EEEEEEeeeccCCeEEEEEcccC--c----cccCCC
Q 042849 441 SVEEYVRVFEPLLFEECRAQLYSTWEELTETG-----SRDTHV-MVRIRNIERRERGWYDVIVLPVN--E----CKWSFK 508 (1019)
Q Consensus 441 S~~eY~~sFePLLLEE~rAqL~ss~ee~~~~~-----sr~~~~-~v~I~sve~~~~~fydV~v~~~~--~----~~~~~~ 508 (1019)
|+++|++.|.+||-.|..+++....+...... .+..++ .+.+...+....|-+.+.+.... . ....|.
T Consensus 3 ~~~~~~~~~~~Ll~~E~~~e~~~~~~~~~~~~~~~~~~~G~~~~~l~~~~~~~~~~g~~~~~~~~~~~~~~~~l~~~~~~ 82 (646)
T 4b3f_X 3 AVESFVTKQLDLLELERDAEVEERRSWQENISLKELQSRGVCLLKLQVSSQRTGLYGRLLVTFEPRRYGSAAALPSNSFT 82 (646)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSCHHHHGGGTSEEEEEEEEEEEECSSSCEEEEEEESCC---CCCCCCCCC
T ss_pred hHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCHHHHHhCCceecceEEEEEEecCCCeEEEEEEecCCCCCCCCccCCCC
Confidence 68999999999999999998877665543221 112221 23333333222343444443211 1 123689
Q ss_pred CCCEEEEecCCCCCCCCcCCCCccccccccccccceEeeeeeeccccCCCCCCceEEEEEecccCCCCCCCCchhHHHhh
Q 042849 509 EGDVAVLSTPRPGSVRGKRNHSLAAEDDEEAEVSGRVAGTVRRHFPVDARDPPGAILHFYVGDSYDPSSSMDDDDHILRK 588 (1019)
Q Consensus 509 egDLVLLS~~kP~~~~~~~~~~~~~~d~~~~~~~g~v~g~v~~~~~v~~~~~~~~~vr~~v~~s~d~~~k~~~~~~~l~~ 588 (1019)
.||+|+|+...+.. ... ..|.|.+... ..+.|.+ ....+. ...
T Consensus 83 ~Gd~v~~~~~~~~~---------------~~~----~~g~v~~~~~------~~i~v~~--~~~~~~----------~~~ 125 (646)
T 4b3f_X 83 SGDIVGLYDAANEG---------------SQL----ATGILTRVTQ------KSVTVAF--DESHDF----------QLS 125 (646)
T ss_dssp TTCEEEEEETTTTS---------------CCC----EEEEEEEEET------TEEEEEC--C-----------------C
T ss_pred CCCEEEEEecCCCC---------------Cce----EEEEEEEEeC------CEEEEEE--CCcccc----------ccc
Confidence 99999998765431 011 1233332110 1123332 111110 012
Q ss_pred cCCCceEEEEEecChhhHHHHHHHHhhcccCC----hHHHHhhcCCCCCCCCCcCCCCCCCCcccchhhHhhhccCCChH
Q 042849 589 LQPKGIWYLTVLGSLATTQREYVALHAFCRLN----SQMQTAILKPSPEHFPKYEHQTPTMPECFTQNFIDHLHRTFNGP 664 (1019)
Q Consensus 589 L~~~s~w~l~kL~nLtT~~RE~~AL~~l~~~~----~~l~~~IL~ps~~~~~~~~~~~~~~~~~~~~~l~~~L~~~LNeS 664 (1019)
+.....|.+.++.|.+|+.|++.||..+.... ..+.+.||.-.+..+. . ... ...++...||++
T Consensus 126 ~~~~~~~~~~~~~~~~~~~r~~~al~~l~~~~~~~~~~l~~~l~~~~~p~~~---~--~~~-------~~~~~~~~LN~~ 193 (646)
T 4b3f_X 126 LDRENSYRLLKLANDVTYRRLKKALIALKKYHSGPASSLIEVLFGRSAPSPA---S--EIH-------PLTFFNTCLDTS 193 (646)
T ss_dssp CCSSCCEEEEEECCHHHHHHHHHHHHHHHTCCSSTTHHHHHHHTTSSCCCCC---C--CCC-------CCCCSSTTCCHH
T ss_pred cCCCCcEEEEEeccchHHHHHHHHHHHhhhcccCchHHHHHHHcCCCCCCCc---c--ccC-------cccccCCCCCHH
Confidence 33456799999999999999999999986543 2355666643211100 0 000 022345789999
Q ss_pred HHHHHHHHHHHhhcCCCCCCCCCCCCeeEEeCCCCCChhHHHHHHHHHHHHHhhhhhhhhhhhhcCcccccCCCCCCCCc
Q 042849 665 QLAAIQWAAIHTAAGTSSGMTKSPWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQHYYNSLLKKLAPESYKQPNESNSDN 744 (1019)
Q Consensus 665 Q~eAI~~Al~~~~~g~s~~~~k~~~~fsLIQGPPGTGKTkTI~~LL~~Lll~~~q~~~~sLlk~l~~~~~kq~~~~~s~~ 744 (1019)
|.+||..|+. ..+++|||||||||||+||+.+|..++ +
T Consensus 194 Q~~AV~~al~-------------~~~~~lI~GPPGTGKT~ti~~~I~~l~------------~----------------- 231 (646)
T 4b3f_X 194 QKEAVLFALS-------------QKELAIIHGPPGTGKTTTVVEIILQAV------------K----------------- 231 (646)
T ss_dssp HHHHHHHHHH-------------CSSEEEEECCTTSCHHHHHHHHHHHHH------------H-----------------
T ss_pred HHHHHHHHhc-------------CCCceEEECCCCCCHHHHHHHHHHHHH------------h-----------------
Confidence 9999999883 247999999999999999999886431 1
Q ss_pred ccCCchhHHhhhhhhhhhccCCCCCCCCcEEEEecCchhHHHHHHHHHhcCcccCcccccCCcEEEEcCchhh-hHHhhh
Q 042849 745 VSMGSIDEVLQNMDQNLLRTLPKLCPKPRMLVCAPSNAATDELLTRVLDRGFIDGEMKVYRPDVARVGVDSQT-RAAQAV 823 (1019)
Q Consensus 745 ~~~g~~~e~~~~~~~n~~r~~~k~~~k~RILVCAPSNaAVDEll~RLl~~Gi~d~~g~~y~p~VVRiG~~s~~-~~v~~v 823 (1019)
.+.+||||||||.|||++++||... ..+++|+|...+. ..+...
T Consensus 232 -------------------------~~~~ILv~a~TN~AvD~i~erL~~~----------~~~ilRlG~~~r~~~~~~~~ 276 (646)
T 4b3f_X 232 -------------------------QGLKVLCCAPSNIAVDNLVERLALC----------KQRILRLGHPARLLESIQQH 276 (646)
T ss_dssp -------------------------TTCCEEEEESSHHHHHHHHHHHHHT----------TCCEEECSCCSSCCHHHHTT
T ss_pred -------------------------CCCeEEEEcCchHHHHHHHHHHHhc----------CCceEEecchhhhhhhhhhh
Confidence 2579999999999999999999754 3489999998764 345556
Q ss_pred cHHHHHHHHHHhhHHHHHhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHhhhcCCCCCChhhhhhhhhhHHHHHHHHHHHH
Q 042849 824 SVERRTEQLLVKSREEVIGWMHNLKGREAVLSQQIANLQRELNAAAFAVRSQGSVGVDPDVLMARDQNRDTLLQNLAAAV 903 (1019)
Q Consensus 824 sLd~rv~~lL~k~~~~~~~~~~~L~~~~~~l~~~i~~L~~~L~~~~~a~rs~~s~~~d~~~l~~~d~~r~~Llq~L~~~~ 903 (1019)
+++..+... + .. ..+..+++++.... .......+. ......+.. +..+.+
T Consensus 277 ~l~~~~~~~------~-------~~-------~~~~~~~~~~~~~~----~~~~~~~~~---~~~~~~~~~-~~~l~~-- 326 (646)
T 4b3f_X 277 SLDAVLARS------D-------SA-------QIVADIRKDIDQVF----VKNKKTQDK---REKSNFRNE-IKLLRK-- 326 (646)
T ss_dssp BHHHHHTTT------T-------CS-------STHHHHHHHHTTSS----TTTTC---------CCSSHHH-HHHHHH--
T ss_pred hHHHHHhhc------h-------HH-------HHHHHHHHHHHHHH----HhhhhhhhH---HHHHHHHHH-HHHHHH--
Confidence 666533210 0 00 00111111111100 000000000 000000000 000000
Q ss_pred HhHHHHHHHHhhhhhhccccCCCCCchhHHHHHHHHHHHhccCcEEEEecccchhHHHhh--hcCCCCEEEEcCCCCCCc
Q 042849 904 ENRDKVLVEMSRFHILEGRFRPGSNFNLEEARASLEASFANEAEIVFTTVSSSGRKLFSR--LTHGFDMVVIDEAAQASE 981 (1019)
Q Consensus 904 ~~r~k~L~elsrl~~l~~r~r~~~~~~l~~~r~~l~~~iL~eA~IV~sTlSssg~~ll~~--l~~~FDvVIIDEAAQa~E 981 (1019)
.+...+......++..++|||+|+++++...... ....||+||||||+|+.|
T Consensus 327 --------------------------~l~~~~~~~~~~~l~~~~vv~~t~~~a~~~~~~~~~~~~~Fd~vIIDEAsQ~~e 380 (646)
T 4b3f_X 327 --------------------------ELKEREEAAMLESLTSANVVLATNTGASADGPLKLLPESYFDVVVIDECAQALE 380 (646)
T ss_dssp --------------------------HHHHHHHHHHHHHHHHCSEEEEETTTTCSSSGGGGSCTTCCSEEEETTGGGSCH
T ss_pred --------------------------HHHHHHHHHHHHHHhhcceeeeehhhhhhhhHHHhhhhccCCEEEEcCccccch
Confidence 0111223344457889999999999987643221 135799999999999999
Q ss_pred cccccccccCCCeEEEecCCCCCCCcccCccccccCC
Q 042849 982 VGVLPPLSLGAARCVLGGGSSAAPCNSYQQGSRHLDV 1018 (1019)
Q Consensus 982 ~stLIPL~~g~kr~ILVGDpkQLPPtV~S~~Ak~lg~ 1018 (1019)
+++|+||. +++|+||||||+||||+|.|..|...|+
T Consensus 381 ~~~lipL~-~~~~~ILVGD~~QLpP~v~~~~a~~~gl 416 (646)
T 4b3f_X 381 ASCWIPLL-KARKCILAGDHKQLPPTTVSHKAALAGL 416 (646)
T ss_dssp HHHTTTGG-GSSEEEEEECTTSCCCCCSCHHHHHTTT
T ss_pred HHHHhhcc-ccceEEEcCCccccCceecchhhhhccc
Confidence 99999995 5799999999999999999999988776
|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1019 | |||
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 99.74 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 99.34 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 99.02 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 98.13 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 98.06 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 98.04 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 97.98 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 97.67 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 97.57 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 97.41 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 96.99 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 96.98 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 96.93 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 96.88 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 96.81 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 96.67 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 96.46 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 96.44 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 96.43 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 96.41 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.33 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 96.3 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 96.23 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 96.07 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 96.02 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 95.97 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 95.85 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 95.84 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 95.77 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 95.56 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 95.38 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 95.38 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.29 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 95.24 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 95.17 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 95.11 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 94.85 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 94.78 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 94.76 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 94.73 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 94.71 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 94.7 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 94.65 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 94.5 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 94.48 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 94.48 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 94.45 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 94.42 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 94.3 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 94.27 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 94.27 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 93.99 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 93.95 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 93.63 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 93.61 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 93.61 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 93.49 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 93.47 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 93.34 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 93.32 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 93.24 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 93.2 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 93.19 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 93.16 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 93.15 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 92.87 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 92.76 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 92.73 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 92.65 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 92.55 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 92.46 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 92.45 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 92.39 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 92.1 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 92.09 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 92.02 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 91.98 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 91.89 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 91.7 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 91.29 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 91.13 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 91.11 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 91.07 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 90.85 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 90.8 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 90.72 | |
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 90.62 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 90.57 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 90.56 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 90.49 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 89.91 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 89.91 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 89.89 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 89.87 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 89.49 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 89.41 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 88.85 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 88.72 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 88.64 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 88.55 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 88.11 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 87.59 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 87.43 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 86.84 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 86.74 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 86.62 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 86.52 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 86.36 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 86.16 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 85.73 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 85.51 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 85.41 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 84.6 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 83.9 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 83.17 | |
| d1t5la1 | 413 | Nucleotide excision repair enzyme UvrB {Bacillus c | 82.3 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 81.54 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 81.33 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 81.17 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 80.99 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 80.66 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 80.57 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 80.47 |
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Exodeoxyribonuclease V alpha chain (RecD) species: Escherichia coli [TaxId: 562]
Probab=99.74 E-value=8.9e-19 Score=195.35 Aligned_cols=69 Identities=26% Similarity=0.249 Sum_probs=56.1
Q ss_pred CCChHHHHHHHHHHHHhhcCCCCCCCCCCCCeeEEeCCCCCChhHHHHHHHHHHHHHhhhhhhhhhhhhcCcccccCCCC
Q 042849 660 TFNGPQLAAIQWAAIHTAAGTSSGMTKSPWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQHYYNSLLKKLAPESYKQPNE 739 (1019)
Q Consensus 660 ~LNeSQ~eAI~~Al~~~~~g~s~~~~k~~~~fsLIQGPPGTGKTkTI~~LL~~Lll~~~q~~~~sLlk~l~~~~~kq~~~ 739 (1019)
.+++.|..||..|+ .++|++|+||||||||+|+..++..|...
T Consensus 148 ~~~~~Q~~A~~~al--------------~~~~~vI~G~pGTGKTt~i~~~l~~l~~~----------------------- 190 (359)
T d1w36d1 148 DEINWQKVAAAVAL--------------TRRISVISGGPGTGKTTTVAKLLAALIQM----------------------- 190 (359)
T ss_dssp TSCCHHHHHHHHHH--------------TBSEEEEECCTTSTHHHHHHHHHHHHHHT-----------------------
T ss_pred ccccHHHHHHHHHH--------------cCCeEEEEcCCCCCceehHHHHHHHHHHH-----------------------
Confidence 46889999999887 24899999999999999999988754210
Q ss_pred CCCCcccCCchhHHhhhhhhhhhccCCCCCCCCcEEEEecCchhHHHHHHHHH
Q 042849 740 SNSDNVSMGSIDEVLQNMDQNLLRTLPKLCPKPRMLVCAPSNAATDELLTRVL 792 (1019)
Q Consensus 740 ~~s~~~~~g~~~e~~~~~~~n~~r~~~k~~~k~RILVCAPSNaAVDEll~RLl 792 (1019)
....+.+|++|||||.|++++.+++.
T Consensus 191 ---------------------------~~~~~~~I~l~ApTgkAA~~L~e~~~ 216 (359)
T d1w36d1 191 ---------------------------ADGERCRIRLAAPTGKAAARLTESLG 216 (359)
T ss_dssp ---------------------------CSSCCCCEEEEBSSHHHHHHHHHHHT
T ss_pred ---------------------------HhccCCeEEEecCcHHHHHHHHHHHH
Confidence 01236799999999999999988874
|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|