Citrus Sinensis ID: 042890


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250----
MSKVKELRLNPNTFTKMPKLRFLKFYSSLFNGENKCKMSYLQDPGFAEVKYLHWHGYPLKSLPSNDIEQLWDRVKRYSKLNQIIHAACHKLIAKIPNPTLMPRMKKLVILNLRGSKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSGNISWLFLRGIAIEELPSSIERQLRLSWLDLSDCKRLKSLPSSLYRLKSLGILDLHGCSNLQRLPECLGQLSSPITCNLAKTNIERIPESIIQLFVSGYLLLSY
ccccccccccHHHHcccccccEEEEcccccccccccccccccccccccccEEEcccccccccccccHHHHHHcccccccccEEcccccccccccccccccccccccccEEccccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccHHHHccccccEEEcccccccccccccccccccccEEEEccccccccccccccccccccEEEccccccccccHHHHccccccEEEccc
cccccEcEccHHHHHHcHccEEEEEEccccccccEEccccccccccHHcEEEccccccccccccHHHHHcccccccHHcccEEEccccHHHHHcccccccHHHHHcccEEEccccccHccccccHHHHHHccEEEcccccHHHccccccHHHHHEEEccccccHcccccHHHHHcccEEEccccccHHccccHHcccccccEEEcccccHHcccccccccHHHHHHEccccccccccccHHHHHHcccEEEccc
mskvkelrlnpntftkmpklRFLKFYSSLfngenkckmsylqdpgfaevkylhwhgyplkslpsndiEQLWDRVKRYSKLNQIIHAACHKLIakipnptlmpRMKKLVILNLrgskslkslpsgifnlefltkldlsgcsklkrlpeissgnisWLFLRGIAIEELPSSIERQLRLSWldlsdckrlkslpsslyrlkslgildlhgcsnlqrlpeclgqlsspitcnlaktnieRIPESIIQLFVSGYLLLSY
mskvkelrlnpntftkmpklrFLKFYSSLFNGENKCKMSYLQDPGFAEVKYLHWHGYPLKSLPSNDIEQLWDRVKRYSKLNQIIHAACHKLIakipnptlmPRMKKLVILNLRGSKSLKSLPSGIFNLEFLTKLDLSGCSKLkrlpeissgnisWLFLRGIAIEELPSSIERQLRLSWLDLSDCKRLKSLPSSLYRLKSLGILDLHGCSNLQRLPECLGQLSSPITCNLAKTNIERIPESIIQLFVSGYLLLSY
MSKVKELRLNPNTFTKMPKLRFLKFYSSLFNGENKCKMSYLQDPGFAEVKYLHWHGYPLKSLPSNDIEQLWDRVKRYSKLNQIIHAACHKLIAKIPNPTLMPRMKKLVILNLRGSKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSGNISWLFLRGIAIEELPSSIERQLRLSWLDLSDCKRLKSLPSSLYRLKSLGILDLHGCSNLQRLPECLGQLSSPITCNLAKTNIERIPESIIQLFVSGYLLLSY
*************FTKMPKLRFLKFYSSLFNGENKCKMSYLQDPGFAEVKYLHWHGYPLKSLPSNDIEQLWDRVKRYSKLNQIIHAACHKLIAKIPNPTLMPRMKKLVILNLRGSKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSGNISWLFLRGIAIEELPSSIERQLRLSWLDLSDCKRLKSLPSSLYRLKSLGILDLHGCSNLQRLPECLGQLSSPITCNLAKTNIERIPESIIQLFVSGYLLL**
*SKVKELRLNPNTFTKMPKLRFLKFYSSLFNGENKCKMSYLQDPGFAEVKYLHWHGYPLKSLPSNDIEQLWDRVKRYSKLNQIIHAACHKLIAKIPNPTLMPRMKKLVILNLRGSKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSGNISWLFLRGIAIEELPSSIERQLRLSWLDLSDCKRLKSLPSSLYRLKSLGILDLHGCSNLQRLPECLGQLSSPITCNLAKTNIERIPESIIQLFVSGYLLLSY
MSKVKELRLNPNTFTKMPKLRFLKFYSSLFNGENKCKMSYLQDPGFAEVKYLHWHGYPLKSLPSNDIEQLWDRVKRYSKLNQIIHAACHKLIAKIPNPTLMPRMKKLVILNLRGSKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSGNISWLFLRGIAIEELPSSIERQLRLSWLDLSDCKRLKSLPSSLYRLKSLGILDLHGCSNLQRLPECLGQLSSPITCNLAKTNIERIPESIIQLFVSGYLLLSY
**KVKELRLNPNTFTKMPKLRFLKFYSSLFNGENKCKMSYLQDPGFAEVKYLHWHGYPLKSLPSNDIEQLWDRVKRYSKLNQIIHAACHKLIAKIPNPTLMPRMKKLVILNLRGSKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSGNISWLFLRGIAIEELPSSIERQLRLSWLDLSDCKRLKSLPSSLYRLKSLGILDLHGCSNLQRLPECLGQLSSPITCNLAKTNIERIPESIIQLFVSGYLLLSY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKVKELRLNPNTFTKMPKLRFLKFYSSLFNGENKCKMSYLQDPGFAEVKYLHWHGYPLKSLPSNDIEQLWDRVKRYSKLNQIIHAACHKLIAKIPNPTLMPRMKKLVILNLRGSKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSGNISWLFLRGIAIEELPSSIERQLRLSWLDLSDCKRLKSLPSSLYRLKSLGILDLHGCSNLQRLPECLGQLSSPITCNLAKTNIERIPESIIQLFVSGYLLLSY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query254 2.2.26 [Sep-21-2011]
Q9SZ67 1895 Probable WRKY transcripti no no 0.940 0.126 0.341 4e-28
O23530 1301 Protein SUPPRESSOR OF npr no no 0.712 0.139 0.371 3e-18
Q40392 1144 TMV resistance protein N N/A no 0.724 0.160 0.330 2e-14
Q9FL92 1372 Probable WRKY transcripti no no 0.834 0.154 0.290 2e-12
O82500 1095 Putative disease resistan no no 0.881 0.204 0.271 4e-12
Q9FH83 1288 Probable WRKY transcripti no no 0.846 0.166 0.293 3e-11
P0CB16 1201 Putative disease resistan no no 0.641 0.135 0.292 7e-11
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.893 0.140 0.242 1e-08
Q9RBS2 1024 Protein PopC OS=Ralstonia no no 0.606 0.150 0.317 2e-08
O81825 919 Probable disease resistan no no 0.677 0.187 0.288 7e-08
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function desciption
 Score =  125 bits (313), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 98/287 (34%), Positives = 146/287 (50%), Gaps = 48/287 (16%)

Query: 10   NPNTFTKMPKLRFLKFYSSLFNGENKCKMSYLQDPGF--AEVKYLHWHGYPLKS------ 61
            NPN F KM  LR LK Y S    E K  +S+ Q   +  ++++ LHW  YPL S      
Sbjct: 1168 NPNVFEKMCNLRLLKLYCS--KAEEKHGVSFPQGLEYLPSKLRLLHWEYYPLSSLPKSFN 1225

Query: 62   --------LPSNDIEQLWDRVK-RYSKLNQIIHAACHKLIAKIPNPTLMPRM-------- 104
                    LPS+  ++LW   K R+   N  +       ++     T +PR+        
Sbjct: 1226 PENLVELNLPSSCAKKLWKGKKARFCTTNSSLEKLKKMRLSYSDQLTKIPRLSSATNLEH 1285

Query: 105  -------------------KKLVILNLRGSKSLKSLPSGIFNLEFLTKLDLSGCSKLKRL 145
                               KKLV LNL+G   L+++PS + +LE L  L+LSGCSKL   
Sbjct: 1286 IDLEGCNSLLSLSQSISYLKKLVFLNLKGCSKLENIPS-MVDLESLEVLNLSGCSKLGNF 1344

Query: 146  PEISSGNISWLFLRGIAIEELPSSIERQLRLSWLDLSDCKRLKSLPSSLYRLKSLGILDL 205
            PEIS  N+  L++ G  I+E+PSSI+  + L  LDL + + LK+LP+S+Y+LK L  L+L
Sbjct: 1345 PEISP-NVKELYMGGTMIQEIPSSIKNLVLLEKLDLENSRHLKNLPTSIYKLKHLETLNL 1403

Query: 206  HGCSNLQRLPECLGQLSSPITCNLAKTNIERIPESIIQLFVSGYLLL 252
             GC +L+R P+   ++      +L++T+I+ +P SI  L     LL 
Sbjct: 1404 SGCISLERFPDSSRRMKCLRFLDLSRTDIKELPSSISYLTALDELLF 1450




Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. May act also as a disease resistance protein with a serine/threonine-protein kinase activity.
Arabidopsis thaliana (taxid: 3702)
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query254
298205188 1027 unnamed protein product [Vitis vinifera] 0.948 0.234 0.383 3e-33
359486071 1261 PREDICTED: TMV resistance protein N-like 0.952 0.191 0.377 1e-32
317415950 807 nematode resistance-like protein [Prunus 0.803 0.252 0.434 1e-32
317415955 806 nematode resistance-like protein [Prunus 0.795 0.250 0.442 2e-32
359486073 1296 PREDICTED: TMV resistance protein N-like 0.976 0.191 0.380 5e-32
359486075 1291 PREDICTED: TMV resistance protein N-like 0.976 0.192 0.373 3e-31
225460354 1174 PREDICTED: TMV resistance protein N-like 0.921 0.199 0.366 6e-31
147770134 1414 hypothetical protein VITISV_040107 [Viti 0.976 0.175 0.367 6e-30
255563202 1158 leucine-rich repeat containing protein, 0.921 0.202 0.365 7e-30
359496026 1250 PREDICTED: TMV resistance protein N-like 0.940 0.191 0.362 1e-29
>gi|298205188|emb|CBI17247.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  147 bits (372), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 110/287 (38%), Positives = 150/287 (52%), Gaps = 46/287 (16%)

Query: 1   MSKVKELRLNPNTFTKMPKLRFLKFYSSLFNG--ENKCKMSYLQDPGF--AEVKYLHWHG 56
           +S+   L ++   F KM KLR LK YSS + G  E + K+   +D  F   E++YLHW G
Sbjct: 402 LSRSTPLEVSTKIFAKMKKLRLLKIYSSGYYGTMEKQLKVILPEDFQFPAHELRYLHWEG 461

Query: 57  YPLKSLPSN--------------DIEQLWDRVKRYSKL---------------------- 80
           YP KSLPSN              +I+QL  R +R  +L                      
Sbjct: 462 YPFKSLPSNFLGVNLIELNMKDSNIKQLMQRNERLEQLKFLNLSGSRQLTETSFSNMPNL 521

Query: 81  NQIIHAACHKLIAKIPNPTLMPRMKKLVILNLRGSKSLKSLPSGIFNLEFLTKLDLSGCS 140
             +I A C  L   + +P++   +KKL +LNL G ++L SLPS I  L+ L  ++L  CS
Sbjct: 522 ETLILADCTSL--NVVDPSI-GDLKKLTVLNLLGCENLTSLPSSIQYLDSLEAMNLMTCS 578

Query: 141 KLKRLPEISSG---NISWLFLRGIAIEELPSSIERQLRLSWLDLSDCKRLKSLPSSLYRL 197
            L+  PE+       +S L L G  I+ELPSSIE   RL  L LS CK L+SLPSS+ RL
Sbjct: 579 NLEEFPEMKGSPMKALSDLLLDGCGIKELPSSIELLTRLKRLYLSKCKNLRSLPSSICRL 638

Query: 198 KSLGILDLHGCSNLQRLPECLGQLSSPITCNLAKTNIERIPESIIQL 244
           KSL  LDLHGCSNL   PE +  +    + ++  + I+ +P SI  L
Sbjct: 639 KSLVQLDLHGCSNLDTFPEIMEDMKCLESLDIRSSGIKELPSSIQNL 685




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359486071|ref|XP_002272667.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|317415950|emb|CAR94516.1| nematode resistance-like protein [Prunus cerasifera] Back     alignment and taxonomy information
>gi|317415955|emb|CAR94520.1| nematode resistance-like protein [Prunus cerasifera] Back     alignment and taxonomy information
>gi|359486073|ref|XP_002272820.2| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|359486075|ref|XP_002273047.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225460354|ref|XP_002263146.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147770134|emb|CAN76615.1| hypothetical protein VITISV_040107 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255563202|ref|XP_002522604.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223538080|gb|EEF39691.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359496026|ref|XP_002277166.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query254
TAIR|locus:2118116 1895 WRKY19 [Arabidopsis thaliana ( 0.736 0.098 0.372 3e-24
TAIR|locus:2081810 1226 AT3G51570 [Arabidopsis thalian 0.917 0.190 0.357 6e-22
TAIR|locus:2153363 1261 AT5G45200 [Arabidopsis thalian 0.913 0.183 0.332 1.3e-21
TAIR|locus:2153207 1165 AT5G45060 [Arabidopsis thalian 0.901 0.196 0.347 1.5e-21
TAIR|locus:2118106 1219 AT4G12010 [Arabidopsis thalian 0.551 0.114 0.436 3e-20
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.893 0.175 0.338 5.3e-20
TAIR|locus:2170333 1197 CSA1 "constitutive shade-avoid 0.535 0.113 0.467 6.1e-20
TAIR|locus:2129236 1301 SNC1 "SUPPRESSOR OF NPR1-1, CO 0.712 0.139 0.371 1.1e-19
TAIR|locus:2147992 1189 AT5G11250 [Arabidopsis thalian 0.862 0.184 0.330 7.1e-19
TAIR|locus:2158475 1217 RPS4 "RESISTANT TO P. SYRINGAE 0.744 0.155 0.377 9.3e-19
TAIR|locus:2118116 WRKY19 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 293 (108.2 bits), Expect = 3.0e-24, P = 3.0e-24
 Identities = 73/196 (37%), Positives = 117/196 (59%)

Query:    59 LKSLPSNDIEQLWDRVKRYSKLNQIIHA---ACHKLIAKIPNPTLMPRMKKLVILNLRGS 115
             LK +  +  +QL  ++ R S    + H     C+ L++   +   +  +KKLV LNL+G 
Sbjct:  1260 LKKMRLSYSDQL-TKIPRLSSATNLEHIDLEGCNSLLSLSQS---ISYLKKLVFLNLKGC 1315

Query:   116 KSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSGNISWLFLRGIAIEELPSSIERQLR 175
               L+++PS + +LE L  L+LSGCSKL   PEIS  N+  L++ G  I+E+PSSI+  + 
Sbjct:  1316 SKLENIPSMV-DLESLEVLNLSGCSKLGNFPEISP-NVKELYMGGTMIQEIPSSIKNLVL 1373

Query:   176 LSWLDLSDCKRLKSLPSSLYRLKSLGILDLHGCSNLQRLPECLGQLSSPITCNLAKTNIE 235
             L  LDL + + LK+LP+S+Y+LK L  L+L GC +L+R P+   ++      +L++T+I+
Sbjct:  1374 LEKLDLENSRHLKNLPTSIYKLKHLETLNLSGCISLERFPDSSRRMKCLRFLDLSRTDIK 1433

Query:   236 RIPESIIQLFVSGYLL 251
              +P SI  L     LL
Sbjct:  1434 ELPSSISYLTALDELL 1449


GO:0000166 "nucleotide binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0006952 "defense response" evidence=IEA
GO:0007165 "signal transduction" evidence=IEA
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0006944 "cellular membrane fusion" evidence=RCA
GO:0009556 "microsporogenesis" evidence=RCA
GO:0052543 "callose deposition in cell wall" evidence=RCA
TAIR|locus:2081810 AT3G51570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153207 AT5G45060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170333 CSA1 "constitutive shade-avoidance1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129236 SNC1 "SUPPRESSOR OF NPR1-1, CONSTITUTIVE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158475 RPS4 "RESISTANT TO P. SYRINGAE 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
PLN03210 1153 PLN03210, PLN03210, Resistant to P 4e-25
PLN03210 1153 PLN03210, PLN03210, Resistant to P 4e-21
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score =  103 bits (259), Expect = 4e-25
 Identities = 97/342 (28%), Positives = 149/342 (43%), Gaps = 100/342 (29%)

Query: 1   MSKVKELRLNPNTFTKMPKLRFLKFYSSLFNGENKCKMSYLQDPGF----AEVKYLHWHG 56
           + ++ EL ++ N F  M  L FLKFY+  +  + K ++ +    GF     +++ L W  
Sbjct: 541 IDEIDELHIHENAFKGMRNLLFLKFYTKKW--DQKKEVRWHLPEGFDYLPPKLRLLRWDK 598

Query: 57  YPLKSLPSN--------------DIEQLWDRVKRYSKLNQIIHAACHKLIAKIPNPTLMP 102
           YPL+ +PSN               +E+LWD V   + L  I       L  +IP+ ++  
Sbjct: 599 YPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLK-EIPDLSMAT 657

Query: 103 RMKKLVI---------------------LNLRGSKSLKSLPSGIFNLEFLTKLDLSGCSK 141
            ++ L +                     L++   ++L+ LP+GI NL+ L +L+LSGCS+
Sbjct: 658 NLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCSR 716

Query: 142 LKRLPEISSGNISWLFLRGIAIEELPSSI--------------------ERQLR------ 175
           LK  P+IS+ NISWL L   AIEE PS++                      Q        
Sbjct: 717 LKSFPDIST-NISWLDLDETAIEEFPSNLRLENLDELILCEMKSEKLWERVQPLTPLMTM 775

Query: 176 ----LSWLDLSDCKRLKSLPSS---LYRLKSLGI--------------------LDLHGC 208
               L+ L LSD   L  LPSS   L++L+ L I                    LDL GC
Sbjct: 776 LSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGINLESLESLDLSGC 835

Query: 209 SNLQRLPECLGQLSSPITCNLAKTNIERIPESIIQLFVSGYL 250
           S L+  P+    +S     NL++T IE +P  I +     +L
Sbjct: 836 SRLRTFPDISTNISD---LNLSRTGIEEVPWWIEKFSNLSFL 874


syringae 6; Provisional. Length = 1153

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 254
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.9
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.86
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.86
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.83
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.83
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.78
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.7
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.68
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.66
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.65
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.64
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.62
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.55
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.53
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.51
KOG0617264 consensus Ras suppressor protein (contains leucine 99.51
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.48
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.47
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.45
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.26
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.25
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.24
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.09
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.08
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.06
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.03
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.01
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.0
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.96
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.92
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.88
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.88
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.82
PLN03150623 hypothetical protein; Provisional 98.8
PLN03150623 hypothetical protein; Provisional 98.78
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.72
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.54
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.53
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.48
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.44
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.43
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.42
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.33
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.11
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.08
PRK15386 426 type III secretion protein GogB; Provisional 98.07
PRK15386 426 type III secretion protein GogB; Provisional 97.9
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.89
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.84
KOG4341483 consensus F-box protein containing LRR [General fu 97.83
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.81
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.79
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.76
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.76
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.72
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.62
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.52
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.14
KOG4341483 consensus F-box protein containing LRR [General fu 97.04
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.04
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.03
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.92
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.58
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.43
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.1
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.73
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.13
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.02
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.99
KOG4308 478 consensus LRR-containing protein [Function unknown 94.68
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.88
smart0037026 LRR Leucine-rich repeats, outliers. 92.78
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.78
KOG1947 482 consensus Leucine rich repeat proteins, some prote 92.38
KOG4308 478 consensus LRR-containing protein [Function unknown 92.23
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.02
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 83.13
KOG0473 326 consensus Leucine-rich repeat protein [Function un 82.42
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 82.13
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.90  E-value=2e-23  Score=194.99  Aligned_cols=229  Identities=25%  Similarity=0.303  Sum_probs=132.1

Q ss_pred             cCCCCcceEEEeeccccCCCccC----------------cccccCCCCC-CceeeeeeCCCCCC-CCCCcchhhcchhhh
Q 042890           14 FTKMPKLRFLKFYSSLFNGENKC----------------KMSYLQDPGF-AEVKYLHWHGYPLK-SLPSNDIEQLWDRVK   75 (254)
Q Consensus        14 ~~~~~~L~~L~l~~~~~~~~~~~----------------~~~~~~~l~~-~~L~~L~l~~~~~~-~l~~~~l~~l~~~~~   75 (254)
                      |..+++|++|++++|.+.+..+.                ....+..+.. ++|++|++.+|.+. .+|        ..+.
T Consensus       114 ~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p--------~~~~  185 (968)
T PLN00113        114 FTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIP--------NSLT  185 (968)
T ss_pred             hccCCCCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCC--------hhhh
Confidence            34777888888888776433211                0012222333 44444554444422 222        2255


Q ss_pred             cccccceehhhccCCceeecCCCCccCCcccccEEeccCCcCCCccCCCCCCCCcccEEeccCCCCCccccccc--cCCc
Q 042890           76 RYSKLNQIIHAACHKLIAKIPNPTLMPRMKKLVILNLRGSKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEIS--SGNI  153 (254)
Q Consensus        76 ~~~~L~~l~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~p~~~--~~~L  153 (254)
                      .+++|++|+++++.. .+.+|.  .+..+++|++|++++|.+.+.+|..+..+++|+.|++++|...+..|...  .++|
T Consensus       186 ~l~~L~~L~L~~n~l-~~~~p~--~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L  262 (968)
T PLN00113        186 NLTSLEFLTLASNQL-VGQIPR--ELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNL  262 (968)
T ss_pred             hCcCCCeeeccCCCC-cCcCCh--HHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCC
Confidence            566666666665442 233444  55566666666666666555566556666666666666665554444332  3556


Q ss_pred             CeEeccccccc-ccchhhhhccccCEEeccCCcCcccCCccccCCCccCEEEecCCCCCcccCccccCCCCCcEEeccCC
Q 042890          154 SWLFLRGIAIE-ELPSSIERQLRLSWLDLSDCKRLKSLPSSLYRLKSLGILDLHGCSNLQRLPECLGQLSSPITCNLAKT  232 (254)
Q Consensus       154 ~~L~l~~~~~~-~l~~~~~~~~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~n  232 (254)
                      +.|++.+|.++ .+|..+..+++|+.|++++|.+.+.+|..+.++++|+.|++++|.+.+..|..+..+++|+.|++++|
T Consensus       263 ~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n  342 (968)
T PLN00113        263 QYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSN  342 (968)
T ss_pred             CEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCC
Confidence            66666666655 45556666666666666666666666666666666666666666666666666666666666666666


Q ss_pred             CCC-CCChhhhhhcccCccccc
Q 042890          233 NIE-RIPESIIQLFVSGYLLLS  253 (254)
Q Consensus       233 ~l~-~l~~~~~~~~~L~~L~ls  253 (254)
                      .+. .+|..+..+++|+.|+++
T Consensus       343 ~l~~~~p~~l~~~~~L~~L~Ls  364 (968)
T PLN00113        343 KFSGEIPKNLGKHNNLTVLDLS  364 (968)
T ss_pred             CCcCcCChHHhCCCCCcEEECC
Confidence            665 556666666666666654



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 1e-08
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Iteration: 1

Score = 56.6 bits (135), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 44/130 (33%), Positives = 57/130 (43%), Gaps = 24/130 (18%) Query: 98 PTLMPRMKKLVILNLRGSKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSGNISWLF 157 P + ++ L L +R S L +L I +L L +LDL GC+ L+ P I G Sbjct: 199 PASIANLQNLKSLKIRNSP-LSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAP--- 254 Query: 158 LRGIAIEELPSSIERQLRLSWLDLSDCKRLKSLPSSLYRLKSLGILDLHGCSNLQRLPEC 217 L L L DC L +LP ++RL L LDL GC NL RLP Sbjct: 255 ------------------LKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSL 296 Query: 218 LGQLSSPITC 227 + QL P C Sbjct: 297 IAQL--PANC 304

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-19
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 9e-11
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-10
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-09
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-09
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-09
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 9e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-08
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-08
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-04
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-08
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-04
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-07
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 2e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-06
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-06
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-05
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 99.6 bits (249), Expect = 8e-25
 Identities = 41/154 (26%), Positives = 65/154 (42%), Gaps = 14/154 (9%)

Query: 103 RMKKLVILNLRGSKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPE-----------ISSG 151
           +   L  L L  +  L++LP+ I +L  L +L +  C +L  LPE               
Sbjct: 125 QFAGLETLTLARNP-LRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLV 183

Query: 152 NISWLFLRGIAIEELPSSIERQLRLSWLDLSDCKRLKSLPSSLYRLKSLGILDLHGCSNL 211
           N+  L L    I  LP+SI     L  L + +   L +L  +++ L  L  LDL GC+ L
Sbjct: 184 NLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSP-LSALGPAIHHLPKLEELDLRGCTAL 242

Query: 212 QRLPECLGQLSSPITCNLAKTN-IERIPESIIQL 244
           +  P   G  +      L   + +  +P  I +L
Sbjct: 243 RNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRL 276


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query254
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.92
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.92
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.92
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.92
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.92
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.92
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.91
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.91
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.91
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.91
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.91
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.9
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.9
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.9
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.9
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.9
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.9
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.9
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.9
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.89
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.89
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.89
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.89
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.88
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.88
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.88
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.88
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.88
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.87
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.87
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.87
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.87
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.86
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.86
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.85
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.85
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.84
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.83
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.83
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.82
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.81
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.79
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.79
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.78
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.77
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.76
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.76
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.75
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.74
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.73
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.72
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.7
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.69
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.69
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.69
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.67
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.66
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.65
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.65
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.64
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.64
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.57
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.57
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.55
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.54
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.54
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.52
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.47
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.47
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.46
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.44
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.44
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.43
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.43
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.41
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.34
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.34
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.33
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.33
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.33
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.27
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.17
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.13
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.12
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.1
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.91
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.8
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.69
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.62
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.5
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.45
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.44
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.41
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.24
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.19
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.12
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.11
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.03
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.9
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.45
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.36
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.84
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.42
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.22
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.96  E-value=1e-27  Score=196.99  Aligned_cols=217  Identities=23%  Similarity=0.296  Sum_probs=192.4

Q ss_pred             CCcceEEEeeccccCCCccCcccccCCCCC-CceeeeeeCCCCCCCCCCcchhhcchhhhcccccceehhhccCCceeec
Q 042890           17 MPKLRFLKFYSSLFNGENKCKMSYLQDPGF-AEVKYLHWHGYPLKSLPSNDIEQLWDRVKRYSKLNQIIHAACHKLIAKI   95 (254)
Q Consensus        17 ~~~L~~L~l~~~~~~~~~~~~~~~~~~l~~-~~L~~L~l~~~~~~~l~~~~l~~l~~~~~~~~~L~~l~l~~~~~~~~~~   95 (254)
                      .+++++|+++++.+       ..+|..+.. ++|++|++++|.++.+|..        +..+++|++|+++++.  ...+
T Consensus        80 ~~~l~~L~L~~n~l-------~~lp~~l~~l~~L~~L~L~~n~l~~lp~~--------~~~l~~L~~L~Ls~n~--l~~l  142 (328)
T 4fcg_A           80 QPGRVALELRSVPL-------PQFPDQAFRLSHLQHMTIDAAGLMELPDT--------MQQFAGLETLTLARNP--LRAL  142 (328)
T ss_dssp             STTCCEEEEESSCC-------SSCCSCGGGGTTCSEEEEESSCCCCCCSC--------GGGGTTCSEEEEESCC--CCCC
T ss_pred             ccceeEEEccCCCc-------hhcChhhhhCCCCCEEECCCCCccchhHH--------HhccCCCCEEECCCCc--cccC
Confidence            47899999999998       456777777 9999999999998888865        7889999999999876  4477


Q ss_pred             CCCCccCCcccccEEeccCCcCCCccCCCCCC---------CCcccEEeccCCCCCccccccc--cCCcCeEeccccccc
Q 042890           96 PNPTLMPRMKKLVILNLRGSKSLKSLPSGIFN---------LEFLTKLDLSGCSKLKRLPEIS--SGNISWLFLRGIAIE  164 (254)
Q Consensus        96 ~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~---------l~~L~~L~l~~~~~~~~~p~~~--~~~L~~L~l~~~~~~  164 (254)
                      |.  .+..+++|++|++++|.+.+.+|..+..         +++|+.|++++|.+. .+|...  .++|+.|++++|.++
T Consensus       143 p~--~l~~l~~L~~L~L~~n~~~~~~p~~~~~~~~~~~~~~l~~L~~L~L~~n~l~-~lp~~l~~l~~L~~L~L~~N~l~  219 (328)
T 4fcg_A          143 PA--SIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIR-SLPASIANLQNLKSLKIRNSPLS  219 (328)
T ss_dssp             CG--GGGGCTTCCEEEEEEETTCCCCCSCSEEEC-CCCEEESTTCCEEEEEEECCC-CCCGGGGGCTTCCEEEEESSCCC
T ss_pred             cH--HHhcCcCCCEEECCCCCCccccChhHhhccchhhhccCCCCCEEECcCCCcC-cchHhhcCCCCCCEEEccCCCCC
Confidence            76  8999999999999999888888877654         999999999998766 666543  479999999999999


Q ss_pred             ccchhhhhccccCEEeccCCcCcccCCccccCCCccCEEEecCCCCCcccCccccCCCCCcEEeccCCCCC-CCChhhhh
Q 042890          165 ELPSSIERQLRLSWLDLSDCKRLKSLPSSLYRLKSLGILDLHGCSNLQRLPECLGQLSSPITCNLAKTNIE-RIPESIIQ  243 (254)
Q Consensus       165 ~l~~~~~~~~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~n~l~-~l~~~~~~  243 (254)
                      .+|..+..+++|+.|++++|.+.+.+|..++++++|+.|++++|+..+.+|..+..+++|+.|++++|.+. .+|..+..
T Consensus       220 ~l~~~l~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~iP~~l~~  299 (328)
T 4fcg_A          220 ALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQ  299 (328)
T ss_dssp             CCCGGGGGCTTCCEEECTTCTTCCBCCCCTTCCCCCCEEECTTCTTCCBCCTTGGGCTTCCEEECTTCTTCCCCCGGGGG
T ss_pred             cCchhhccCCCCCEEECcCCcchhhhHHHhcCCCCCCEEECCCCCchhhcchhhhcCCCCCEEeCCCCCchhhccHHHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999998875 89999999


Q ss_pred             hcccCccccc
Q 042890          244 LFVSGYLLLS  253 (254)
Q Consensus       244 ~~~L~~L~ls  253 (254)
                      +++|+.+++.
T Consensus       300 L~~L~~l~l~  309 (328)
T 4fcg_A          300 LPANCIILVP  309 (328)
T ss_dssp             SCTTCEEECC
T ss_pred             ccCceEEeCC
Confidence            9999988764



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 254
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Leucine rich effector protein YopM
domain: Leucine rich effector protein YopM
species: Yersinia pestis [TaxId: 632]
 Score = 37.9 bits (86), Expect = 8e-04
 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 7/91 (7%)

Query: 159 RGIAIEELPSSIERQLRLSWLDLSDCKRLKSLPSSLYRLKSLGILDLHGCSNLQRLPECL 218
           R +A+  L   ++RQ     L+L++   L SLP     L+SL       C++L  LPE  
Sbjct: 25  REMAVSRLRDCLDRQAHE--LELNNLG-LSSLPELPPHLESLVA----SCNSLTELPELP 77

Query: 219 GQLSSPITCNLAKTNIERIPESIIQLFVSGY 249
             L S +  N     +  +P  +  L VS  
Sbjct: 78  QSLKSLLVDNNNLKALSDLPPLLEYLGVSNN 108


>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query254
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.86
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.84
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.83
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.83
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.82
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.82
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.79
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.73
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.68
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.6
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.53
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.51
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.51
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.51
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.46
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.44
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.39
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.34
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.26
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.21
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.21
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.17
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.16
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.07
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.01
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.42
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.95
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.84
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.71
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.46
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.13
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.88  E-value=6.5e-23  Score=165.30  Aligned_cols=225  Identities=16%  Similarity=0.154  Sum_probs=133.3

Q ss_pred             cccCCCCcceEEEeec-cccCCCccCcccccCCCCC-CceeeeeeCCCCCCCCCCcchhhcchhhhcccccceehhhccC
Q 042890           12 NTFTKMPKLRFLKFYS-SLFNGENKCKMSYLQDPGF-AEVKYLHWHGYPLKSLPSNDIEQLWDRVKRYSKLNQIIHAACH   89 (254)
Q Consensus        12 ~~~~~~~~L~~L~l~~-~~~~~~~~~~~~~~~~l~~-~~L~~L~l~~~~~~~l~~~~l~~l~~~~~~~~~L~~l~l~~~~   89 (254)
                      ++|+++++|++|++++ |.+.|      .+|..+.. ++|++|++++|.+..++..       .+..+..|+.++++.+.
T Consensus        70 ~~l~~L~~L~~L~Ls~~N~l~g------~iP~~i~~L~~L~~L~Ls~N~l~~~~~~-------~~~~~~~L~~l~l~~N~  136 (313)
T d1ogqa_          70 SSLANLPYLNFLYIGGINNLVG------PIPPAIAKLTQLHYLYITHTNVSGAIPD-------FLSQIKTLVTLDFSYNA  136 (313)
T ss_dssp             GGGGGCTTCSEEEEEEETTEES------CCCGGGGGCTTCSEEEEEEECCEEECCG-------GGGGCTTCCEEECCSSE
T ss_pred             hHHhcCcccccccccccccccc------ccccccccccccchhhhccccccccccc-------cccchhhhccccccccc
Confidence            3445555555555543 33311      23334444 5555555555544333221       13344455555554332


Q ss_pred             CceeecCCCCccCCcccccEEeccCCcCCCccCCCCCCCCcc-cEEeccCCCCCccccccc-cCCcCeEeccccccc-cc
Q 042890           90 KLIAKIPNPTLMPRMKKLVILNLRGSKSLKSLPSGIFNLEFL-TKLDLSGCSKLKRLPEIS-SGNISWLFLRGIAIE-EL  166 (254)
Q Consensus        90 ~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L-~~L~l~~~~~~~~~p~~~-~~~L~~L~l~~~~~~-~l  166 (254)
                      . ...+|.  .+..++.++.+++++|.+.+.+|..+..+.++ +.+++++|++.+..|... ......+++..+... .+
T Consensus       137 ~-~~~~p~--~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~~~~~~~~~  213 (313)
T d1ogqa_         137 L-SGTLPP--SISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDA  213 (313)
T ss_dssp             E-ESCCCG--GGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSEEEECC
T ss_pred             c-cccCch--hhccCcccceeecccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            1 223333  45555555555555555444455444444443 445555544443333322 123334555555444 34


Q ss_pred             chhhhhccccCEEeccCCcCcccCCccccCCCccCEEEecCCCCCcccCccccCCCCCcEEeccCCCCC-CCChhhhhhc
Q 042890          167 PSSIERQLRLSWLDLSDCKRLKSLPSSLYRLKSLGILDLHGCSNLQRLPECLGQLSSPITCNLAKTNIE-RIPESIIQLF  245 (254)
Q Consensus       167 ~~~~~~~~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~n~l~-~l~~~~~~~~  245 (254)
                      |..+...++++.+++++|.+.+.++ .++.+++|+.|++++|++.+.+|..++++++|+.|++++|.+. .+|. +.+++
T Consensus       214 ~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~  291 (313)
T d1ogqa_         214 SVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQ  291 (313)
T ss_dssp             GGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STTGG
T ss_pred             ccccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC-cccCC
Confidence            5556677888999999888766654 5788899999999999888889999999999999999999998 7775 57788


Q ss_pred             ccCcccccC
Q 042890          246 VSGYLLLSY  254 (254)
Q Consensus       246 ~L~~L~ls~  254 (254)
                      +|+.+++++
T Consensus       292 ~L~~l~l~~  300 (313)
T d1ogqa_         292 RFDVSAYAN  300 (313)
T ss_dssp             GSCGGGTCS
T ss_pred             CCCHHHhCC
Confidence            888888764



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure