Citrus Sinensis ID: 042944


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------
MGMREQVNLVMCRQKEVELTMCRREQAELAMCRRKQVELTMYRREQVELAISPINSFILKLMMALSKNSQNAIITVFNTCIVTITSLASLRDLYLASSTLLSINRPSLSSMNSSTSLTLLDLSSCGLSNSAYHWLFKISSNLLALDLNSNQLAGPIPDYAFSNMTALQHLNLSLNQISAISKSFGNMCGLKTLHLFDNNLTGQLPELFLNLSGCSKNSLEILKLGGNKLTGSLPDITEFSSLQELHLFDNKLDGSFPEKFRKPSPLVILNLDGNQLWGSLPDLSVFPFLTRLDVSDSRLNGTVSEGLGRLSKLEFLDLFGNSLEGMITESHVSNLSKLKYMDFSFNSLALNFSFGWLPPFQLESIGLLHCKLGPHFPKWLQSQKNYYFLDISDTEISDAVPSWFWDLSPNLYYLNLSHNHLEGTVLDLSLNYAGYPGIDLSSNDFEGPVPPVPGNVTSLNLSNNKFSGPISSLCSISGEYFSYLDVSDNLLSGELPDCLLRWQALAVLNLANNNFSGNFLTFFVGEIPPSLKKCNELKIIDAGDNKFSGTIPAWIGDTLPKLAILSLRSNQFHGSIPRNLCRLSKIQLLDFSLNSISGAIPKCINNLTAMVEKASSNSTITHIYVYYRSATLDGFVS
ccccccccccccccccccccccccEEEccccccccEEEEEcccccccccccccccccccccEEEcccccccccccccccccccccccccccEEEccccccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccccccccccccccccccccEEEccccccccccHHccccccccEEEcccccccccccHHHHHccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEEcHHHHcccccccEEEccccEEEEEccccccccccccEEEccccccccccHHHHcccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEccccccccccccccccccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccHHHHccccccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHHHHHccccccccccccccccccccccccccc
ccccHHHHHHHHHHccccccccccccccccccccEEEEEEcccccccccccHHHcccccccEEEEccccccccccccccccHHHccccccEEEEcccccccccccccHHHHccccccEEEEEccccccccccHHHHHHHHHccEEEcccccccccccHHHHHccccccEEEccccccccccHHHcccccccEEEEccccccccccHHHHcccHcccccccEEEEcccccccccccccccccccEEEEccccccccccHHHccccccEEEEEcccccccccccccccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHHcccccccEEEEccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHHHHcccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHccccEEEcccccccccccHHHHHHcccccEEEcccccccccccHHHccccccEEEEcccccccccccccccccccHHHcccccccEEEcccccccccccHHHHHHHHHccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHHcHHHHcc
MGMREQVNLVMCRQKEVELTMCRREQAELAMCRRKQVELTMYRREQVELAISPINSFILKLMMALSKNSQNAIITVFNTCIVTITSLASLRDLYLASStllsinrpslssmnsstsltlldlsscglsnsaYHWLFKISSNLLaldlnsnqlagpipdyafsNMTALQHLNLSLNQISAISKSFgnmcglktlhlfdnnltgqlpelflnlsgcsknSLEILKLGgnkltgslpditefsslqelhlfdnkldgsfpekfrkpsplvilnldgnqlwgslpdlsvfpfltrldvsdsrlngtvseglgrlsklEFLDLFGNSLEGMITESHVsnlsklkymdfSFNSLalnfsfgwlppfqlesigllhcklgphfpkwlqsqknyyfldisdteisdavpswfwdlspnlyylnLSHNHLEGTVLDLslnyagypgidlssndfegpvppvpgnvtslnlsnnkfsgpisslcsisgeyfsyldvsdnllsgelpdCLLRWQALAVLNLannnfsgnfltffvgeippslkkcnelkiidagdnkfsgtipawigdtlpKLAILSLrsnqfhgsiprnlcrlsKIQLLDFSLNSISGAIPKCINNLTAMVEKASSNSTITHIYVYYRSatldgfvs
mgmreqvnlvmcrqkevelTMCRREQAELAMCRRKQVELTMYRREQVELAISPINSFILKLMMALSKNSQNAIITVFNTCIVTITSLASLRDLYLASSTLlsinrpslssmNSSTSLTLLDLSSCGLSNSAYHWLFKISSNLLALDLNSNQLAGPIPDYAFSNMTALQHLNLSLNQISAISKSFGNMCGLKTLHLFDNNLTGQLPELFLNLSGCSKNSLEILKLGGNKLTGSLPDITEFSSLQELHLFDNKLDGSFPEKFRKPSPLVILNLDGNQLWGSLPDLSVFPFLTRLDVSDSRLNGTvseglgrlskLEFLDLFGNSLEGMITESHVSNLSKLKYMDFSFNSLALNFSFGWLPPFQLESIGLLHCKLGPHFPKWLQSQKNYYFLDISDTEISDAVPSWFWDLSPNLYYLNLSHNHLEGTVLDLSLNYAGYPGIDLSSNDFEGPVPPVPGNVTSLNLSNNKFSGPISSLCSISGEYFSYLDVSDNLLSGELPDCLLRWQALAVLNLANNNFSGNFLTFFVGEIPPSLKKCNELKIIDAGDNKFSGTIPAWIGDTLPKLAILSLRSNQFHGSIPRNLCRLSKIQLLDFSLNSISGAIPKCINNLTAMVEKASSNSTITHIYVYYRSATLDGFVS
MGMREQVNLVMCRQKEVELTMCRREQAELAMCRRKQVELTMYRREQVELAISPINSFILKLMMALSKNSQNAIITVFNTCIVTITSLASLRDLYLASSTLLSINRPslssmnsstsltlldlsscglsNSAYHWLFKIssnllaldlnsnqlAGPIPDYAFSNMTALQHLNLSLNQISAISKSFGNMCGLKTLHLFDNNLTGQLPELFLNLSGCSKNSLEILKLGGNKLTGSLPDITEFSSLQELHLFDNKLDGSFPEKFRKPSPLVILNLDGNQLWGSLPDLSVFPFLTRLDVSDSRLNGTVSEGLGRLSKLEFLDLFGNSLEGMITESHVSNLSKLKYMDfsfnslalnfsfGWLPPFQLESIGLLHCKLGPHFPKWLQSQKNYYFLDISDTEISDAVPSWFWDlspnlyylnlshnhlEGTVLDLSLNYAGYPGIDLSSNDFEGPVPPVPGNVTSLNLSNNKFSGPISSLCSISGEYFSYLDVSDNLLSGELPDCLLRWQalavlnlannnFSGNFLTFFVGEIPPSLKKCNELKIIDAGDNKFSGTIPAWIGDTLPKLAILSLRSNQFHGSIPRNLCRLSKIQLLDFSLNSISGAIPKCINNLTAMVEKASSNSTITHIYVYYRSATLDGFVS
*******NLVMCRQKEVELTMCRREQAELAMCRRKQVELTMYRREQVELAISPINSFILKLMMALSKNSQNAIITVFNTCIVTITSLASLRDLYLASSTLLSIN************LTLLDLSSCGLSNSAYHWLFKISSNLLALDLNSNQLAGPIPDYAFSNMTALQHLNLSLNQISAISKSFGNMCGLKTLHLFDNNLTGQLPELFLNLSGCSKNSLEILKLGGNKLTGSLPDITEFSSLQELHLFDNKLDGSFPEKFRKPSPLVILNLDGNQLWGSLPDLSVFPFLTRLDVSDSRLNGTVSEGLGRLSKLEFLDLFGNSLEGMITESHVSNLSKLKYMDFSFNSLALNFSFGWLPPFQLESIGLLHCKLGPHFPKWLQSQKNYYFLDISDTEISDAVPSWFWDLSPNLYYLNLSHNHLEGTVLDLSLNYAGYPGIDLSSN***************LNLSNNKFSGPISSLCSISGEYFSYLDVSDNLLSGELPDCLLRWQALAVLNLANNNFSGNFLTFFVGEIPPSLKKCNELKIIDAGDNKFSGTIPAWIGDTLPKLAILSLRSNQFHGSIPRNLCRLSKIQLLDFSLNSISGAIPKCINNLTAMVEKASSNSTITHIYVYYRSATLDG***
MGM**QVNLVMCRQKEVELTMCRREQAELAMCRRKQVELTMYRREQVELAISPINSFILKLMMALSKNSQNAIITVFNTCIVTITSLASLRDLYLASSTLLSINRPSLSSMNSSTSLTLLDLSSCGLSNSAYHWLFKISSNLLALDLNSNQLAGPIPDYAFSNMTALQHLNLSLNQISAISKSFGNMCGLKTLHLFDNNLTGQLPELFLNLSGCSKNSLEILKLGGNKLTGSLPDITEFSSLQELHLFDNKLDGSFPEKFRKPSPLVILNLDGNQLWGSLPDLSVFPFLTRLDVSDSRLNGTVSEGLGRLSKLEFLDLFGNSLEGMITESHVSNLSKLKYMDFSFNSLALNFSFGWLPPFQLESIGLLHCKLGPHFPKWLQSQKNYYFLDISDTEISDAVPSWFWDLSPNLYYLNLSHNHLEGTVLDLSLNYAGYPGIDLSSNDFEGPVPPVPGNVTSLNLSNNKFSGPISSLCSISGEYFSYLDVSDNLLSGELPDCLLRWQALAVLNLANNNFSGNFLTFFVGEIPPSLKKCNELKIIDAGDNKFSGTIPAWIGDTLPKLAILSLRSNQFHGSIPRNLCRLSKIQLLDFSLNSISGAIPKCINNLTAMVEKASSNSTITHIYVYYRSATLDGFVS
MGMREQVNLVMCRQKEVELTMCRREQAELAMCRRKQVELTMYRREQVELAISPINSFILKLMMALSKNSQNAIITVFNTCIVTITSLASLRDLYLASSTLLSINRPSLSSMNSSTSLTLLDLSSCGLSNSAYHWLFKISSNLLALDLNSNQLAGPIPDYAFSNMTALQHLNLSLNQISAISKSFGNMCGLKTLHLFDNNLTGQLPELFLNLSGCSKNSLEILKLGGNKLTGSLPDITEFSSLQELHLFDNKLDGSFPEKFRKPSPLVILNLDGNQLWGSLPDLSVFPFLTRLDVSDSRLNGTVSEGLGRLSKLEFLDLFGNSLEGMITESHVSNLSKLKYMDFSFNSLALNFSFGWLPPFQLESIGLLHCKLGPHFPKWLQSQKNYYFLDISDTEISDAVPSWFWDLSPNLYYLNLSHNHLEGTVLDLSLNYAGYPGIDLSSNDFEGPVPPVPGNVTSLNLSNNKFSGPISSLCSISGEYFSYLDVSDNLLSGELPDCLLRWQALAVLNLANNNFSGNFLTFFVGEIPPSLKKCNELKIIDAGDNKFSGTIPAWIGDTLPKLAILSLRSNQFHGSIPRNLCRLSKIQLLDFSLNSISGAIPKCINNLTAMVEKASSNSTITHIYVYYRSATLDGFVS
MGMREQVNLVMCRQKEVELTMCRREQAELAMCRRKQVELTMYRREQVELAISPINSFILKLMMALSKNSQNAIITVFNTCIVTITSLASLRDLYLASSTLLSINRPSLSSMNSSTSLTLLDLSSCGLSNSAYHWLFKISSNLLALDLNSNQLAGPIPDYAFSNMTALQHLNLSLNQISAISKSFGNMCGLKTLHLFDNNLTGQLPELFLNLSGCSKNSLEILKLGGNKLTGSLPDITEFSSLQELHLFDNKLDGSFPEKFRKPSPLVILNLDGNQLWGSLPDLSVFPFLTRLDVSDSRLNGTVSEGLGRLSKLEFLDLFGNSLEGMITESHVSNLSKLKYMDFSFNSLALNFSFGWLPPFQLESIGLLHCKLGPHFPKWLQSQKNYYFLDISDTEISDAVPSWFWDLSPNLYYLNLSHNHLEGTVLDLSLNYAGYPGIDLSSNDFEGPVPPVPGNVTSLNLSNNKFSGPISSLCSISGEYFSYLDVSDNLLSGELPDCLLRWQALAVLNLANNNFSGNFLTFFVGEIPPSLKKCNELKIIDAGDNKFSGTIPAWIGDTLPKLAILSLRSNQFHGSIPRNLCRLSKIQLLDFSLNSISGAIPKCINNLTAMVEKASSNSTITHIYVYYRSATLDGF*S
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGMREQVNLVMCRQKEVELTMCRREQAELAMCRRKQVELTMYRREQVELAISPINSFILKLMMALSKNSQNAIITVFNTCIVTITSLASLRDLYLASSTLLSINRPSLSSMNSSTSLTLLDLSSCGLSNSAYHWLFKISSNLLALDLNSNQLAGPIPDYAFSNMTALQHLNLSLNQISAISKSFGNMCGLKTLHLFDNNLTGQLPELFLNLSGCSKNSLEILKLGGNKLTGSLPDITEFSSLQELHLFDNKLDGSFPEKFRKPSPLVILNLDGNQLWGSLPDLSVFPFLTRLDVSDSRLNGTVSEGLGRLSKLEFLDLFGNSLEGMITESHVSNLSKLKYMDFSFNSLALNFSFGWLPPFQLESIGLLHCKLGPHFPKWLQSQKNYYFLDISDTEISDAVPSWFWDLSPNLYYLNLSHNHLEGTVLDLSLNYAGYPGIDLSSNDFEGPVPPVPGNVTSLNLSNNKFSGPISSLCSISGEYFSYLDVSDNLLSGELPDCLLRWQALAVLNLANNNFSGNFLTFFVGEIPPSLKKCNELKIIDAGDNKFSGTIPAWIGDTLPKLAILSLRSNQFHGSIPRNLCRLSKIQLLDFSLNSISGAIPKCINNLTAMVEKASSNSTITHIYVYYRSATLDGFVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query637 2.2.26 [Sep-21-2011]
C0LGQ5 1249 LRR receptor-like serine/ no no 0.693 0.353 0.316 3e-44
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.731 0.372 0.308 4e-41
C0LGW6 966 LRR receptor-like serine/ no no 0.643 0.424 0.328 2e-39
O49318 1124 Probable leucine-rich rep no no 0.706 0.400 0.301 3e-38
Q9LHP4 1141 Receptor-like protein kin no no 0.701 0.391 0.319 3e-38
Q42371 976 LRR receptor-like serine/ no no 0.675 0.440 0.309 5e-38
Q6XAT2 967 LRR receptor-like serine/ no no 0.653 0.430 0.316 2e-37
Q9FL28 1173 LRR receptor-like serine/ no no 0.670 0.364 0.310 4e-37
Q8VZG8 1045 Probable LRR receptor-lik no no 0.791 0.482 0.298 4e-37
Q9SHI2 1101 Leucine-rich repeat recep no no 0.772 0.446 0.301 5e-37
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function desciption
 Score =  180 bits (456), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 154/486 (31%), Positives = 241/486 (49%), Gaps = 44/486 (9%)

Query: 120 LDLSSCGLSNSAYHWLFKISSNLLALDLNSNQLAGPIPDYAFSNMTALQHLNLSLNQISA 179
           L+L+  GL+ S   W  +   NL+ LDL+SN L GPIP  A SN+T+L+ L L  NQ++ 
Sbjct: 76  LNLTGLGLTGSISPWFGRFD-NLIHLDLSSNNLVGPIP-TALSNLTSLESLFLFSNQLTG 133

Query: 180 -ISKSFGNMCGLKTLHLFDNNLTGQLPELFLNLSGCSKNSLEILKLGGNKLTGSLP-DIT 237
            I    G++  +++L + DN L G +PE   NL      +L++L L   +LTG +P  + 
Sbjct: 134 EIPSQLGSLVNIRSLRIGDNELVGDIPETLGNLV-----NLQMLALASCRLTGPIPSQLG 188

Query: 238 EFSSLQELHLFDNKLDGSFPEKFRKPSPLVILNLDGNQLWGSLP-DLSVFPFLTRLDVSD 296
               +Q L L DN L+G  P +    S L +     N L G++P +L     L  L++++
Sbjct: 189 RLVRVQSLILQDNYLEGPIPAELGNCSDLTVFTAAENMLNGTIPAELGRLENLEILNLAN 248

Query: 297 SRLNGTVSEGLGRLSKLEFLDLFGNSLEGMITESHVSNLSKLKYMDFSFNSLALNFSFGW 356
           + L G +   LG +S+L++L L  N L+G+I +S +++L  L+ +D S N+L       +
Sbjct: 249 NSLTGEIPSQLGEMSQLQYLSLMANQLQGLIPKS-LADLGNLQTLDLSANNLTGEIPEEF 307

Query: 357 LPPFQLESIGLLHCKLGPHFPKWLQSQK-NYYFLDISDTEISDAVPSWFWDLSPNLYYLN 415
               QL  + L +  L    PK + S   N   L +S T++S  +P        +L  L+
Sbjct: 308 WNMSQLLDLVLANNHLSGSLPKSICSNNTNLEQLVLSGTQLSGEIPVELSKCQ-SLKQLD 366

Query: 416 LSHNHLEGTVLDLSLNYAGYPGIDLSSNDFEGPVPPVPGNVTSLNLSNNKFSGPISSLCS 475
           LS+N L G++ +          + L +N  EG + P   N+T+L                
Sbjct: 367 LSNNSLAGSIPEALFELVELTDLYLHNNTLEGTLSPSISNLTNL---------------- 410

Query: 476 ISGEYFSYLDVSDNLLSGELPDCLLRWQALAVLNLANNNFSGNFLTFFVGEIPPSLKKCN 535
                  +L +  N L G+LP  +   + L VL L  N FS        GEIP  +  C 
Sbjct: 411 ------QWLVLYHNNLEGKLPKEISALRKLEVLFLYENRFS--------GEIPQEIGNCT 456

Query: 536 ELKIIDAGDNKFSGTIPAWIGDTLPKLAILSLRSNQFHGSIPRNLCRLSKIQLLDFSLNS 595
            LK+ID   N F G IP  IG  L +L +L LR N+  G +P +L    ++ +LD + N 
Sbjct: 457 SLKMIDMFGNHFEGEIPPSIG-RLKELNLLHLRQNELVGGLPASLGNCHQLNILDLADNQ 515

Query: 596 ISGAIP 601
           +SG+IP
Sbjct: 516 LSGSIP 521




Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description
>sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query637
224105891 1036 predicted protein [Populus trichocarpa] 0.794 0.488 0.505 1e-131
255560149 1010 serine-threonine protein kinase, plant-t 0.777 0.490 0.482 1e-128
224097947 1086 predicted protein [Populus trichocarpa] 0.841 0.493 0.476 1e-127
224116866 994 predicted protein [Populus trichocarpa] 0.795 0.510 0.475 1e-126
224116870 1084 predicted protein [Populus trichocarpa] 0.783 0.460 0.491 1e-125
225464712 1021 PREDICTED: receptor-like protein 12-like 0.838 0.523 0.465 1e-121
359490572 975 PREDICTED: probable LRR receptor-like se 0.836 0.546 0.462 1e-118
224105895 963 predicted protein [Populus trichocarpa] 0.791 0.523 0.454 1e-117
224125666 938 predicted protein [Populus trichocarpa] 0.786 0.534 0.462 1e-112
359490576 972 PREDICTED: LRR receptor-like serine/thre 0.843 0.552 0.451 1e-111
>gi|224105891|ref|XP_002333752.1| predicted protein [Populus trichocarpa] gi|222838400|gb|EEE76765.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  474 bits (1221), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 270/534 (50%), Positives = 354/534 (66%), Gaps = 28/534 (5%)

Query: 103 INRPSLSSMNSSTSLTLLDLSSCGLSNSAYHWLFKISSNLLALDLNSNQLAGPIPDYAFS 162
           I  PSLS +NSS SL ++D S   LS+S +HWL    ++L+ LDL+ N L G IPD  F+
Sbjct: 233 IGSPSLSLVNSSESLAIVDFSFNDLSSSIFHWLANFGNSLIDLDLSHNNLQGSIPD-VFT 291

Query: 163 NMTALQHLNLSLNQISAISKSFGNMCGLKTLHLFDNNLTGQLPELFLNLSGCSKNSLEIL 222
           NMT+L+ L+LS NQ+     SFG MC L  L + +NNL G+L +LF    GC +NSLEIL
Sbjct: 292 NMTSLRTLDLSSNQLQGDLSSFGQMCSLNKLCISENNLIGELSQLF----GCVENSLEIL 347

Query: 223 KLGGNKLTGSLPDITEFSSLQELHLFDNKLDGSFPEKFRKPSPLVILNLDGNQLWGSLPD 282
           +L  N+L GSLPDIT F+S++EL+L  N+L+GS PE+F + S LV+L L+ NQL GSL D
Sbjct: 348 QLDRNQLYGSLPDITRFTSMRELNLSGNQLNGSLPERFSQRSELVLLYLNDNQLTGSLTD 407

Query: 283 LSVFPFLTRLDVSDSRLNGTVSEGLGRLSKLEFLDLFGNSLEGMITESHVSNLSKLKYMD 342
           +++   L  L +S++RL+G VSE +G L +LE L + GNSL+G+++E+H SNLSKL  +D
Sbjct: 408 VAMLSSLRELGISNNRLDGNVSESIGSLFQLEKLHVGGNSLQGVMSEAHFSNLSKLTVLD 467

Query: 343 FSFNSLALNFSFGWLPPFQLESIGLLHCKLGPHFPKWLQSQKNYYFLDISDTEISDAVPS 402
            + NSLAL F   W P FQL+ I L  C LGP FP+WL++Q N+  LDIS + ISD +P+
Sbjct: 468 LTDNSLALKFESNWAPTFQLDRIFLSSCDLGPPFPQWLRNQTNFMELDISGSRISDTIPN 527

Query: 403 WFWDLS-PNLYYLNLSHNHLEGTVLDLSLNYAGYPGIDLSSNDFEGPVPPVPGNVTS-LN 460
           WFW+LS   L  L+LSHN + G + D S  YA    IDLS N FEGP+P    + TS L 
Sbjct: 528 WFWNLSNSKLELLDLSHNKMSGLLPDFSSKYANLRSIDLSFNQFEGPLPHFSSDTTSTLF 587

Query: 461 LSNNKFSGPISSLCSISGEYFSYLDVSDNLLSGELPDCLLRWQALAVLNLANNNFSGNFL 520
           LSNNKFS      C I  +    LD+S+NLL+G +PDCL   + L VLNLA+NNFSG   
Sbjct: 588 LSNNKFSASFR--CDIGSDILRVLDLSNNLLTGSIPDCL---RGLVVLNLASNNFSGKIP 642

Query: 521 T----------------FFVGEIPPSLKKCNELKIIDAGDNKFSGTIPAWIGDTLPKLAI 564
           +                 FVGE+P SL+ C+ L  +D   NK  G IP WIG+++P L +
Sbjct: 643 SSIGSMLELQTLSLHNNSFVGELPLSLRSCSSLVFLDLSSNKLRGEIPGWIGESMPSLKV 702

Query: 565 LSLRSNQFHGSIPRNLCRLSKIQLLDFSLNSISGAIPKCINNLTAMVEKASSNS 618
           LSL+SN F GSIP NLC LS I +LD SLN+ISG IPKC+NNLT+MV+K  S S
Sbjct: 703 LSLQSNGFSGSIPPNLCHLSNILILDLSLNNISGIIPKCLNNLTSMVQKTESES 756




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255560149|ref|XP_002521092.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223539661|gb|EEF41243.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224097947|ref|XP_002334582.1| predicted protein [Populus trichocarpa] gi|222873265|gb|EEF10396.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224116866|ref|XP_002331833.1| predicted protein [Populus trichocarpa] gi|222875071|gb|EEF12202.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224116870|ref|XP_002331834.1| predicted protein [Populus trichocarpa] gi|222875072|gb|EEF12203.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225464712|ref|XP_002276171.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490572|ref|XP_003634116.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224105895|ref|XP_002333753.1| predicted protein [Populus trichocarpa] gi|222838401|gb|EEE76766.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224125666|ref|XP_002329688.1| predicted protein [Populus trichocarpa] gi|222870596|gb|EEF07727.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359490576|ref|XP_003634117.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query637
TAIR|locus:2044767 905 AT2G34930 "AT2G34930" [Arabido 0.701 0.493 0.309 1.3e-45
TAIR|locus:2137296 811 RLP46 "receptor like protein 4 0.733 0.575 0.292 1.9e-41
TAIR|locus:2825384 847 RLP12 "AT1G71400" [Arabidopsis 0.670 0.504 0.286 3.3e-39
TAIR|locus:2119430 741 RLP47 "receptor like protein 4 0.659 0.566 0.289 1.9e-36
TAIR|locus:2046515 864 RLP24 "receptor like protein 2 0.725 0.534 0.266 8.8e-36
TAIR|locus:2129246 891 RLP50 "receptor like protein 5 0.668 0.478 0.296 1.8e-35
TAIR|locus:2085949 1141 AT3G24240 [Arabidopsis thalian 0.678 0.378 0.287 2.2e-35
TAIR|locus:2825389 784 RLP11 "AT1G71390" [Arabidopsis 0.665 0.540 0.282 1.4e-34
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.690 0.351 0.277 5.9e-34
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.704 0.359 0.280 7.8e-34
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 487 (176.5 bits), Expect = 1.3e-45, P = 1.3e-45
 Identities = 148/478 (30%), Positives = 223/478 (46%)

Query:   155 PIPDYAFSNMTALQHLNLSLNQIS-AISKSFGNMCGLKTLHLFDN-NLTGQLPELFLNLS 212
             PIP++ F  +T L+ L L  + +  +I   F N+  L+TL L +N  L G++P +  +L 
Sbjct:   262 PIPNWLFG-LTNLRKLFLRWDFLQGSIPTGFKNLKLLETLDLSNNLALQGEIPSVLGDLP 320

Query:   213 GCSKNSLEILKLGGNKLTGSLPDITE-FS-----SLQELHLFDNKLDGSFPEKFRKPSPL 266
                   L+ L L  N+L G +    + FS     SL  L L  NKL G+ PE       L
Sbjct:   321 -----QLKFLDLSANELNGQIHGFLDAFSRNKGNSLVFLDLSSNKLAGTLPESLGSLRNL 375

Query:   267 VILNLDGNQLWGSLPD-LSVFPFLTRLDVSDSRLNGTVSEGLGRLSKLEFLDLFGNSLEG 325
               L+L  N   GS+P  +     L +LD+S++ +NGT++E LG+L++L  L+L  N+  G
Sbjct:   376 QTLDLSSNSFTGSVPSSIGNMASLKKLDLSNNAMNGTIAESLGQLAELVDLNLMANTWGG 435

Query:   326 MITESHVSNLSKLKYMDXXXXXXXXXXX---XGWLPPFQLESIGLLHCKLGPHFPKWLQS 382
             ++ +SH  NL  LK +                 W+PPF+LE I + +C++G  FP WLQ 
Sbjct:   436 VLQKSHFVNLRSLKSIRLTTEPYRSLVFKLPSTWIPPFRLELIQIENCRIGL-FPMWLQV 494

Query:   383 QKNYYFLDISDTEISDAVP-SWFWDXXXXXXXXXXXXXXXEGTVLDLSLNYAGYPGIDLS 441
             Q    F+ + +T I D +P SWF                 +G  L   L +     IDLS
Sbjct:   495 QTKLNFVTLRNTGIEDTIPDSWFSGISSKVTYLILANNRIKGR-LPQKLAFPKLNTIDLS 553

Query:   442 SNDFEGPVPPVPGNVTSLNLSNNKFSGPISSLCSISGEYFSYLDVSDNLLSGELPDCLLR 501
             SN+FEG  P    N T L L  N FSG +     +       + +  N  +G +P  L  
Sbjct:   554 SNNFEGTFPLWSTNATELRLYENNFSGSLPQNIDVLMPRMEKIYLFSNSFTGNIPSSLCE 613

Query:   502 WQXXXXXXXXXXXFSGNFLTFFVGEIPPSLKKCNELKIIDAGDNKFSGTIPAWIGDTLPK 561
                          FSG+F        P    +   L  ID  +N  SG IP  +G  LP 
Sbjct:   614 VSGLQILSLRKNHFSGSF--------PKCWHRQFMLWGIDVSENNLSGEIPESLG-MLPS 664

Query:   562 LAILSLRSNQFHGSIPRNLCRLSKIQLLDFSLNSISGAIPKCINNLTAM-VEKASSNS 618
             L++L L  N   G IP +L   S +  +D   N ++G +P  +  L+++ + +  SNS
Sbjct:   665 LSVLLLNQNSLEGKIPESLRNCSGLTNIDLGGNKLTGKLPSWVGKLSSLFMLRLQSNS 722


GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0005618 "cell wall" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IEP;IMP
TAIR|locus:2137296 RLP46 "receptor like protein 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119430 RLP47 "receptor like protein 47" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046515 RLP24 "receptor like protein 24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129246 RLP50 "receptor like protein 50" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825389 RLP11 "AT1G71390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_scaffold_742000001
hypothetical protein (1036 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query637
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-49
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-38
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-35
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 7e-05
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-04
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 0.002
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.003
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  186 bits (473), Expect = 1e-49
 Identities = 167/535 (31%), Positives = 260/535 (48%), Gaps = 47/535 (8%)

Query: 112 NSSTSLTLLDLSSCGLSNSAYHWLFKISSNLLALDLNSNQLAGPIPDYAFSNMTALQHLN 171
           N+S+ +  +DLS   +S      +F++   +  ++L++NQL+GPIPD  F+  ++L++LN
Sbjct: 66  NNSSRVVSIDLSGKNISGKISSAIFRLPY-IQTINLSNNQLSGPIPDDIFTTSSSLRYLN 124

Query: 172 LSLNQISAISKSFGNMCGLKTLHLFDNNLTGQLPELFLNLSGCSKNSLEILKLGGNKLTG 231
           LS N  +  S   G++  L+TL L +N L+G++P    + S     SL++L LGGN L G
Sbjct: 125 LSNNNFTG-SIPRGSIPNLETLDLSNNMLSGEIPNDIGSFS-----SLKVLDLGGNVLVG 178

Query: 232 SLP-DITEFSSLQELHLFDNKLDGSFPEKFRKPSPLVILNLDGNQLWGSLP-DLSVFPFL 289
            +P  +T  +SL+ L L  N+L G  P +  +   L  + L  N L G +P ++     L
Sbjct: 179 KIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSL 238

Query: 290 TRLDVSDSRLNGTVSEGLGRLSKLEFLDLFGNSLEGMITESHVSNLSKLKYMDFSFNSLA 349
             LD+  + L G +   LG L  L++L L+ N L G I  S + +L KL  +D S NSL+
Sbjct: 239 NHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPS-IFSLQKLISLDLSDNSLS 297

Query: 350 LNFSFGWLPPF--QLESIGLLHC---KLGPHFPKWLQSQKNYYFLDISDTEISDAVPSWF 404
                G +P    QL+++ +LH          P  L S      L +   + S  +P   
Sbjct: 298 -----GEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPK-- 350

Query: 405 WDLSP--NLYYLNLSHNHLEGTVLDLSLNYAGYPGIDLSSNDFEGPVPPVPGNVTSLN-- 460
            +L    NL  L+LS N+L G + +   +      + L SN  EG +P   G   SL   
Sbjct: 351 -NLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRV 409

Query: 461 -LSNNKFSGPISS-LCSISGEYFSYLDVSDNLLSGELPDCLLRWQALAVLNLANNNFSGN 518
            L +N FSG + S    +   YF  LD+S+N L G +        +L +L+LA N F G 
Sbjct: 410 RLQDNSFSGELPSEFTKLPLVYF--LDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGG 467

Query: 519 FLTF---------------FVGEIPPSLKKCNELKIIDAGDNKFSGTIPAWIGDTLPKLA 563
                              F G +P  L   +EL  +   +NK SG IP  +  +  KL 
Sbjct: 468 LPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDEL-SSCKKLV 526

Query: 564 ILSLRSNQFHGSIPRNLCRLSKIQLLDFSLNSISGAIPKCINNLTAMVEKASSNS 618
            L L  NQ  G IP +   +  +  LD S N +SG IPK + N+ ++V+   S++
Sbjct: 527 SLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHN 581


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 637
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG4237498 consensus Extracellular matrix protein slit, conta 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
KOG0617264 consensus Ras suppressor protein (contains leucine 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.37
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.34
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.31
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.28
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.26
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.22
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.21
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.2
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.15
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.14
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.12
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.07
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.06
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.98
PLN03150623 hypothetical protein; Provisional 98.93
PLN03150623 hypothetical protein; Provisional 98.91
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.9
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.88
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.86
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.8
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.77
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.73
KOG4341483 consensus F-box protein containing LRR [General fu 98.69
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.64
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.53
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.53
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.51
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.43
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.43
KOG4341483 consensus F-box protein containing LRR [General fu 98.31
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.27
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.23
PRK15386 426 type III secretion protein GogB; Provisional 98.09
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.07
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.03
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.03
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.01
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.98
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.95
PRK15386 426 type III secretion protein GogB; Provisional 97.81
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.37
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.26
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.25
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.16
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.12
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.03
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.01
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.92
KOG4308 478 consensus LRR-containing protein [Function unknown 96.25
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.93
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.6
KOG4308478 consensus LRR-containing protein [Function unknown 95.33
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.68
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.92
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.55
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.17
smart0037026 LRR Leucine-rich repeats, outliers. 91.5
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.5
smart0037026 LRR Leucine-rich repeats, outliers. 91.07
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.07
KOG0473 326 consensus Leucine-rich repeat protein [Function un 91.01
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.84
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 90.43
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 88.83
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 86.13
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 85.33
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 82.31
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 80.76
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.2e-54  Score=499.95  Aligned_cols=548  Identities=28%  Similarity=0.397  Sum_probs=453.6

Q ss_pred             HHHHHhhccccceeeeeeccccccccccCchhHHHHHHhcccccccceeeeccccchhhcCCCCCcEEEcCCCCCCCCCc
Q 042944           26 QAELAMCRRKQVELTMYRREQVELAISPINSFILKLMMALSKNSQNAIITVFNTCIVTITSLASLRDLYLASSTLLSINR  105 (637)
Q Consensus        26 ~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~  105 (637)
                      ....++|.|.++.|+...  .             ++.++++++......      ...+..+++|+.|++++|.+.+..+
T Consensus        52 ~~~~~~c~w~gv~c~~~~--~-------------v~~L~L~~~~i~~~~------~~~~~~l~~L~~L~Ls~n~~~~~ip  110 (968)
T PLN00113         52 NSSADVCLWQGITCNNSS--R-------------VVSIDLSGKNISGKI------SSAIFRLPYIQTINLSNNQLSGPIP  110 (968)
T ss_pred             CCCCCCCcCcceecCCCC--c-------------EEEEEecCCCccccC------ChHHhCCCCCCEEECCCCccCCcCC
Confidence            334568999998886211  1             124566665543322      2347789999999999998875433


Q ss_pred             ccccccCCCCCccEEECCCCCCCchhhhHHHhhcCCCcEEECCCCCCCCCCCchhccCCCCCCEEEcCCCcccc-hhhhc
Q 042944          106 PSLSSMNSSTSLTLLDLSSCGLSNSAYHWLFKISSNLLALDLNSNQLAGPIPDYAFSNMTALQHLNLSLNQISA-ISKSF  184 (637)
Q Consensus       106 ~~~~~l~~l~~L~~L~L~~n~i~~~~~~~~~~~~~~L~~L~L~~n~l~~~l~~~~~~~l~~L~~L~L~~n~l~~-l~~~~  184 (637)
                        ...+..+++|++|++++|.+.+..|.  ..+ ++|++|++++|.+.+.+|. .++++++|++|++++|.+.. +|..+
T Consensus       111 --~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l-~~L~~L~Ls~n~~~~~~p~-~~~~l~~L~~L~L~~n~l~~~~p~~~  184 (968)
T PLN00113        111 --DDIFTTSSSLRYLNLSNNNFTGSIPR--GSI-PNLETLDLSNNMLSGEIPN-DIGSFSSLKVLDLGGNVLVGKIPNSL  184 (968)
T ss_pred             --hHHhccCCCCCEEECcCCccccccCc--ccc-CCCCEEECcCCcccccCCh-HHhcCCCCCEEECccCcccccCChhh
Confidence              12244779999999999998866654  233 8899999999999867776 78899999999999998875 78889


Q ss_pred             CCCCCCcEEEcCCCcCCCCchhHhhhcccCCCCcccEEEcCCCCCCCC-cCCcccCCCccEEEccCCcCCCCCCCcCCCC
Q 042944          185 GNMCGLKTLHLFDNNLTGQLPELFLNLSGCSKNSLEILKLGGNKLTGS-LPDITEFSSLQELHLFDNKLDGSFPEKFRKP  263 (637)
Q Consensus       185 ~~l~~L~~L~l~~n~i~~~~~~~l~~l~~~~~~~L~~L~l~~n~~~~~-~~~~~~~~~L~~L~l~~n~i~~~~~~~l~~l  263 (637)
                      .++++|++|++++|.+.+..|..+..+.     +|+.|++++|.+... +..+..+++|++|++++|.+.+..|..+.++
T Consensus       185 ~~l~~L~~L~L~~n~l~~~~p~~l~~l~-----~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l  259 (968)
T PLN00113        185 TNLTSLEFLTLASNQLVGQIPRELGQMK-----SLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNL  259 (968)
T ss_pred             hhCcCCCeeeccCCCCcCcCChHHcCcC-----CccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCC
Confidence            9999999999999999888899999888     999999999988754 4457888999999999999988888889999


Q ss_pred             CCCcEEEcCCCCCCCCCC-CCCCCCCCCEEEccCCcCCCCChhhhcCCCCCCEEecCCCcCCCccchhhhcCCCCCcEEE
Q 042944          264 SPLVILNLDGNQLWGSLP-DLSVFPFLTRLDVSDSRLNGTVSEGLGRLSKLEFLDLFGNSLEGMITESHVSNLSKLKYMD  342 (637)
Q Consensus       264 ~~L~~L~l~~~~~~~~~~-~~~~~~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~~~~~l~~L~~L~  342 (637)
                      ++|+.|++++|.+.+..+ .+..+++|++|++++|.+.+..|..+..+++|+.|++++|.+.+..+. .+..+++|+.|+
T Consensus       260 ~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~-~~~~l~~L~~L~  338 (968)
T PLN00113        260 KNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPV-ALTSLPRLQVLQ  338 (968)
T ss_pred             CCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCCh-hHhcCCCCCEEE
Confidence            999999999998876554 355589999999999999888888889999999999999998876554 678899999999


Q ss_pred             ccCCcccccccCCCCCCCceeEEeccCCcCCCCccccccCCCCccEEEeeCCCCCCccchhhhhcCCCccEEECCCCcCC
Q 042944          343 FSFNSLALNFSFGWLPPFQLESIGLLHCKLGPHFPKWLQSQKNYYFLDISDTEISDAVPSWFWDLSPNLYYLNLSHNHLE  422 (637)
Q Consensus       343 l~~n~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~n~i~~~~~~~~~~~~~~L~~L~l~~n~i~  422 (637)
                      +++|.+....+..+..+.+|+.|++++|.+.+..|.++..+++|+.|++++|.+.+..+..+... ++|++|++++|.++
T Consensus       339 L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~-~~L~~L~L~~n~l~  417 (968)
T PLN00113        339 LWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGAC-RSLRRVRLQDNSFS  417 (968)
T ss_pred             CcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCC-CCCCEEECcCCEee
Confidence            99999987778788888999999999999988888888889999999999999988888777664 89999999999999


Q ss_pred             CcccccccCCCCCCeEeCCCCcCcCCCCC---CCCCccEEEcccccccCcccccccccCCCccEEeCCCCCCcccCchhh
Q 042944          423 GTVLDLSLNYAGYPGIDLSSNDFEGPVPP---VPGNVTSLNLSNNKFSGPISSLCSISGEYFSYLDVSDNLLSGELPDCL  499 (637)
Q Consensus       423 ~~~~~~~~~~~~L~~L~l~~n~~~~~~~~---~~~~L~~L~L~~n~l~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~l  499 (637)
                      +..+..+..++.|+.+++++|.+.+..+.   .+++|++|++++|++.+..+.....  ++|+.|++++|.+++..|..+
T Consensus       418 ~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~--~~L~~L~ls~n~l~~~~~~~~  495 (968)
T PLN00113        418 GELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGS--KRLENLDLSRNQFSGAVPRKL  495 (968)
T ss_pred             eECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccccc--ccceEEECcCCccCCccChhh
Confidence            88888889999999999999999887665   3778999999999988777765443  789999999999998888899


Q ss_pred             hccCCCcEEeccCccCCCCccccccccCCccccCCCCCcEEEcCCCcccccCChhhhhcCCCCcEEeccCccccccCCcc
Q 042944          500 LRWQALAVLNLANNNFSGNFLTFFVGEIPPSLKKCNELKIIDAGDNKFSGTIPAWIGDTLPKLAILSLRSNQFHGSIPRN  579 (637)
Q Consensus       500 ~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~~l~~l~~L~~L~ls~n~l~~~~~~~l~~~l~~L~~L~L~~n~~~~~~~~~  579 (637)
                      ..+++|+.|++++|.+.        +.+|..+.++++|++|++++|.+++.+|..+. .+++|+.|+|++|++++.+|..
T Consensus       496 ~~l~~L~~L~Ls~N~l~--------~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~-~l~~L~~L~Ls~N~l~~~~p~~  566 (968)
T PLN00113        496 GSLSELMQLKLSENKLS--------GEIPDELSSCKKLVSLDLSHNQLSGQIPASFS-EMPVLSQLDLSQNQLSGEIPKN  566 (968)
T ss_pred             hhhhccCEEECcCCcce--------eeCChHHcCccCCCEEECCCCcccccCChhHh-CcccCCEEECCCCcccccCChh
Confidence            99999999999999887        36777888899999999999999888888776 6899999999999999889999


Q ss_pred             ccCCCCCcEeeCCCCcccccccccccccccceeeccCCCe
Q 042944          580 LCRLSKIQLLDFSLNSISGAIPKCINNLTAMVEKASSNST  619 (637)
Q Consensus       580 l~~l~~L~~L~ls~n~l~~~~p~~l~~l~~L~~l~l~~n~  619 (637)
                      +..+++|+.|++++|++.+.+|.. +....+....+.||.
T Consensus       567 l~~l~~L~~l~ls~N~l~~~~p~~-~~~~~~~~~~~~~n~  605 (968)
T PLN00113        567 LGNVESLVQVNISHNHLHGSLPST-GAFLAINASAVAGNI  605 (968)
T ss_pred             HhcCcccCEEeccCCcceeeCCCc-chhcccChhhhcCCc
Confidence            999999999999999999888854 334445555566665



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query637
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-19
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-16
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-19
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 3e-16
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 1e-04
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 1e-04
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-04
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 5e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 94.7 bits (234), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 135/512 (26%), Positives = 203/512 (39%), Gaps = 69/512 (13%) Query: 172 LSLNQISAISKSFGNMCGLKTLHLFDNNLTGQLPELFLNLSGCSKNSLEILKLGGNKLT- 230 LS + I+ F L +L L N+L+G + L +L CS L+ L + N L Sbjct: 81 LSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTL-TSLGSCS--GLKFLNVSSNTLDF 137 Query: 231 -GSLPDITEFSSLQELHLFDNKLDGSFPEKF---RKPSPLVILNLDGNQLWGSLPDLSVF 286 G + + +SL+ L L N + G+ + L L + GN++ G + D+S Sbjct: 138 PGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDV-DVSRC 196 Query: 287 PFLTRLDVSDSRLNGTVSEGLGRLSKLEFLDLFGNSLEGMITESHVSNLSKLKYMDXXXX 346 L LDVS + + + LG S L+ LD+ GN L G + + +S ++LK ++ Sbjct: 197 VNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRA-ISTCTELKLLNISSN 254 Query: 347 XXXXXXXXGWLPPFQLESI---GLLHCKLGPHFPKWLQSQ-KNYYFLDISDTEISDAVPS 402 G +PP L+S+ L K P +L LD+S AVP Sbjct: 255 QFV-----GPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPP 309 Query: 403 WFWDXXXXXXXXXXXXXXXEGTVLDLSLNYAGYPGIDLSSNDFEGPVPPVPGNVT----S 458 +F +D L G +DLS N+F G +P N++ + Sbjct: 310 FFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLT 369 Query: 459 LNLSNNKFSGPI-SSLCSISGEYFSYLDVSDNLLSGELPDCLLRWQXXXXXXXXXXXFSG 517 L+LS+N FSGPI +LC L + +N +G++P L SG Sbjct: 370 LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSG 429 Query: 518 NF--------------------------------------LTF--FVGEIPPSLKKCNEL 537 L F GEIP L C L Sbjct: 430 TIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNL 489 Query: 538 KIIDAGDNKFSGTIPAWIGDTLPKLAILSLRSNQFHGSIPRNLCRLSKIQLLDFSLNSIS 597 I +N+ +G IP WIG L LAIL L +N F G+IP L + LD + N + Sbjct: 490 NWISLSNNRLTGEIPKWIG-RLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFN 548 Query: 598 GAIPKCINNLTAMVEKASSNSTITHIYVYYRS 629 G IP + + K ++N YVY ++ Sbjct: 549 GTIPAAMFKQSG---KIAANFIAGKRYVYIKN 577
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query637
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-110
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-91
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-88
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-73
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-54
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-60
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-60
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-60
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-51
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-41
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-56
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-53
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-31
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-55
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-47
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-40
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-39
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-48
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-45
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-44
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-47
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-45
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-46
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-44
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-44
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-42
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-27
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-42
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-29
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-19
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-17
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-36
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-32
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-32
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-37
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-37
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-37
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-24
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-18
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-36
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-30
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-20
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-34
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-32
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-31
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-20
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-29
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-27
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-18
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-29
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-27
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-18
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-11
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-28
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-27
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-27
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-27
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-26
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-25
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-26
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-21
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-09
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-07
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-24
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-21
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-16
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-23
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-05
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-21
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-21
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-17
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-19
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-19
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-13
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-19
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-15
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-05
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-17
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-16
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-15
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-15
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-14
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-13
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-12
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-11
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-10
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 8e-09
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 2e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 6e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 5e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  347 bits (892), Expect = e-110
 Identities = 155/548 (28%), Positives = 240/548 (43%), Gaps = 40/548 (7%)

Query: 89  SLRDLYLASSTLLSINRPSLSSMNSSTSLTLLDLSSCGLSNSAYHWLFKISSNLLALDLN 148
            +  + L+S  L        SS+ S T L  L LS+  ++ S     FK S++L +LDL+
Sbjct: 51  KVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVSG--FKCSASLTSLDLS 108

Query: 149 SNQLAGPIPD-YAFSNMTALQHLNLSLNQISAI--SKSFGNMCGLKTLHLFDNNLTGQLP 205
            N L+GP+    +  + + L+ LN+S N +           +  L+ L L  N+++G   
Sbjct: 109 RNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANV 168

Query: 206 ELFLNLSGCSKNSLEILKLGGNKLTGSLPDITEFSSLQELHLFDNKLDGSFPEKFRKPSP 265
             ++   GC    L+ L + GNK++G +  ++   +L+ L +  N      P      + 
Sbjct: 169 VGWVLSDGCG--ELKHLAISGNKISGDVD-VSRCVNLEFLDVSSNNFSTGIPFLGDCSA- 224

Query: 266 LVILNLDGNQLWGSLPD-LSVFPFLTRLDVSDSRLNGTVSEGLGRLSKLEFLDLFGNSLE 324
           L  L++ GN+L G     +S    L  L++S ++  G +      L  L++L L  N   
Sbjct: 225 LQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFT 282

Query: 325 GMITESHVSNLSKLKYMDFSFNSLALNFSFGWLPPF-----QLESIGLLHCKLGPHFPK- 378
           G I +        L  +D S N       +G +PPF      LES+ L         P  
Sbjct: 283 GEIPDFLSGACDTLTGLDLSGNHF-----YGAVPPFFGSCSLLESLALSSNNFSGELPMD 337

Query: 379 WLQSQKNYYFLDISDTEISDAVPSWFWDLSPNLYYLNLSHNHLEGTVLD--LSLNYAGYP 436
            L   +    LD+S  E S  +P    +LS +L  L+LS N+  G +L            
Sbjct: 338 TLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQ 397

Query: 437 GIDLSSNDFEGPVPPVPGNVTSL---NLSNNKFSGPI-SSLCSISGEYFSYLDVSDNLLS 492
            + L +N F G +PP   N + L   +LS N  SG I SSL S+S      L +  N+L 
Sbjct: 398 ELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLS--KLRDLKLWLNMLE 455

Query: 493 GELPDCLLRWQALAVLNLANNNFSGNFLTFFVGEIPPSLKKCNELKIIDAGDNKFSGTIP 552
           GE+P  L+  + L  L L  N+ +G        EIP  L  C  L  I   +N+ +G IP
Sbjct: 456 GEIPQELMYVKTLETLILDFNDLTG--------EIPSGLSNCTNLNWISLSNNRLTGEIP 507

Query: 553 AWIGDTLPKLAILSLRSNQFHGSIPRNLCRLSKIQLLDFSLNSISGAIPKCINNLTAMVE 612
            WIG  L  LAIL L +N F G+IP  L     +  LD + N  +G IP  +   +  + 
Sbjct: 508 KWIG-RLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIA 566

Query: 613 KASSNSTI 620
                   
Sbjct: 567 ANFIAGKR 574


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query637
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.9
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.83
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.82
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.82
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.79
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.77
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.75
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.74
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.73
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.6
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.59
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.56
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.56
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.56
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.56
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.54
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.54
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.51
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.51
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.51
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.51
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.47
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.42
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.38
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.34
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.33
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.33
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.32
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.32
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.32
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.31
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.3
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.11
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.02
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.01
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.94
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.94
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.76
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.71
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.62
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.37
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.3
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.26
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.15
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.79
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.78
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.56
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.14
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=5.9e-63  Score=553.52  Aligned_cols=524  Identities=28%  Similarity=0.404  Sum_probs=430.6

Q ss_pred             hhcCCCCCcEEEcCCCCCCCCCcccccccCCCCCccEEECCCCCCCchhhhH---HHhhcCCCcEEECCCCCCCCCCCch
Q 042944           83 TITSLASLRDLYLASSTLLSINRPSLSSMNSSTSLTLLDLSSCGLSNSAYHW---LFKISSNLLALDLNSNQLAGPIPDY  159 (637)
Q Consensus        83 ~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~l~~L~~L~L~~n~i~~~~~~~---~~~~~~~L~~L~L~~n~l~~~l~~~  159 (637)
                      .+..+++|++|++++|.+.+..+  ...+.++++|++|++++|.+.+..+..   +..+ ++|++|++++|.+.+.++  
T Consensus       121 ~l~~l~~L~~L~Ls~n~l~~~~~--~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l-~~L~~L~Ls~n~l~~~~~--  195 (768)
T 3rgz_A          121 SLGSCSGLKFLNVSSNTLDFPGK--VSGGLKLNSLEVLDLSANSISGANVVGWVLSDGC-GELKHLAISGNKISGDVD--  195 (768)
T ss_dssp             GGGGCTTCCEEECCSSEEECCSS--CCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCC-TTCCEEECCSSEEESCCB--
T ss_pred             HHhCCCCCCEEECcCCccCCcCC--HHHhccCCCCCEEECCCCccCCcCChhhhhhccC-CCCCEEECCCCcccccCC--
Confidence            35566666666666666554432  112255667777777777776555544   3333 777777777777763333  


Q ss_pred             hccCCCCCCEEEcCCCcccchhhhcCCCCCCcEEEcCCCcCCCCchhHhhhcccCCCCcccEEEcCCCCCCCCcCCcccC
Q 042944          160 AFSNMTALQHLNLSLNQISAISKSFGNMCGLKTLHLFDNNLTGQLPELFLNLSGCSKNSLEILKLGGNKLTGSLPDITEF  239 (637)
Q Consensus       160 ~~~~l~~L~~L~L~~n~l~~l~~~~~~l~~L~~L~l~~n~i~~~~~~~l~~l~~~~~~~L~~L~l~~n~~~~~~~~~~~~  239 (637)
                       +..+++|++|++++|++...+..++++++|++|++++|.+.+..|..+..++     +|++|++++|.+....+.. .+
T Consensus       196 -~~~l~~L~~L~Ls~n~l~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~-----~L~~L~Ls~n~l~~~~~~~-~l  268 (768)
T 3rgz_A          196 -VSRCVNLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNKLSGDFSRAISTCT-----ELKLLNISSNQFVGPIPPL-PL  268 (768)
T ss_dssp             -CTTCTTCCEEECCSSCCCSCCCBCTTCCSCCEEECCSSCCCSCHHHHTTTCS-----SCCEEECCSSCCEESCCCC-CC
T ss_pred             -cccCCcCCEEECcCCcCCCCCcccccCCCCCEEECcCCcCCCcccHHHhcCC-----CCCEEECCCCcccCccCcc-cc
Confidence             3678888888888888877433488888899999988888888888888888     8999999988887555544 77


Q ss_pred             CCccEEEccCCcCCCCCCCcCCCC-CCCcEEEcCCCCCCCCCCC-CCCCCCCCEEEccCCcCCCCChhh-hcCCCCCCEE
Q 042944          240 SSLQELHLFDNKLDGSFPEKFRKP-SPLVILNLDGNQLWGSLPD-LSVFPFLTRLDVSDSRLNGTVSEG-LGRLSKLEFL  316 (637)
Q Consensus       240 ~~L~~L~l~~n~i~~~~~~~l~~l-~~L~~L~l~~~~~~~~~~~-~~~~~~L~~L~l~~n~~~~~~~~~-l~~l~~L~~L  316 (637)
                      ++|++|++++|.+++..|..+... ++|++|++++|.+.+..+. +..+++|++|++++|.+.+.+|.. +..+++|+.|
T Consensus       269 ~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L  348 (768)
T 3rgz_A          269 KSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVL  348 (768)
T ss_dssp             TTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEE
T ss_pred             CCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEE
Confidence            889999999998887777777664 8899999999988765554 445888999999999887555544 8888999999


Q ss_pred             ecCCCcCCCccchhhhcCCC-CCcEEEccCCcccccccCCCCC--CCceeEEeccCCcCCCCccccccCCCCccEEEeeC
Q 042944          317 DLFGNSLEGMITESHVSNLS-KLKYMDFSFNSLALNFSFGWLP--PFQLESIGLLHCKLGPHFPKWLQSQKNYYFLDISD  393 (637)
Q Consensus       317 ~l~~n~~~~~~~~~~~~~l~-~L~~L~l~~n~~~~~~~~~~~~--~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~  393 (637)
                      ++++|.+.+..+. .+.+++ +|++|++++|.+....+..+..  +++|++|++.+|.+.+..|.++..+++|++|++++
T Consensus       349 ~Ls~n~l~~~~p~-~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~  427 (768)
T 3rgz_A          349 DLSFNEFSGELPE-SLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF  427 (768)
T ss_dssp             ECCSSEEEECCCT-THHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCS
T ss_pred             eCcCCccCccccH-HHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcC
Confidence            9999988765555 455555 8999999999888766666655  78899999999999988899999999999999999


Q ss_pred             CCCCCccchhhhhcCCCccEEECCCCcCCCcccccccCCCCCCeEeCCCCcCcCCCCCC---CCCccEEEcccccccCcc
Q 042944          394 TEISDAVPSWFWDLSPNLYYLNLSHNHLEGTVLDLSLNYAGYPGIDLSSNDFEGPVPPV---PGNVTSLNLSNNKFSGPI  470 (637)
Q Consensus       394 n~i~~~~~~~~~~~~~~L~~L~l~~n~i~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~---~~~L~~L~L~~n~l~~~~  470 (637)
                      |.+.+..+..+... ++|++|++++|.+++..+..+..+++|+.|++++|++.+..|..   +++|++|++++|++++.+
T Consensus       428 N~l~~~~p~~l~~l-~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~  506 (768)
T 3rgz_A          428 NYLSGTIPSSLGSL-SKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEI  506 (768)
T ss_dssp             SEEESCCCGGGGGC-TTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCC
T ss_pred             CcccCcccHHHhcC-CCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcC
Confidence            99998888887765 89999999999999999999999999999999999999887765   689999999999999887


Q ss_pred             cccccccCCCccEEeCCCCCCcccCchhhhccCCCcEEeccCccCCCCcccc----------------------------
Q 042944          471 SSLCSISGEYFSYLDVSDNLLSGELPDCLLRWQALAVLNLANNNFSGNFLTF----------------------------  522 (637)
Q Consensus       471 ~~~~~~~~~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~----------------------------  522 (637)
                      |..... .++|++|++++|.+++.+|..+..+++|+.|++++|++++..|..                            
T Consensus       507 p~~~~~-l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  585 (768)
T 3rgz_A          507 PKWIGR-LENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKK  585 (768)
T ss_dssp             CGGGGG-CTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCT
T ss_pred             ChHHhc-CCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccc
Confidence            765543 399999999999999999999999999999999999998665543                            


Q ss_pred             ----------------------------------ccccCCccccCCCCCcEEEcCCCcccccCChhhhhcCCCCcEEecc
Q 042944          523 ----------------------------------FVGEIPPSLKKCNELKIIDAGDNKFSGTIPAWIGDTLPKLAILSLR  568 (637)
Q Consensus       523 ----------------------------------~~~~~~~~l~~l~~L~~L~ls~n~l~~~~~~~l~~~l~~L~~L~L~  568 (637)
                                                        +.|.+|..+..+++|++||+++|.+++.+|..+. .+++|+.|+|+
T Consensus       586 ~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~-~l~~L~~L~Ls  664 (768)
T 3rgz_A          586 ECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIG-SMPYLFILNLG  664 (768)
T ss_dssp             TCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGG-GCTTCCEEECC
T ss_pred             cccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHh-ccccCCEEeCc
Confidence                                              2234566677889999999999999999999988 69999999999


Q ss_pred             CccccccCCccccCCCCCcEeeCCCCcccccccccccccccceeeccCCCeeEE
Q 042944          569 SNQFHGSIPRNLCRLSKIQLLDFSLNSISGAIPKCINNLTAMVEKASSNSTITH  622 (637)
Q Consensus       569 ~n~~~~~~~~~l~~l~~L~~L~ls~n~l~~~~p~~l~~l~~L~~l~l~~n~l~~  622 (637)
                      +|++++.+|..+..+++|++||+++|++++.+|+.|..+++|++|++++|+++-
T Consensus       665 ~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g  718 (768)
T 3rgz_A          665 HNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSG  718 (768)
T ss_dssp             SSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEE
T ss_pred             CCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccc
Confidence            999999999999999999999999999999999999999999999999999974



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 637
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-11
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 6e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 7e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 5e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 7e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.004
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 77.8 bits (190), Expect = 3e-16
 Identities = 58/260 (22%), Positives = 95/260 (36%), Gaps = 10/260 (3%)

Query: 165 TALQHLNLSLNQISAI-SKSFGNMCGLKTLHLFDNNLTGQLPELFLNLSGCSKNSLEILK 223
                L+L  N+I+ I    F N+  L TL L +N ++   P  F  L       LE L 
Sbjct: 31  PDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLV-----KLERLY 85

Query: 224 LGGNKLTGSLPDITEFSSLQELHLFDNKLDGSFPEKFRKPSPLVILNLDGNQLWGSLPDL 283
           L  N+L      + +    QEL + +N++       F   + ++++ L  N L  S  + 
Sbjct: 86  LSKNQLKELPEKMPKTL--QELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIEN 143

Query: 284 SVFPFLTRLDVSDSRLNGTVSEGLGRLSKLEFLDLFGNSLEGMITESHVSNLSKLKYMDF 343
             F  + +L           +   G    L  L L GN +  +   S    L+ L  +  
Sbjct: 144 GAFQGMKKLSYIRIADTNITTIPQGLPPSLTELHLDGNKITKVDAASLK-GLNNLAKLGL 202

Query: 344 SFNSLALNFSFGWLPPFQLESIGLLHCKLGPHFPKWLQSQKNYYFLDISDTEISDAVPSW 403
           SFNS++   +        L  + L + KL    P  L   K    + + +  IS    + 
Sbjct: 203 SFNSISAVDNGSLANTPHLRELHLNNNKL-VKVPGGLADHKYIQVVYLHNNNISAIGSND 261

Query: 404 FWDLSPNLYYLNLSHNHLEG 423
           F     N    + S   L  
Sbjct: 262 FCPPGYNTKKASYSGVSLFS 281


>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query637
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.92
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.85
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.85
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.82
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.82
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.82
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.65
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.64
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.62
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.58
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.58
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.57
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.51
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.5
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.22
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.21
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.08
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.5
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.32
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.11
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.99
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.65
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.59
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.95  E-value=8.8e-26  Score=229.98  Aligned_cols=187  Identities=23%  Similarity=0.270  Sum_probs=130.3

Q ss_pred             CCccEEECCCCcCCCcccccccCCCCCCeEeCCCCcCcCCCC-CCCCCccEEEcccccccCcccccccccCCCccEEeCC
Q 042944          409 PNLYYLNLSHNHLEGTVLDLSLNYAGYPGIDLSSNDFEGPVP-PVPGNVTSLNLSNNKFSGPISSLCSISGEYFSYLDVS  487 (637)
Q Consensus       409 ~~L~~L~l~~n~i~~~~~~~~~~~~~L~~L~l~~n~~~~~~~-~~~~~L~~L~L~~n~l~~~~~~~~~~~~~~L~~L~l~  487 (637)
                      ++++.+++++|.+++..+  ...+++|+.+++++|.+++... ..+++|+.|++++|++++..+   ....++|+.|+++
T Consensus       197 ~~~~~l~l~~n~i~~~~~--~~~~~~L~~L~l~~n~l~~~~~l~~l~~L~~L~l~~n~l~~~~~---~~~~~~L~~L~l~  271 (384)
T d2omza2         197 TNLESLIATNNQISDITP--LGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAP---LSGLTKLTELKLG  271 (384)
T ss_dssp             TTCSEEECCSSCCCCCGG--GGGCTTCCEEECCSSCCCCCGGGGGCTTCSEEECCSSCCCCCGG---GTTCTTCSEEECC
T ss_pred             cccceeeccCCccCCCCc--ccccCCCCEEECCCCCCCCcchhhcccccchhccccCccCCCCc---ccccccCCEeecc
Confidence            455555555555554332  2344555556666555544321 124566667777766665433   1222788888888


Q ss_pred             CCCCcccCchhhhccCCCcEEeccCccCCCCccccccccCCccccCCCCCcEEEcCCCcccccCChhhhhcCCCCcEEec
Q 042944          488 DNLLSGELPDCLLRWQALAVLNLANNNFSGNFLTFFVGEIPPSLKKCNELKIIDAGDNKFSGTIPAWIGDTLPKLAILSL  567 (637)
Q Consensus       488 ~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~~l~~l~~L~~L~ls~n~l~~~~~~~l~~~l~~L~~L~L  567 (637)
                      ++.+++..  .+..++.++.+++.+|.+.+         + ..+..+++++.|++++|.++ .++. +. .+++|++|++
T Consensus       272 ~~~l~~~~--~~~~~~~l~~l~~~~n~l~~---------~-~~~~~~~~l~~L~ls~n~l~-~l~~-l~-~l~~L~~L~L  336 (384)
T d2omza2         272 ANQISNIS--PLAGLTALTNLELNENQLED---------I-SPISNLKNLTYLTLYFNNIS-DISP-VS-SLTKLQRLFF  336 (384)
T ss_dssp             SSCCCCCG--GGTTCTTCSEEECCSSCCSC---------C-GGGGGCTTCSEEECCSSCCS-CCGG-GG-GCTTCCEEEC
T ss_pred             CcccCCCC--cccccccccccccccccccc---------c-cccchhcccCeEECCCCCCC-CCcc-cc-cCCCCCEEEC
Confidence            88887432  37778889999999998873         2 23677888999999999987 4443 43 6899999999


Q ss_pred             cCccccccCCccccCCCCCcEeeCCCCcccccccccccccccceeeccCCCe
Q 042944          568 RSNQFHGSIPRNLCRLSKIQLLDFSLNSISGAIPKCINNLTAMVEKASSNST  619 (637)
Q Consensus       568 ~~n~~~~~~~~~l~~l~~L~~L~ls~n~l~~~~p~~l~~l~~L~~l~l~~n~  619 (637)
                      ++|+++ .++ .+..+++|++|++++|++++..|  +.++++|+.|+|++|.
T Consensus       337 ~~n~l~-~l~-~l~~l~~L~~L~l~~N~l~~l~~--l~~l~~L~~L~L~~Na  384 (384)
T d2omza2         337 ANNKVS-DVS-SLANLTNINWLSAGHNQISDLTP--LANLTRITQLGLNDQA  384 (384)
T ss_dssp             CSSCCC-CCG-GGGGCTTCCEEECCSSCCCBCGG--GTTCTTCSEEECCCEE
T ss_pred             CCCCCC-CCh-hHcCCCCCCEEECCCCcCCCChh--hccCCCCCEeeCCCCc
Confidence            999988 444 68889999999999999986644  8899999999999873



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure