Citrus Sinensis ID: 042884


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610----
NVKIRDGSKLLQSMGSLPSLNTLYLKHNNFTGTATTTTQELHNFTNLEYSTLSGSSLHISLLQSIASLFPSLKNLSMSYCEVNGVVRGQGFPHFKSLEHLNMERARIAPNTSFLQIIGESTPSLKYLSLSDFTLSTNSSRILDRGLCSLMHLQELYKVNNDLRGSLPWCVANMTSLRILDVSSNQLTGSIASSPLAHLTSIEELHLSDNHFRIPISLEPLFNHSRLKIFDAENNELNAEITESYSLTTPNFQLQYLLLSSGYGDGATFPKFLYHQHDLEYVDLSHTKMNGEFPNWLLENNTKLKTLFLVNDSLAGPFRLPIHSHKRLRQLDVSNNNFQGHIPLEIGDILPNLISFNISMNALDGSIPSSFGNINLLKILDLSNNQLTGEIPEHLAVGCVYLDFLALSNNSLEGKVLSLLSGLDLSCNKLIGHIPPQIGNLTRIQTLNLSHNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSLAFNNLSGEIPEWKAQFATFNESSYEGNTFLCGLPLPICRSPATTPEASIGNERDDNLIDMDNFFITFTTSYVIVIFGIVVVLYVNPYWRCRWFYFVEMWITSCYYFVVDNLIPTRFCH
cccccccccccHHccccccccEEEccccccccccccccccccccccccEEEccccccccccHHHHHHccccccEEEccccccEEEEccccccccccccEEEccccccccccccccccccccccccEEccccccccccccccccccccccccccEEEcccccccccccHHHHHcccccEEEccccccccccccccccccccccEEEccccccEEccccccccccccccEEEccccccEEEccccHHcccccccccEEEccccccccccccHHHcccccccEEEcccccccccccccHHcccccccEEEccccEEEEEccccccccccccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccccEEEccccccccccHHHHHHcccccEEEEEEEccccccccccccEEEccccccccccHHHHHccccccccccccccccccccHHHHccccccEEccccccccccccHHHHcccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHEEEEEEEEEEEEcccccc
cccccccccccHHHcccccccEEEcccccccccccccHHHHcccccccEEEcccccccccccHHHHHHHHHccEEEcccccccccccHHHHHccccccEEEEcccccccccccccccccccccccEEEEccccccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEEccccccccccHHHHHccccccEEEEccccccccccHHHHcccccccEEEcccccccccccHHHcccccccccEEEEEcccccccccccHHHccccccEEEEEccccccccccHHHHHccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHHHHHHcccEEEcccccccccccHHHcccccccEEEEccccccccccHHHHHHcccccEEEcccccccccccccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccccccccccHcccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccc
nvkirdgskllqsmgslpslntlylkhnnftgtattTTQELhnftnleystlsgSSLHISLLQSIASLFPslknlsmsycevngvvrgqgfphfkslehlnmerariapntsFLQIIGestpslkylslsdftlstnssrilDRGLCSLMHLQELYKVNndlrgslpwcVANMTSlrildvssnqltgsiassplahltsieelhlsdnhfripisleplfnhsrlkifdAENNELNAEitesyslttpnFQLQYLLLSsgygdgatfpkflyhqhdleyvdlshtkmngefpnwllenntkLKTLFLVNdslagpfrlpihshkrlrqldvsnnnfqghipleigdilpnlisfnismnaldgsipssfgniNLLKILdlsnnqltgeipehlaVGCVYLDFLALSNNSLEGKVLSLLSGldlscnklighippqignltRIQTLNlshnnltglipstfsnlkhiESLDLSYnklngkiphqlVELKTLEVFSLAFNNlsgeipewKAQFATfnessyegntflcglplpicrspattpeasignerddnlidmdnfFITFTTSYVIVIFGIVVVLYVNPYWRCRWFYFVEMWITSCYYFVvdnliptrfch
nvkirdgskllqsmgslpSLNTLYLKHNNFTGTATTTTQELHNFTNLEYSTLSGSSLHISLLQSIASLFPSLKNLSMSYCEVNGVVRGQGFPHFKSLEHLNMERARIAPNTSFLQIIGESTPSLKYLSLSDFTLSTNSSRILDRGLCSLMHLQELYKVNNDLRGSLPWCVANMTSLRILDVSSNQLTGSIASSPLAHLTSIEELHLSDNHFRIPISLEPLFNHSRLKIFDAENNELNAEITESYSLTTPNFQLQYLLLSSGYGDGATFPKFLYHQHDLEYVDLSHTKMNGEFPNWLLENNTKLKTLFLVNDSLAGPFRLPIHSHKRLRQLDVSNNNFQGHIPLEIGDILPNLISFNISMNALDGSIPSSFGNINLLKILDLSNNQLTGEIPEHLAVGCVYLDFLALSNNSLEGKVLSLLSGLDLSCNKLIGHIPPQIGNLTRIQTLNLSHNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSLAFNNLSGEIPEWKAQFATFNESSYEGNTFLCGLPLPICRSPATTPEASIGNERDDNLIDMDNFFITFTTSYVIVIFGIVVVLYVNPYWRCRWFYFVEMWITSCYYFVVDNLIPTRFCH
NVKIRDGSKLLQSMGSLPSLNTLYLKHNNFtgtattttQELHNFTNLEYSTLSGSSLHISLLQSIASLFPSLKNLSMSYCEVNGVVRGQGFPHFKSLEHLNMERARIAPNTSFLQIIGESTPSLKYLSLSDFTLSTNSSRILDRGLCSLMHLQELYKVNNDLRGSLPWCVANMTSLRILDVSSNQLTGSIASSPLAHLTSIEELHLSDNHFRIPISLEPLFNHSRLKIFDAENNELNAEITESYSLTTPNFQLQYLLLSSGYGDGATFPKFLYHQHDLEYVDLSHTKMNGEFPNWLLENNTKLKTLFLVNDSLAGPFRLPIHSHKRLRQLDVSNNNFQGHIPLEIGDILPNLISFNISMNALDGSIPSSFGNINLLKILDLSNNQLTGEIPEHLAVGCVYLDFLALSNNSLEGKVLSLLSGLDLSCNKLIGHIPPQIGNLTRIQTLNLSHNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSLAFNNLSGEIPEWKAQFATFNESSYEGNTFLCGLPLPICRSPATTPEASIGNERDDNLIDMDNFFITFTTSYVIVIFGIVVVLYVNPYWRCRWFYFVEMWITSCYYFVVDNLIPTRFCH
*******************LNTLYLKHNNFTGTATTTTQELHNFTNLEYSTLSGSSLHISLLQSIASLFPSLKNLSMSYCEVNGVVRGQGFPHFKSLEHLNMERARIAPNTSFLQIIGESTPSLKYLSLSDFTLSTNSSRILDRGLCSLMHLQELYKVNNDLRGSLPWCVANMTSLRILDVSSNQLTGSIASSPLAHLTSIEELHLSDNHFRIPISLEPLFNHSRLKIFDAENNELNAEITESYSLTTPNFQLQYLLLSSGYGDGATFPKFLYHQHDLEYVDLSHTKMNGEFPNWLLENNTKLKTLFLVNDSLAGPFRLPIHSHKRLRQLDVSNNNFQGHIPLEIGDILPNLISFNISMNALDGSIPSSFGNINLLKILDLSNNQLTGEIPEHLAVGCVYLDFLALSNNSLEGKVLSLLSGLDLSCNKLIGHIPPQIGNLTRIQTLNLSHNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSLAFNNLSGEIPEWKAQFATFNESSYEGNTFLCGLPLPICRSP************DDNLIDMDNFFITFTTSYVIVIFGIVVVLYVNPYWRCRWFYFVEMWITSCYYFVVDNLIPTRFC*
NVKIRDGSKLLQSMGSLPSLNTLYLKHNNFTGTATTTTQELHNFTNLEYSTLSGSSLHISLLQSIASLFPSLKNLSMSYCEVNGVVRGQGFPHFKSLEHLNMERARIAPNTSFLQIIGESTPSLKYLSLSDFTLSTNSSRILDRGLCSLMHLQELYKVNNDLRGSLPWCVANMTSLRILDVSSNQLTGSIASSPLAHLTSIEELHLSDNHFRIPISLEPLFNHSRLKIFDAENNELNAEITESYSLTTPNFQLQYLLLSSGYGDGATFPKFLYHQHDLEYVDLSHTKMNGEFPNWLLENNTKLKTLFLVNDSLAGPFRLPIHSHKRLRQLDVSNNNFQGHIPLEIGDILPNLISFNISMNALDGSIPSSFGNINLLKILDLSNNQLTGEIPEHLAVGCVYLDFLALSNNSLEGKVLSLLSGLDLSCNKLIGHIPPQIGNLTRIQTLNLSHNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSLAFNNLSGEIPEWKAQFATFNESSYEGNTFLCG***************************MDNFFITFTTSYVIVIFGIVVVLYVNPYWRCRWFYFVEMWITSCYYFVVDNLIPTRFC*
NVKIRDGSKLLQSMGSLPSLNTLYLKHNNFTGTATTTTQELHNFTNLEYSTLSGSSLHISLLQSIASLFPSLKNLSMSYCEVNGVVRGQGFPHFKSLEHLNMERARIAPNTSFLQIIGESTPSLKYLSLSDFTLSTNSSRILDRGLCSLMHLQELYKVNNDLRGSLPWCVANMTSLRILDVSSNQLTGSIASSPLAHLTSIEELHLSDNHFRIPISLEPLFNHSRLKIFDAENNELNAEITESYSLTTPNFQLQYLLLSSGYGDGATFPKFLYHQHDLEYVDLSHTKMNGEFPNWLLENNTKLKTLFLVNDSLAGPFRLPIHSHKRLRQLDVSNNNFQGHIPLEIGDILPNLISFNISMNALDGSIPSSFGNINLLKILDLSNNQLTGEIPEHLAVGCVYLDFLALSNNSLEGKVLSLLSGLDLSCNKLIGHIPPQIGNLTRIQTLNLSHNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSLAFNNLSGEIPEWKAQFATFNESSYEGNTFLCGLPLPICRSPATTPEASIGNERDDNLIDMDNFFITFTTSYVIVIFGIVVVLYVNPYWRCRWFYFVEMWITSCYYFVVDNLIPTRFCH
*****DGSKLLQSMGSLPSLNTLYLKHNNFTGTATTTTQELHNFTNLEYSTLSGSSLHISLLQSIASLFPSLKNLSMSYCEVNGVVRGQGFPHFKSLEHLNMERARIAPNTSFLQIIGESTPSLKYLSLSDFTLSTNSSRILDRGLCSLMHLQELYKVNNDLRGSLPWCVANMTSLRILDVSSNQLTGSIASSPLAHLTSIEELHLSDNHFRIPISLEPLFNHSRLKIFDAENNELNAEITESYSLTTPNFQLQYLLLSSGYGDGATFPKFLYHQHDLEYVDLSHTKMNGEFPNWLLENNTKLKTLFLVNDSLAGPFRLPIHSHKRLRQLDVSNNNFQGHIPLEIGDILPNLISFNISMNALDGSIPSSFGNINLLKILDLSNNQLTGEIPEHLAVGCVYLDFLALSNNSLEGKVLSLLSGLDLSCNKLIGHIPPQIGNLTRIQTLNLSHNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSLAFNNLSGEIPEWKAQFATFNESSYEGNTFLCGLPLPICRSPATTPEASIGNERDDNLIDMDNFFITFTTSYVIVIFGIVVVLYVNPYWRCRWFYFVEMWITSCYYFVVDNLIPTRFC*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHoooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NVKIRDGSKLLQSMGSLPSLNTLYLKHNNFTGTATTTTQELHNFTNLEYSTLSGSSLHISLLQSIASLFPSLKNLSMSYCEVNGVVRGQGFPHFKSLEHLNMERARIAPNTSFLQIIGESTPSLKYLSLSDFTLSTNSSRILDRGLCSLMHLQELYKVNNDLRGSLPWCVANMTSLRILDVSSNQLTGSIASSPLAHLTSIEELHLSDNHFRIPISLEPLFNHSRLKIFDAENNELNAEITESYSLTTPNFQLQYLLLSSGYGDGATFPKFLYHQHDLEYVDLSHTKMNGEFPNWLLENNTKLKTLFLVNDSLAGPFRLPIHSHKRLRQLDVSNNNFQGHIPLEIGDILPNLISFNISMNALDGSIPSSFGNINLLKILDLSNNQLTGEIPEHLAVGCVYLDFLALSNNSLEGKVLSLLSGLDLSCNKLIGHIPPQIGNLTRIQTLNLSHNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSLAFNNLSGEIPEWKAQFATFNESSYEGNTFLCGLPLPICRSPATTPEASIGNERDDNLIDMDNFFITFTTSYVIVIFGIVVVLYVNPYWRCRWFYFVEMWITSCYYFVVDNLIPTRFCH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query614 2.2.26 [Sep-21-2011]
Q9ZUI0 980 Putative leucine-rich rep no no 0.739 0.463 0.320 1e-42
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.840 0.412 0.288 4e-42
Q9SHI2 1101 Leucine-rich repeat recep no no 0.806 0.449 0.303 2e-40
Q9ZPS9 1143 Serine/threonine-protein no no 0.793 0.426 0.288 2e-39
Q9FL28 1173 LRR receptor-like serine/ no no 0.627 0.328 0.336 3e-39
Q9LHP4 1141 Receptor-like protein kin no no 0.798 0.429 0.308 1e-37
Q9LYN8 1192 Leucine-rich repeat recep no no 0.783 0.403 0.312 2e-37
C0LGQ5 1249 LRR receptor-like serine/ no no 0.729 0.358 0.291 2e-37
C0LGF5 1072 Probable LRR receptor-lik no no 0.610 0.349 0.345 4e-37
Q8VZG8 1045 Probable LRR receptor-lik no no 0.832 0.488 0.276 1e-36
>sp|Q9ZUI0|Y2241_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130 OS=Arabidopsis thaliana GN=At2g24130 PE=3 SV=1 Back     alignment and function desciption
 Score =  175 bits (443), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 153/478 (32%), Positives = 248/478 (51%), Gaps = 24/478 (5%)

Query: 65  IASLFPSLKNLSMSYCEVNGVVRGQGFPHFKSLEHLNMERARIAPNTSFLQIIGESTPSL 124
           I SL  +LK LS+S   ++G +  Q       L +L++   R+  +         S+ SL
Sbjct: 110 IGSLHETLKQLSLSENLLHGNIP-QELGLLNRLVYLDLGSNRLNGSIPVQLFCNGSSSSL 168

Query: 125 KYLSLSDFTLSTNSSRILDRGLCSLMHLQELYKVNNDLRGSLPWCVANMTSLRILDVSSN 184
           +Y+ LS+ +L+     I     C L  L+ L   +N L G++P  ++N T+L+ +D+ SN
Sbjct: 169 QYIDLSNNSLT---GEIPLNYHCHLKELRFLLLWSNKLTGTVPSSLSNSTNLKWMDLESN 225

Query: 185 QLTGSIASSPLAHLTSIEELHLSDNHF---RIPISLEPLF----NHSRLKIFDAENNELN 237
            L+G + S  ++ +  ++ L+LS NHF       +LEP F    N S L+  +   N L 
Sbjct: 226 MLSGELPSQVISKMPQLQFLYLSYNHFVSHNNNTNLEPFFASLANSSDLQELELAGNSLG 285

Query: 238 AEITESYSLTTPNFQLQYLLLSSGYGDGATFPKFLYHQHDLEYVDLSHTKMNGEFPNWLL 297
            EIT S    + N    +L  +  +G   + P  + +  +L  ++LS   ++G  P  L 
Sbjct: 286 GEITSSVRHLSVNLVQIHLDQNRIHG---SIPPEISNLLNLTLLNLSSNLLSGPIPRELC 342

Query: 298 ENNTKLKTLFLVNDSLAGPFRLPIHSHKRLRQLDVSNNNFQGHIPLEIGDILPNLISFNI 357
           +  +KL+ ++L N+ L G   + +    RL  LDVS NN  G IP   G+ L  L    +
Sbjct: 343 KL-SKLERVYLSNNHLTGEIPMELGDIPRLGLLDVSRNNLSGSIPDSFGN-LSQLRRLLL 400

Query: 358 SMNALDGSIPSSFGNINLLKILDLSNNQLTGEIPEHLAVGCVYLD-FLALSNNSLEGKV- 415
             N L G++P S G    L+ILDLS+N LTG IP  +      L  +L LS+N L G + 
Sbjct: 401 YGNHLSGTVPQSLGKCINLEILDLSHNNLTGTIPVEVVSNLRNLKLYLNLSSNHLSGPIP 460

Query: 416 -----LSLLSGLDLSCNKLIGHIPPQIGNLTRIQTLNLSHNNLTGLIPSTFSNLKHIESL 470
                + ++  +DLS N+L G IPPQ+G+   ++ LNLS N  +  +PS+   L +++ L
Sbjct: 461 LELSKMDMVLSVDLSSNELSGKIPPQLGSCIALEHLNLSRNGFSSTLPSSLGQLPYLKEL 520

Query: 471 DLSYNKLNGKIPHQLVELKTLEVFSLAFNNLSGEIPEWKAQFATFNESSYEGNTFLCG 528
           D+S+N+L G IP    +  TL+  + +FN LSG + + K  F+     S+ G++ LCG
Sbjct: 521 DVSFNRLTGAIPPSFQQSSTLKHLNFSFNLLSGNVSD-KGSFSKLTIESFLGDSLLCG 577





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|C0LGF5|Y1341_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query614
224120284 929 predicted protein [Populus trichocarpa] 0.965 0.638 0.397 1e-112
224112249 806 predicted protein [Populus trichocarpa] 0.910 0.693 0.413 1e-103
255581263 912 serine-threonine protein kinase, plant-t 0.669 0.450 0.487 2e-97
224120450 935 predicted protein [Populus trichocarpa] 0.910 0.597 0.367 8e-94
224124502452 predicted protein [Populus trichocarpa] 0.708 0.962 0.421 3e-86
224144186 973 predicted protein [Populus trichocarpa] 0.962 0.607 0.351 2e-85
224142717 876 predicted protein [Populus trichocarpa] 0.915 0.641 0.354 6e-85
224112245 876 predicted protein [Populus trichocarpa] 0.877 0.615 0.393 2e-84
224106948658 predicted protein [Populus trichocarpa] 0.942 0.879 0.354 2e-83
297743503 947 unnamed protein product [Vitis vinifera] 0.825 0.535 0.376 3e-82
>gi|224120284|ref|XP_002331010.1| predicted protein [Populus trichocarpa] gi|222872940|gb|EEF10071.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  413 bits (1062), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 290/730 (39%), Positives = 377/730 (51%), Gaps = 137/730 (18%)

Query: 5   RDGSKLLQSMGSLPSLNTLYLKHNNFTGTATTTTQELHNFTNLEYS-----TLSGSSLHI 59
           R  + +L S   L SL  L L+ N+  GT     + +  F NL        T +G  + +
Sbjct: 194 RFDNSILSSFKGLSSLKNLGLEKNHLKGTFNM--KGIRGFGNLSRVRLFNITANGRRISL 251

Query: 60  SLLQSIASLFPSLKNLSMSYCEVNGVVRGQGFPHFKSLEHLNMERARIAPNTSFLQIIGE 119
            LLQS+A L P+LK L +      G +  Q  P  K+L  L++  + +  + SFLQ IG 
Sbjct: 252 PLLQSLAKL-PNLKTLDLGNNNFEGTILAQALPSLKNLHKLDLSSSTL--DNSFLQTIGR 308

Query: 120 STPSLKYLSLSDFTLSTNSSRILDRGLCSLMHLQELYKVNNDLRGSLPWCVANMTSLRIL 179
            T +L  L L+   LS   S  +  GLC L HLQ L   NN L G LP C+AN+TSL+ +
Sbjct: 309 IT-TLTSLKLNGCRLS--GSIPIAEGLCELKHLQSLDISNNSLTGVLPKCLANLTSLKQI 365

Query: 180 DVSSNQLTGSIASSPLAHLTSIEELHLSDNHFRIPISLEPLFNHSRLKIFDAENNELNAE 239
           D+SSN   G I+SSPL  LTSI+EL LSDN+F+IPISL    NHS LK F   NNE+ AE
Sbjct: 366 DLSSNHFGGDISSSPLITLTSIQELRLSDNNFQIPISLRSFSNHSELKFFFGYNNEICAE 425

Query: 240 ITESYSLTTPNFQLQYLLLSS-GYGDGATFPKFLYHQHDLEYVDLSHTKMNGEFPNWLLE 298
           + E   +  P FQLQ L LS   YG    FPKFL++QH+L  +  S+ +M G  PNWLLE
Sbjct: 426 LEEHNLI--PKFQLQRLHLSGQAYGGALPFPKFLFYQHNLREIYFSNMRMRGGVPNWLLE 483

Query: 299 NNTKLKTLFLVNDSLAGPFRLPIHSHKRLRQLDVSNNNFQGHIPLEIGDILPNLISFNIS 358
           NNT L  LFLVN+SL+GPF+LPIH H  L QLD+S+N+   HIP EIG   P+L   ++S
Sbjct: 484 NNTNLHELFLVNNSLSGPFQLPIHPHVSLSQLDISDNHLDSHIPTEIGAYFPSLTFLSMS 543

Query: 359 MNALDGSIPSSFGNINLLKILDLSNNQLTGEIPE-------------------------H 393
            N  +G IPSSFG ++ L +LDLS N ++G++P                          H
Sbjct: 544 KNHFNGIIPSSFGYMSSLLVLDLSENNISGKLPSCFSSLPLVHVYLSQNKLQGSLEDAFH 603

Query: 394 LAVGCVYLD---------------------FLALSNNSLEGKV------LSLLSGLDLSC 426
            +   + LD                     +L L  N+LEG++      L  LS +DLS 
Sbjct: 604 KSFELITLDLSHNQLTGNISEWIGEFSHMSYLLLGYNNLEGRIPNQLCKLDKLSFIDLSH 663

Query: 427 NKLIGHIPP-------------------------------------QIGNLTRIQTLNLS 449
           NK  GHI P                                      I  L  +  ++LS
Sbjct: 664 NKFSGHILPCLRFRSSIWYSNLRIYPDRYLIREPLEITTKSVSYSYPISILNIMSGMDLS 723

Query: 450 HNNLTGL------------------------IPSTFSNLKHIESLDLSYNKLNGKIPHQL 485
            NNLTG                         IP TFSNL  +ESLDLS N L G IP  L
Sbjct: 724 CNNLTGEIPPEIGNLNHIHVLNLSNNFLIGPIPQTFSNLSEVESLDLSNNSLTGAIPPGL 783

Query: 486 VELKTLEVFSLAFNNLSGEI-PEWKAQFATFNESSYEGNTFLCGLPLPICRSPATTPEAS 544
           V+L  LEVFS+A NNLSG   P    QF+TFNESSYEGN  LCG PL    +     EAS
Sbjct: 784 VQLHYLEVFSVAHNNLSGRTPPNMIPQFSTFNESSYEGNPLLCGPPLSRHCTTQEEEEAS 843

Query: 545 IGNER---DD----NLIDMDNFFITFTTSYVIVIFGIVVVLYVNPYWRCRWFYFVEMWIT 597
              +R   DD      +D D F+++F  +Y++++     +LY+NP WR  WFYF++  I 
Sbjct: 844 SLPKRTSTDDIEESGFMDTDVFYVSFVVTYIMMLLVTAAILYINPNWRRAWFYFIKQSIN 903

Query: 598 SCYYFVVDNL 607
           +CYYF VDNL
Sbjct: 904 NCYYFFVDNL 913




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224112249|ref|XP_002332816.1| predicted protein [Populus trichocarpa] gi|222833210|gb|EEE71687.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255581263|ref|XP_002531443.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223528936|gb|EEF30930.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224120450|ref|XP_002331051.1| predicted protein [Populus trichocarpa] gi|222872981|gb|EEF10112.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224124502|ref|XP_002330039.1| predicted protein [Populus trichocarpa] gi|222871464|gb|EEF08595.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224144186|ref|XP_002336117.1| predicted protein [Populus trichocarpa] gi|222873047|gb|EEF10178.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142717|ref|XP_002324701.1| predicted protein [Populus trichocarpa] gi|222866135|gb|EEF03266.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224112245|ref|XP_002332815.1| predicted protein [Populus trichocarpa] gi|222833209|gb|EEE71686.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224106948|ref|XP_002333588.1| predicted protein [Populus trichocarpa] gi|222837496|gb|EEE75875.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297743503|emb|CBI36370.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query614
TAIR|locus:2037313 1000 RLP13 "AT1G74170" [Arabidopsis 0.788 0.484 0.351 1.6e-63
TAIR|locus:2019662 965 RLP15 "AT1G74190" [Arabidopsis 0.747 0.475 0.347 2.5e-58
TAIR|locus:2025012 1083 RLP1 "AT1G07390" [Arabidopsis 0.649 0.368 0.371 1.5e-56
TAIR|locus:2037308 976 RLP14 "AT1G74180" [Arabidopsis 0.778 0.489 0.345 6.8e-56
TAIR|locus:2101943 891 RLP45 "AT3G53240" [Arabidopsis 0.737 0.508 0.327 2.8e-53
TAIR|locus:2047525 980 AT2G24130 [Arabidopsis thalian 0.775 0.485 0.316 1.2e-51
TAIR|locus:2155909 908 RLP56 "AT5G49290" [Arabidopsis 0.736 0.497 0.337 1.4e-51
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.794 0.390 0.321 2.5e-48
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.736 0.483 0.334 1.7e-47
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.892 0.482 0.300 7.6e-46
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 653 (234.9 bits), Expect = 1.6e-63, P = 1.6e-63
 Identities = 181/515 (35%), Positives = 272/515 (52%)

Query:    10 LLQSMGSLPSLNTLYLKHNNFXXXX-XXXXQELHNFTNLEYSTLSGSSLHISLLQSIASL 68
             L++    L +L  L L+ N F           L  F  LE   LS +  +  +   + S 
Sbjct:   113 LVKEFKDLTNLEHLDLRGNRFNGSIPTQDYNSLRRFRKLEILDLSDNLFNSRIFPFLNSA 172

Query:    69 FPSLKNLSMSYCEVNGVVRGQGFPHFKSLEHLNMERARIAPNTSFLQIIGESTPSLKYLS 128
               SLK+LS+    + G    +      ++E L++ R R   +     +   +   LK L 
Sbjct:   173 -TSLKSLSLWGNNMGGPFPAKELRDLTNVELLDLSRNRFNGSIPVRALF--ALRKLKALD 229

Query:   129 LSDFTLSTN--------SSRILDRGLCSLMHLQELYKVNNDLRGSLPWCVANMTSLRILD 180
             LSD   S++         ++ L  G C   +++EL   NN L G  P C+ ++T LR+LD
Sbjct:   230 LSDNEFSSSVELQGKFAKTKPLS-GTCPWKNMEELKLSNNKLAGQFPLCLTSLTGLRVLD 288

Query:   181 VSSNQLTGSIASSPLAHLTSIEELHLSDNHFRIPISLEPLFNHSRLKIF--DAENNELNA 238
             +SSNQLTG++ S+ LA+L S+E L L  N+F    SL  L N S+LK+   D+++N L  
Sbjct:   289 LSSNQLTGNVPSA-LANLESLEYLSLFGNNFEGFFSLGLLANLSKLKVLRLDSQSNSLEV 347

Query:   239 EITESYSLTTPNFQLQYLLLSSGYGDGATFPKFLYHQHDLEYVDLSHTKMNGEFPNWLLE 298
             E   S+    P FQL  + L S   +    P FL HQ DL +VDLS  +++G FP+WLLE
Sbjct:   348 EFETSWK---PKFQLVVIALRSCNLEKV--PHFLLHQKDLHHVDLSDNQIHGNFPSWLLE 402

Query:   299 NNTKLKTLFLVNDSLAGPFRLPIHSHKRLRQLDVSNNNFQGHIPLE-IGDILPNLISFNI 357
             NNTKL+ L L N+S    F+LP  +H  L  L+VS N F  H+ L+  G ILP+L+  N+
Sbjct:   403 NNTKLEVLLLQNNSFTS-FQLPKSAHNLLF-LNVSVNKFN-HLFLQNFGWILPHLVCVNL 459

Query:   358 SMNALDGSIPSSFGNINLLKILDLSNNQLTGEIPEHLAVGCVYLDFLALSNNSLEGKVL- 416
             + N   G++PSS  N+  ++ LDLS+N+  G++P     GC  L  L LS+N L G+V  
Sbjct:   460 AYNGFQGNLPSSLDNMKSIEFLDLSHNRFHGKLPRRFLKGCYNLTILKLSHNKLSGEVFP 519

Query:   417 -----SLLSGLDLSCNKLIGHIPPQIGNLTRIQTLNLSHNNLTGLIPSTFSNLKHIESLD 471
                  + L  + +  N   G+I     +L  +  L++S+N LTG+IPS     + + +L 
Sbjct:   520 EAANFTRLWVMSMDNNLFTGNIGKGFRSLPSLNVLDISNNKLTGVIPSWIGERQGLFALQ 579

Query:   472 LSYNKLNGKIPHQLVELKTLEVFSLAFNNLSGEIP 506
             LS N L G+IP  L  +  L++  L+ N LSG+IP
Sbjct:   580 LSNNMLEGEIPTSLFNISYLQLLDLSSNRLSGDIP 614


GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2047525 AT2G24130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query614
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-45
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-38
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-27
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-18
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-08
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-07
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-04
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 1e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 8e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  171 bits (436), Expect = 5e-45
 Identities = 164/543 (30%), Positives = 269/543 (49%), Gaps = 69/543 (12%)

Query: 15  GSLPSLNTLYLKHNNFTGTATTTTQELHNFTNLEYSTLSGSSLHISLLQSIASLFPSLKN 74
           GS+P+L TL L +N  +G       ++ +F++L+   L G+ L   +  S+ +L  SL+ 
Sbjct: 137 GSIPNLETLDLSNNMLSGE---IPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNL-TSLEF 192

Query: 75  LSMSYCEVNGVVRGQGFPH----FKSLEHLNMERARIAPNTSFLQIIGESTPSLKYLSLS 130
           L+++  ++ G       P      KSL+ + +    ++    +   IG  T SL +L L 
Sbjct: 193 LTLASNQLVG-----QIPRELGQMKSLKWIYLGYNNLSGEIPYE--IGGLT-SLNHLDL- 243

Query: 131 DFTLSTNSSRILDRGLCSLMHLQELYKVNNDLRGSLPWCVANMTSLRILDVSSNQLTGSI 190
              +  N +  +   L +L +LQ L+   N L G +P  + ++  L  LD+S N L+G I
Sbjct: 244 ---VYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEI 300

Query: 191 ASSPLAHLTSIEELHLSDNHF--RIPISLEPLFNHSRLKIFDAENNELNAEITESYSLTT 248
               +  L ++E LHL  N+F  +IP++L  L    RL++    +N+ + EI        
Sbjct: 301 PEL-VIQLQNLEILHLFSNNFTGKIPVALTSL---PRLQVLQLWSNKFSGEI-------- 348

Query: 249 PNFQLQYLLLSSGYGDGATFPKFLYHQHDLEYVDLSHTKMNGEFPNWLLENNTKLKTLFL 308
                               PK L   ++L  +DLS   + GE P  L  ++  L  L L
Sbjct: 349 --------------------PKNLGKHNNLTVLDLSTNNLTGEIPEGLC-SSGNLFKLIL 387

Query: 309 VNDSLAGPFRLPIHSHKRLRQLDVSNNNFQGHIPLEIGDILPNLISFNISMNALDGSIPS 368
            ++SL G     + + + LR++ + +N+F G +P E    LP +   +IS N L G I S
Sbjct: 388 FSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTK-LPLVYFLDISNNNLQGRINS 446

Query: 369 SFGNINLLKILDLSNNQLTGEIPEHLAVGCVYLDFLALSNNSLEGKV------LSLLSGL 422
              ++  L++L L+ N+  G +P+  + G   L+ L LS N   G V      LS L  L
Sbjct: 447 RKWDMPSLQMLSLARNKFFGGLPD--SFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQL 504

Query: 423 DLSCNKLIGHIPPQIGNLTRIQTLNLSHNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIP 482
            LS NKL G IP ++ +  ++ +L+LSHN L+G IP++FS +  +  LDLS N+L+G+IP
Sbjct: 505 KLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIP 564

Query: 483 HQLVELKTLEVFSLAFNNLSGEIPEWKAQFATFNESSYEGNTFLCG----LPLPICRSPA 538
             L  +++L   +++ N+L G +P   A F   N S+  GN  LCG      LP C+   
Sbjct: 565 KNLGNVESLVQVNISHNHLHGSLPSTGA-FLAINASAVAGNIDLCGGDTTSGLPPCKRVR 623

Query: 539 TTP 541
            TP
Sbjct: 624 KTP 626


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 614
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG4237498 consensus Extracellular matrix protein slit, conta 99.92
KOG4237498 consensus Extracellular matrix protein slit, conta 99.92
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.71
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.64
KOG0617264 consensus Ras suppressor protein (contains leucine 99.6
PLN03150623 hypothetical protein; Provisional 99.48
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.26
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.24
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.16
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.15
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.11
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.1
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.08
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.08
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.07
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.07
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.02
PLN03150623 hypothetical protein; Provisional 98.99
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.96
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.93
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.93
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.91
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.87
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.7
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.64
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.61
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.55
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.38
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.37
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.24
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.21
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.15
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.1
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.09
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.04
PRK15386426 type III secretion protein GogB; Provisional 98.03
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.87
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.82
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.81
PRK15386426 type III secretion protein GogB; Provisional 97.81
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.8
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.78
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.78
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.72
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.53
KOG4341483 consensus F-box protein containing LRR [General fu 97.15
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.83
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.79
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.66
KOG4341483 consensus F-box protein containing LRR [General fu 96.56
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.53
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.02
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.78
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.46
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 94.45
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.31
KOG4308478 consensus LRR-containing protein [Function unknown 93.46
KOG4308478 consensus LRR-containing protein [Function unknown 92.46
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.1
smart0037026 LRR Leucine-rich repeats, outliers. 92.1
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.74
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.17
smart0037026 LRR Leucine-rich repeats, outliers. 91.17
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.38
KOG0473326 consensus Leucine-rich repeat protein [Function un 84.57
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 84.28
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 82.85
KOG3864221 consensus Uncharacterized conserved protein [Funct 81.97
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 80.26
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.6e-56  Score=513.91  Aligned_cols=499  Identities=29%  Similarity=0.416  Sum_probs=403.2

Q ss_pred             ccccccCCCCCCCEEECCCcccCCCCCCCCc--ccCCCCCCCEEeCCCCCCCccchHHHhhccCCcEEeccCccccCCcc
Q 042884            9 KLLQSMGSLPSLNTLYLKHNNFTGTATTTTQ--ELHNFTNLEYSTLSGSSLHISLLQSIASLFPSLKNLSMSYCEVNGVV   86 (614)
Q Consensus         9 ~l~~~~~~l~~L~~L~Ls~n~i~~~~~~~~~--~l~~l~~L~~L~Ls~n~~~~~~~~~~~~l~~l~~l~l~~~~~~~~~~   86 (614)
                      .+++.|..+++|++|+|++|++++.    +|  .+..+++|++|++++|.+.+..|.  ..+++|+++++++|.+.+.+|
T Consensus        84 ~~~~~~~~l~~L~~L~Ls~n~~~~~----ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p  157 (968)
T PLN00113         84 KISSAIFRLPYIQTINLSNNQLSGP----IPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIP  157 (968)
T ss_pred             cCChHHhCCCCCCEEECCCCccCCc----CChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCC
Confidence            3566788888888888888888754    44  345788888888888888766654  456788888888888776666


Q ss_pred             CCCCCCCCCCCCEEeCcCcccCCCcchhhHhhhcCCCcCEEeccCCcCCCCCCCcCchhhcCCCCCCeEECcCCcccccc
Q 042884           87 RGQGFPHFKSLEHLNMERARIAPNTSFLQIIGESTPSLKYLSLSDFTLSTNSSRILDRGLCSLMHLQELYKVNNDLRGSL  166 (614)
Q Consensus        87 ~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~l~~~l~~L~~L~L~~n~l~~~~~~i~~~~~~~l~~L~~L~L~~n~i~~~~  166 (614)
                      .  .++++++|++|++++|.+.+  .+|..+.+ +++|++|++++|.+.+   .+|. .+..+++|++|++++|++++.+
T Consensus       158 ~--~~~~l~~L~~L~L~~n~l~~--~~p~~~~~-l~~L~~L~L~~n~l~~---~~p~-~l~~l~~L~~L~L~~n~l~~~~  228 (968)
T PLN00113        158 N--DIGSFSSLKVLDLGGNVLVG--KIPNSLTN-LTSLEFLTLASNQLVG---QIPR-ELGQMKSLKWIYLGYNNLSGEI  228 (968)
T ss_pred             h--HHhcCCCCCEEECccCcccc--cCChhhhh-CcCCCeeeccCCCCcC---cCCh-HHcCcCCccEEECcCCccCCcC
Confidence            3  57888888888888888776  77777777 8888888888888875   5555 7888888888888888888888


Q ss_pred             CccccCCCCCcEEEcccCCCCCccCCCCCCCCCCCCEEEcccCcCccccCcccccCCCCccEEEccCCcccccccccccC
Q 042884          167 PWCVANMTSLRILDVSSNQLTGSIASSPLAHLTSIEELHLSDNHFRIPISLEPLFNHSRLKIFDAENNELNAEITESYSL  246 (614)
Q Consensus       167 ~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~  246 (614)
                      |..+.++++|++|++++|.+.+.+|.. ++++++|++|++++|.+.+.++ ..+..+++|+.|++++|.+.+..+..+..
T Consensus       229 p~~l~~l~~L~~L~L~~n~l~~~~p~~-l~~l~~L~~L~L~~n~l~~~~p-~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~  306 (968)
T PLN00113        229 PYEIGGLTSLNHLDLVYNNLTGPIPSS-LGNLKNLQYLFLYQNKLSGPIP-PSIFSLQKLISLDLSDNSLSGEIPELVIQ  306 (968)
T ss_pred             ChhHhcCCCCCEEECcCceeccccChh-HhCCCCCCEEECcCCeeeccCc-hhHhhccCcCEEECcCCeeccCCChhHcC
Confidence            888888888888888888888777764 7888888888888888876555 45778888888888888887766554443


Q ss_pred             CCCCccceeeeccCCCCCCCCCCccccCCCCCcEEEccCCCCCCCCChhHHhcCCCccEEEccCCCCCCCCCCCCCCCCc
Q 042884          247 TTPNFQLQYLLLSSGYGDGATFPKFLYHQHDLEYVDLSHTKMNGEFPNWLLENNTKLKTLFLVNDSLAGPFRLPIHSHKR  326 (614)
Q Consensus       247 ~~~~~~L~~L~l~~~~~~~~~~p~~~~~l~~L~~L~Ls~n~i~~~~~~~~~~~~~~L~~L~l~~n~i~~~~~~~~~~l~~  326 (614)
                         ..+|+.|++ .++...+..|..+..+++|+.|++++|.+.+.+|.. +..+++|+.|++++|.+.+..+..+..+++
T Consensus       307 ---l~~L~~L~l-~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~-l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~  381 (968)
T PLN00113        307 ---LQNLEILHL-FSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKN-LGKHNNLTVLDLSTNNLTGEIPEGLCSSGN  381 (968)
T ss_pred             ---CCCCcEEEC-CCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChH-HhCCCCCcEEECCCCeeEeeCChhHhCcCC
Confidence               347888888 667777778888888888888888888888777776 677888888888888888777777778888


Q ss_pred             cCEEEccCCccccCCChhhhhcCCCccEEEccCCcCCCCCccchhccccCcEEEccCCccCCcCCchhhccCCCCCEEEc
Q 042884          327 LRQLDVSNNNFQGHIPLEIGDILPNLISFNISMNALDGSIPSSFGNINLLKILDLSNNQLTGEIPEHLAVGCVYLDFLAL  406 (614)
Q Consensus       327 L~~L~l~~n~i~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~L~~L~l  406 (614)
                      |+.|++++|.+.+.+|..+.. +++|+.|++++|++++..|..|..+++|+.|++++|.+++.+|..+ ..+++|+.|++
T Consensus       382 L~~L~l~~n~l~~~~p~~~~~-~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~-~~l~~L~~L~L  459 (968)
T PLN00113        382 LFKLILFSNSLEGEIPKSLGA-CRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRK-WDMPSLQMLSL  459 (968)
T ss_pred             CCEEECcCCEecccCCHHHhC-CCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhh-ccCCCCcEEEC
Confidence            888888888888777776665 8888888888888888888888888888888888888886666554 56888888888


Q ss_pred             cCCcccccc-----cCCccEEEcCCCcCCccCCccccCCCcCCEEECcCCcCCCCCCcCCCCCCCCCEEEccCCcCCCCC
Q 042884          407 SNNSLEGKV-----LSLLSGLDLSCNKLIGHIPPQIGNLTRIQTLNLSHNNLTGLIPSTFSNLKHIESLDLSYNKLNGKI  481 (614)
Q Consensus       407 ~~n~l~~~~-----~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~ls~N~l~~~~  481 (614)
                      ++|++.+..     .++|+.|++++|++++..|..+..+++|+.|++++|.+.+.+|..+.++++|++|++++|.+++.+
T Consensus       460 ~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~  539 (968)
T PLN00113        460 ARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQI  539 (968)
T ss_pred             cCceeeeecCcccccccceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccC
Confidence            888877643     356888888888888888888888888888888888888888888888888888888888888888


Q ss_pred             cccccCCCCCCeEeccCCcCcccCCccccccCCcCcccccCCcCCCCCCC
Q 042884          482 PHQLVELKTLEVFSLAFNNLSGEIPEWKAQFATFNESSYEGNTFLCGLPL  531 (614)
Q Consensus       482 ~~~l~~l~~L~~L~l~~N~l~~~~~~~~~~~~~l~~~~~~~n~~~c~~~~  531 (614)
                      |..|..+++|+.|++++|++++.+|..+..+..++.+++++|++.+..|.
T Consensus       540 p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~  589 (968)
T PLN00113        540 PASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPS  589 (968)
T ss_pred             ChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCC
Confidence            88888888888888888888888888788888888888888888776553



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query614
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-30
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-30
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-21
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-11
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 7e-06
2z62_A276 Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 A 4e-04
4g8a_A 635 Crystal Structure Of Human Tlr4 Polymorphic Variant 4e-04
3ul9_A278 Structure Of The Tv3 Mutant M41e Length = 278 4e-04
3ul7_A278 Crystal Structure Of The Tv3 Mutant F63w Length = 2 5e-04
3fxi_A 605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 5e-04
3ul8_A279 Crystal Structure Of The Tv3 Mutant V134l Length = 5e-04
3ula_A279 Crystal Structure Of The Tv3 Mutant F63w-Md-2-Erito 5e-04
2z63_A 570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 5e-04
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 6e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 131 bits (329), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 118/421 (28%), Positives = 191/421 (45%), Gaps = 60/421 (14%) Query: 169 CVANMTSLRILDVSSNQLTGSIAS-SPLAHLTSIEELHLSDNHFRIPISLEPLFNHSRLK 227 C A++TSL D+S N L+G + + + L + ++ L++S N P + + L+ Sbjct: 98 CSASLTSL---DLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLE 154 Query: 228 IFDAENNELNAEITESYSLTTPNFQLQYLLLSSGYGDG--------------------AT 267 + D N ++ + L+ +L++L +S G +T Sbjct: 155 VLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFST 214 Query: 268 FPKFLYHQHDLEYVDLSHTKMNGEFPNWLLENNTKLKTLFLVNDSLAGPFRLPIHSHKRL 327 FL L+++D+S K++G+F + + T+LK L + ++ GP +P K L Sbjct: 215 GIPFLGDCSALQHLDISGNKLSGDF-SRAISTCTELKLLNISSNQFVGP--IPPLPLKSL 271 Query: 328 RQLDVSNNNFQGHIPLEIGDILPNLISFNISMNALDGSIPSSFG---------------- 371 + L ++ N F G IP + L ++S N G++P FG Sbjct: 272 QYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFS 331 Query: 372 ---------NINLLKILDLSNNQLTGEIPEHLAVGCVYLDFLALSNNSLEGKVL------ 416 + LK+LDLS N+ +GE+PE L L L LS+N+ G +L Sbjct: 332 GELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQN 391 Query: 417 --SLLSGLDLSCNKLIGHIPPQIGNLTRIQTLNLSHNNLTGLIPSTFSNLKHIESLDLSY 474 + L L L N G IPP + N + + +L+LS N L+G IPS+ +L + L L Sbjct: 392 PKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWL 451 Query: 475 NKLNGKIPHQLVELKTLEVFSLAFNNLSGEIPEWKAQFATFNESSYEGNTFLCGLPLPIC 534 N L G+IP +L+ +KTLE L FN+L+GEIP + N S N +P I Sbjct: 452 NMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIG 511 Query: 535 R 535 R Sbjct: 512 R 512
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|2Z62|A Chain A, Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 276 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|3UL9|A Chain A, Structure Of The Tv3 Mutant M41e Length = 278 Back     alignment and structure
>pdb|3UL7|A Chain A, Crystal Structure Of The Tv3 Mutant F63w Length = 278 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|3UL8|A Chain A, Crystal Structure Of The Tv3 Mutant V134l Length = 279 Back     alignment and structure
>pdb|3ULA|A Chain A, Crystal Structure Of The Tv3 Mutant F63w-Md-2-Eritoran Complex Length = 279 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query614
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-98
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-87
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-75
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-66
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-43
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-55
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-36
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-31
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-24
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-24
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-55
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-51
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-49
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-43
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-33
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-27
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-53
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-44
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-43
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-28
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-50
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-46
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-41
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-48
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-48
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-44
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-37
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-19
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-46
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-46
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-45
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-41
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-40
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-35
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-18
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-38
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-34
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-33
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-09
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-09
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-37
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-28
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-31
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-29
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-31
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-31
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-21
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-20
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-26
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-24
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-10
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-26
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-17
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-25
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-11
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-11
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-21
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-21
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-23
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-21
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-09
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-22
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-10
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-09
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 1e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-16
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-08
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-19
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-16
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-19
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-16
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-15
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-14
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-06
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-13
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-12
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-11
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-10
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 6e-05
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 9e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  316 bits (813), Expect = 1e-98
 Identities = 147/542 (27%), Positives = 221/542 (40%), Gaps = 63/542 (11%)

Query: 16  SLPSLNTLYLKHNNFTGTATTTTQELHNFTNLEYSTLSGSSLHISLLQSIASLFPSLKNL 75
            L SL  L L  N FTG              L    LSG+  + ++     S    L++L
Sbjct: 267 PLKSLQYLSLAENKFTGEIPDFL--SGACDTLTGLDLSGNHFYGAVPPFFGSC-SLLESL 323

Query: 76  SMSYCEVNGVVRGQGFPHFKSLEHLNMERARIA---PNTSFLQIIGESTPSLKYLSLSDF 132
           ++S    +G +        + L+ L++     +   P +     +   + SL  L LS  
Sbjct: 324 ALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES-----LTNLSASLLTLDLSSN 378

Query: 133 TLSTNSSRILDRGLCSLMHLQELYKVNNDLRGSLPWCVANMTSLRILDVSSNQLTGSIAS 192
             S      L         LQELY  NN   G +P  ++N + L  L +S N L+G+I S
Sbjct: 379 NFSGPILPNL--CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPS 436

Query: 193 SPLAHLTSIEELHLSDNHF--RIPISLEPLFNHSRLKIFDAENNELNAEITESYSLTTPN 250
           S L  L+ + +L L  N     IP  L        L+    + N+L  EI          
Sbjct: 437 S-LGSLSKLRDLKLWLNMLEGEIPQEL---MYVKTLETLILDFNDLTGEI---------- 482

Query: 251 FQLQYLLLSSGYGDGATFPKFLYHQHDLEYVDLSHTKMNGEFPNWLLENNTKLKTLFLVN 310
                             P  L +  +L ++ LS+ ++ GE P W+      L  L L N
Sbjct: 483 ------------------PSGLSNCTNLNWISLSNNRLTGEIPKWI-GRLENLAILKLSN 523

Query: 311 DSLAGPFRLPIHSHKRLRQLDVSNNNFQGHIPLEIGDILPNLISFNISMNALDGSIPSSF 370
           +S +G     +   + L  LD++ N F G IP  +        S  I+ N + G      
Sbjct: 524 NSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQ-----SGKIAANFIAGKRYVYI 578

Query: 371 GNINLLKILDLSNN--QLTGEIPEHLAVGCVYLDFLALSNNSLEGKV------LSLLSGL 422
            N  + K    + N  +  G   E L       +   +++    G           +  L
Sbjct: 579 KNDGMKKECHGAGNLLEFQGIRSEQLN-RLSTRNPCNITSRVYGGHTSPTFDNNGSMMFL 637

Query: 423 DLSCNKLIGHIPPQIGNLTRIQTLNLSHNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIP 482
           D+S N L G+IP +IG++  +  LNL HN+++G IP    +L+ +  LDLS NKL+G+IP
Sbjct: 638 DMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIP 697

Query: 483 HQLVELKTLEVFSLAFNNLSGEIPEWKAQFATFNESSYEGNTFLCGLPLPICRSPATTPE 542
             +  L  L    L+ NNLSG IPE   QF TF  + +  N  LCG PLP C        
Sbjct: 698 QAMSALTMLTEIDLSNNNLSGPIPEMG-QFETFPPAKFLNNPGLCGYPLPRCDPSNADGY 756

Query: 543 AS 544
           A 
Sbjct: 757 AH 758


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query614
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.86
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.84
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.84
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.8
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.79
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.78
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.73
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.73
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.73
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.69
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.68
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.66
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.66
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.66
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.64
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.64
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.62
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.6
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.59
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.57
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.55
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.54
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.51
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.45
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.44
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.44
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.41
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.37
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.36
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.3
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.19
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.18
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.15
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.76
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.54
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.47
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.41
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.26
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.22
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.07
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.92
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.76
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.22
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.95
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.85
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=3.7e-61  Score=539.30  Aligned_cols=512  Identities=30%  Similarity=0.432  Sum_probs=389.5

Q ss_pred             ccc--ccCCCCCCCEEECCCcccCCCCCCCCc-c-cCCCCCCCEEeCCCCCCCccchHH---HhhccCCcEEeccCcccc
Q 042884           10 LLQ--SMGSLPSLNTLYLKHNNFTGTATTTTQ-E-LHNFTNLEYSTLSGSSLHISLLQS---IASLFPSLKNLSMSYCEV   82 (614)
Q Consensus        10 l~~--~~~~l~~L~~L~Ls~n~i~~~~~~~~~-~-l~~l~~L~~L~Ls~n~~~~~~~~~---~~~l~~l~~l~l~~~~~~   82 (614)
                      +|.  .++++++|++|+|++|.+++.    .+ . +.++++|++|++++|.+.+..+..   +.++++|+++++.+|.+.
T Consensus       116 ~~~~~~l~~l~~L~~L~Ls~n~l~~~----~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~  191 (768)
T 3rgz_A          116 VTTLTSLGSCSGLKFLNVSSNTLDFP----GKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKIS  191 (768)
T ss_dssp             GGGGGGGGGCTTCCEEECCSSEEECC----SSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEE
T ss_pred             CCChHHHhCCCCCCEEECcCCccCCc----CCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCccc
Confidence            455  667777777777777777654    33 2 367788888888888877666655   455555555555555544


Q ss_pred             CCccCC-------------------CCCCCCCCCCEEeCcCcccCCCcchhhHhhhcCCCcCEEeccCCcCCCCCCCcCc
Q 042884           83 NGVVRG-------------------QGFPHFKSLEHLNMERARIAPNTSFLQIIGESTPSLKYLSLSDFTLSTNSSRILD  143 (614)
Q Consensus        83 ~~~~~~-------------------~~~~~l~~L~~L~l~~n~l~~~~~~~~~l~~~l~~L~~L~L~~n~l~~~~~~i~~  143 (614)
                      +..+..                   ..++++++|++|++++|.+.+  .+|..+.. +++|++|++++|.+.+   .++.
T Consensus       192 ~~~~~~~l~~L~~L~Ls~n~l~~~~~~l~~l~~L~~L~Ls~n~l~~--~~~~~l~~-l~~L~~L~Ls~n~l~~---~~~~  265 (768)
T 3rgz_A          192 GDVDVSRCVNLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNKLSG--DFSRAIST-CTELKLLNISSNQFVG---PIPP  265 (768)
T ss_dssp             SCCBCTTCTTCCEEECCSSCCCSCCCBCTTCCSCCEEECCSSCCCS--CHHHHTTT-CSSCCEEECCSSCCEE---SCCC
T ss_pred             ccCCcccCCcCCEEECcCCcCCCCCcccccCCCCCEEECcCCcCCC--cccHHHhc-CCCCCEEECCCCcccC---ccCc
Confidence            332210                   025555555555555555554  45555555 5566666666555543   2222


Q ss_pred             hhhcCCCCCCeEECcCCccccccCccccCC-CCCcEEEcccCCCCCccCCCCCCCCCCCCEEEcccCcCccccCcccccC
Q 042884          144 RGLCSLMHLQELYKVNNDLRGSLPWCVANM-TSLRILDVSSNQLTGSIASSPLAHLTSIEELHLSDNHFRIPISLEPLFN  222 (614)
Q Consensus       144 ~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l-~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~~~~~  222 (614)
                        . .+++|++|++++|++++.+|..+... ++|++|++++|.+.+.+|.. |+.+++|++|++++|.+.+.++...+..
T Consensus       266 --~-~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~-~~~l~~L~~L~L~~n~l~~~ip~~~l~~  341 (768)
T 3rgz_A          266 --L-PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPF-FGSCSLLESLALSSNNFSGELPMDTLLK  341 (768)
T ss_dssp             --C-CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGG-GGGCTTCCEEECCSSEEEEECCHHHHTT
T ss_pred             --c-ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchH-HhcCCCccEEECCCCcccCcCCHHHHhc
Confidence              1 44555555555555555566555553 66777777777666555543 6667777777777777766666555667


Q ss_pred             CCCccEEEccCCcccccccccccCCC------------------------CCccceeeeccCCCCCCCCCCccccCCCCC
Q 042884          223 HSRLKIFDAENNELNAEITESYSLTT------------------------PNFQLQYLLLSSGYGDGATFPKFLYHQHDL  278 (614)
Q Consensus       223 l~~L~~L~l~~n~~~~~~~~~~~~~~------------------------~~~~L~~L~l~~~~~~~~~~p~~~~~l~~L  278 (614)
                      +++|++|++++|.+.+..+..+....                        +..+|++|++ .++...+.+|..+..+++|
T Consensus       342 l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L-~~n~l~~~~p~~l~~l~~L  420 (768)
T 3rgz_A          342 MRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYL-QNNGFTGKIPPTLSNCSEL  420 (768)
T ss_dssp             CTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEEC-CSSEEEEECCGGGGGCTTC
T ss_pred             CCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEEC-CCCccccccCHHHhcCCCC
Confidence            77777777777766644443322111                        1346788888 6666667788889999999


Q ss_pred             cEEEccCCCCCCCCChhHHhcCCCccEEEccCCCCCCCCCCCCCCCCccCEEEccCCccccCCChhhhhcCCCccEEEcc
Q 042884          279 EYVDLSHTKMNGEFPNWLLENNTKLKTLFLVNDSLAGPFRLPIHSHKRLRQLDVSNNNFQGHIPLEIGDILPNLISFNIS  358 (614)
Q Consensus       279 ~~L~Ls~n~i~~~~~~~~~~~~~~L~~L~l~~n~i~~~~~~~~~~l~~L~~L~l~~n~i~~~~~~~~~~~l~~L~~L~L~  358 (614)
                      ++|++++|.+.+.+|.. +..+++|++|++++|.+.+..+..+..+++|++|++++|.+++.+|..+.. +++|++|+++
T Consensus       421 ~~L~Ls~N~l~~~~p~~-l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~-l~~L~~L~L~  498 (768)
T 3rgz_A          421 VSLHLSFNYLSGTIPSS-LGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSN-CTNLNWISLS  498 (768)
T ss_dssp             CEEECCSSEEESCCCGG-GGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGG-CTTCCEEECC
T ss_pred             CEEECcCCcccCcccHH-HhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhc-CCCCCEEEcc
Confidence            99999999998888877 788999999999999999888888999999999999999999888887766 8999999999


Q ss_pred             CCcCCCCCccchhccccCcEEEccCCccCCcCCchhhccCCCCCEEEccCCcccccc-----------------------
Q 042884          359 MNALDGSIPSSFGNINLLKILDLSNNQLTGEIPEHLAVGCVYLDFLALSNNSLEGKV-----------------------  415 (614)
Q Consensus       359 ~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~L~~L~l~~n~l~~~~-----------------------  415 (614)
                      +|++++.+|..++.+++|++|++++|++++.+|..+ ..+++|++|++++|++++..                       
T Consensus       499 ~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l-~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~  577 (768)
T 3rgz_A          499 NNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAEL-GDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVY  577 (768)
T ss_dssp             SSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGG-GGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEE
T ss_pred             CCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHH-cCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccc
Confidence            999999999999999999999999999998888776 68999999999999886421                       


Q ss_pred             -----------------------------------------------------cCCccEEEcCCCcCCccCCccccCCCc
Q 042884          416 -----------------------------------------------------LSLLSGLDLSCNKLIGHIPPQIGNLTR  442 (614)
Q Consensus       416 -----------------------------------------------------~~~L~~L~L~~n~l~~~~~~~~~~l~~  442 (614)
                                                                           +++|+.|+|++|++++.+|..++.+++
T Consensus       578 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~  657 (768)
T 3rgz_A          578 IKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPY  657 (768)
T ss_dssp             EECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTT
T ss_pred             cccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhcccc
Confidence                                                                 246889999999999999999999999


Q ss_pred             CCEEECcCCcCCCCCCcCCCCCCCCCEEEccCCcCCCCCcccccCCCCCCeEeccCCcCcccCCccccccCCcCcccccC
Q 042884          443 IQTLNLSHNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSLAFNNLSGEIPEWKAQFATFNESSYEG  522 (614)
Q Consensus       443 L~~L~L~~n~l~~~~~~~~~~l~~L~~L~ls~N~l~~~~~~~l~~l~~L~~L~l~~N~l~~~~~~~~~~~~~l~~~~~~~  522 (614)
                      |+.|+|++|++++.+|..++++++|+.|||++|++++.+|..+..+++|++|++++|+++|.+|. ..++.++....+.|
T Consensus       658 L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~-~~~~~~~~~~~~~g  736 (768)
T 3rgz_A          658 LFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPE-MGQFETFPPAKFLN  736 (768)
T ss_dssp             CCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCS-SSSGGGSCGGGGCS
T ss_pred             CCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCC-chhhccCCHHHhcC
Confidence            99999999999999999999999999999999999999999999999999999999999999998 56788889999999


Q ss_pred             CcCCCCCCCCCCCCCCCC
Q 042884          523 NTFLCGLPLPICRSPATT  540 (614)
Q Consensus       523 n~~~c~~~~~~c~~~~~~  540 (614)
                      ||.+|+.|+..|......
T Consensus       737 N~~Lcg~~l~~C~~~~~~  754 (768)
T 3rgz_A          737 NPGLCGYPLPRCDPSNAD  754 (768)
T ss_dssp             CTEEESTTSCCCCSCC--
T ss_pred             CchhcCCCCcCCCCCccC
Confidence            999999998888665443



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 614
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-21
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-19
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-11
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.004
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-08
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.003
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 7e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 9e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 8e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 7e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.001
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 94.7 bits (234), Expect = 2e-21
 Identities = 68/359 (18%), Positives = 136/359 (37%), Gaps = 26/359 (7%)

Query: 149 LMHLQELYKVNNDLRGSLPWCVANMTSLRILDVSSNQLTGSIASSPLAHLTSIEELHLSD 208
           L  +  L      ++ S+   V  + +L  ++ S+NQLT      PL +LT + ++ +++
Sbjct: 43  LDQVTTLQADRLGIK-SIDG-VEYLNNLTQINFSNNQLTDIT---PLKNLTKLVDILMNN 97

Query: 209 NHFRIPISLEPLFNHSRLKIFDAENNELNAEITESYSLTTPNFQLQYLLLSSGYGDGATF 268
           N       L  L N + L +F+ +  +++     +              +S+  G  +  
Sbjct: 98  NQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQ 157

Query: 269 PKFLYHQH-------DLEYVDLSHTKMNGEFPNWLLENNTKLKTLFLVNDSLAGPFRLPI 321
                +Q        +L  ++      N      +L   T L++L   N+ ++     P+
Sbjct: 158 QLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDIT--PL 215

Query: 322 HSHKRLRQLDVSNNNFQGHIPLEIGDILPNLISFNISMNALDGSIPSSFGNINLLKILDL 381
                L +L ++ N  +    L     L NL   +++ N +    P     +  L  L L
Sbjct: 216 GILTNLDELSLNGNQLKDIGTLAS---LTNLTDLDLANNQISNLAP--LSGLTKLTELKL 270

Query: 382 SNNQLTGEIPEH-LAVGCVYLDFLALSNNSLEGKVLSLLSGLDLSCNKLIGHIPPQIGNL 440
             NQ++   P   L              +      L  L+ L L  N +    P  + +L
Sbjct: 271 GANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISP--VSSL 328

Query: 441 TRIQTLNLSHNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSLAFN 499
           T++Q L  ++N ++    S+ +NL +I  L   +N+++   P  L  L  +    L   
Sbjct: 329 TKLQRLFFANNKVSD--VSSLANLTNINWLSAGHNQISDLTP--LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query614
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.85
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.85
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.79
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.78
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.77
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.51
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.5
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.5
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.43
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.42
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.41
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.28
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.23
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.27
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.01
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.69
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.6
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.18
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.12
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.96  E-value=1.2e-29  Score=251.03  Aligned_cols=255  Identities=31%  Similarity=0.511  Sum_probs=195.5

Q ss_pred             CCcEEEccCCCCCC--CCChhHHhcCCCccEEEccC-CCCCCCCCCCCCCCCccCEEEccCCccccCCChhhhhcCCCcc
Q 042884          277 DLEYVDLSHTKMNG--EFPNWLLENNTKLKTLFLVN-DSLAGPFRLPIHSHKRLRQLDVSNNNFQGHIPLEIGDILPNLI  353 (614)
Q Consensus       277 ~L~~L~Ls~n~i~~--~~~~~~~~~~~~L~~L~l~~-n~i~~~~~~~~~~l~~L~~L~l~~n~i~~~~~~~~~~~l~~L~  353 (614)
                      +++.|+|+++.+.+  .+|.. +..+++|++|++++ |.+.+..|..+..+++|++|++++|++.+..+..+. .++.|+
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~-l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~-~~~~L~  128 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSS-LANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLS-QIKTLV  128 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGG-GGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGG-GCTTCC
T ss_pred             EEEEEECCCCCCCCCCCCChH-HhcCccccccccccccccccccccccccccccchhhhcccccccccccccc-chhhhc
Confidence            46667777776665  35555 56677777777764 666665666677777777777777777644444333 366777


Q ss_pred             EEEccCCcCCCCCccchhccccCcEEEccCCccCCcCCchhhccCCCCCEEEccCCccccccc-----CCccEEEcCCCc
Q 042884          354 SFNISMNALDGSIPSSFGNINLLKILDLSNNQLTGEIPEHLAVGCVYLDFLALSNNSLEGKVL-----SLLSGLDLSCNK  428 (614)
Q Consensus       354 ~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~-----~~L~~L~L~~n~  428 (614)
                      .++++.|.+.+.+|..+..++.|+++++++|.+.+.+|..+......++.+++++|++++..+     .....++++++.
T Consensus       129 ~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~~~~  208 (313)
T d1ogqa_         129 TLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNM  208 (313)
T ss_dssp             EEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSE
T ss_pred             ccccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            777777777666777777777777777777777766666654333334667777777665332     234568889999


Q ss_pred             CCccCCccccCCCcCCEEECcCCcCCCCCCcCCCCCCCCCEEEccCCcCCCCCcccccCCCCCCeEeccCCcCcccCCcc
Q 042884          429 LIGHIPPQIGNLTRIQTLNLSHNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSLAFNNLSGEIPEW  508 (614)
Q Consensus       429 l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~ls~N~l~~~~~~~l~~l~~L~~L~l~~N~l~~~~~~~  508 (614)
                      ..+.+|..+..+++++.+++++|.+.+.++ .+..+++|+.|++++|++++.+|+.|.++++|++|+|++|+++|.+|+ 
T Consensus       209 ~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-  286 (313)
T d1ogqa_         209 LEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-  286 (313)
T ss_dssp             EEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-
T ss_pred             cccccccccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC-
Confidence            988999999999999999999999987655 688899999999999999999999999999999999999999999997 


Q ss_pred             ccccCCcCcccccCCcCCCCCCCCCCC
Q 042884          509 KAQFATFNESSYEGNTFLCGLPLPICR  535 (614)
Q Consensus       509 ~~~~~~l~~~~~~~n~~~c~~~~~~c~  535 (614)
                      +..+++++.+++.+|+.+|+.|++.|.
T Consensus       287 ~~~L~~L~~l~l~~N~~l~g~plp~c~  313 (313)
T d1ogqa_         287 GGNLQRFDVSAYANNKCLCGSPLPACT  313 (313)
T ss_dssp             STTGGGSCGGGTCSSSEEESTTSSCCC
T ss_pred             cccCCCCCHHHhCCCccccCCCCCCCC
Confidence            678899999999999999999998883



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure