Citrus Sinensis ID: 042957

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-
MDSLTSSPSPPTERNPSGHLILASFCLREPGPRSNISNWLASYNPSNNTWSHVSHIPDLLENHVLKGFSIVSLGDSVYIIGGLLCHKERAHNSDESDDFVDAYDKVLAWVLRYNVKSNEWTRCAPLSVPRYDFACTVCDNKIYVAGGKSNLFSAKGTASAEVYHPELDQWTPLPNMSTLRYKCVGVTWQGKIHVVSGFAQRADSDGSVHFTERSSAEVYDTQAGKWDLVARMWQLDIPPNQIVEVDNRLFSSGDCLKAWKGHIESYDGELNMWDEVNGSCLQTLSSPVSTSSTNTEDWPPIQRLYLTMAPIGTHLYFLAGYRMAGELARTMSMVHIFDTAAKSDAWRSFEPIVEEGEKELCSHCCVVQLSS
ccccccccccccccccccEEEEccEEEEEcccccccccEEEEEEcccccEEEccccccccccccccEEEEEEEccEEEEEccccccccccccccccccccccccccccEEEEEEcccccEEcccccccccccEEEEEEccEEEEEcccccccccccccEEEEEEcccccEEEccccccccccEEEEEEccEEEEEcccccccccccccccccccEEEEEEcccccEEEccccccccccccEEEEEccEEEEEEccccccccEEEEEEcccccEEEcccccccccccccccccccccccccccccccEEEEEccEEEEEEcccccccccccccEEEEEccccccccEEEccccccccccEEccEEEEEEEcc
ccccEEccccccccccccEEEEcccEEEEEEcccccccEEEEEccccccEEEcccccccccccccccEEEEEEccEEEEEEccccccccccccccccccccccccccccEEEEccccccEEEEcccccccccEEEEEEccEEEEEEccccccccccccEEEEEccccccEEEEcccccccccEEEEEEccEEEEEEcccccccccccccccHcccEEEEccccccEEEEccccccccccEEEEEEccEEEEEEccccccccEEEEEccccccEEEEcccccccccccccccccccccccccccccEEEEEEccEEEEEEcccccccccccccEEEEEccccccccEEEEcccccccccccccEEEEEEEcc
mdsltsspsppternpsghlilasfclrepgprsnisnwlasynpsnntwshvshipdllenhvlkgfsivSLGDSVYIIGGLLchkerahnsdesddfVDAYDKVLAWVLRYNvksnewtrcaplsvprydfactvcdnkiyvaggksnlfsakgtasaevyhpeldqwtplpnmstlrykcvgvtwqgKIHVVSGfaqradsdgsvhfterssaevydtqagKWDLVARMWqldippnqivevdnrlfssgDCLKAWKGHIESYDGELNMWDEVNGsclqtlsspvstsstntedwppiqrlyltmapigthLYFLAGYRMAGELARTMSMVHIFDTAaksdawrsfepIVEEGEKELCSHCCVVQLSS
mdsltsspsppternpsGHLILASFCLREPGPRSNISNWLASYNPSNNTWSHVSHIPDLLENHVLKGFSIVSLGDSVYIIGGLLCHKERAHNSDESDDFVDAYDKVLAWVLRYnvksnewtrcaplSVPRYDFACTVCDNKIYVAGGKSNLFSAKGTASAEVYHPELDQWTPLPNMSTLRYKCVGVTWQGKIHVVSGFAQRADSDGSVHFTerssaevydtQAGKWDLVARMWQLDIPPNQIVEVDNRLFSSGDCLKAWKGHIESYDGELNMWDEVNGSCLQTLSspvstsstntedwppIQRLYLTMAPIGTHLYFLAGYRMAGELARTMSMVHIFDTAAKSDAWRSFEPIVEEGEKELCSHCCVVQLSS
MDSLTSSPSPPTERNPSGHLILASFCLREPGPRSNISNWLASYNPSNNTWSHVSHIPDLLENHVLKGFSIVSLGDSVYIIGGLLCHKERAHNSDESDDFVDAYDKVLAWVLRYNVKSNEWTRCAPLSVPRYDFACTVCDNKIYVAGGKSNLFSAKGTASAEVYHPELDQWTPLPNMSTLRYKCVGVTWQGKIHVVSGFAQRADSDGSVHFTERSSAEVYDTQAGKWDLVARMWQLDIPPNQIVEVDNRLFSSGDCLKAWKGHIESYDGELNMWDEVNGSCLQTLSSPVSTSSTNTEDWPPIQRLYLTMAPIGTHLYFLAGYRMAGELARTMSMVHIFDTAAKSDAWRSFEPIVEEGEKELCSHCCVVQLSS
******************HLILASFCLREPGPRSNISNWLASYNPSNNTWSHVSHIPDLLENHVLKGFSIVSLGDSVYIIGGLLCHKERAH****SDDFVDAYDKVLAWVLRYNVKSNEWTRCAPLSVPRYDFACTVCDNKIYVAGGKSNLFSAKGTASAEVYHPELDQWTPLPNMSTLRYKCVGVTWQGKIHVVSGFAQRA*****VHFTE**SAEVYDTQAGKWDLVARMWQLDIPPNQIVEVDNRLFSSGDCLKAWKGHIESYDGELNMWDEVNGSCLQTL************DWPPIQRLYLTMAPIGTHLYFLAGYRMAGELARTMSMVHIFDTAAKSDAWRSFEPIVEEGEKELCSHCCVVQ***
MDSLT************GHLILASFCLREPGPRSNISNWLASYNPSNNTWSHVSHIPDLLENHVLKGFSIVSLGDSVYIIGGLLCHKERAHNSDESDDFVDAYDKVLAWVLRYNVKSNEWTRCAPLSVPRYDFACTVCDNKIYVAGGKSNLFSAKGTASAEVYHPELDQWTPLPNMSTLRYKCVGVTWQGKIHVVSGFAQRADSDGSVHFTERSSAEVYDTQAGKWDLVARMWQLDIPPNQIVEVDNRLFSSGDCLKAWKGHIESYDGELNMWDEVNGSCLQTLSSPVSTSSTNTEDWPPIQRLYLTMAPIGTHLYFLAGYRMAGELARTMSMVHIFDTAAKSDAWRSFEPIVEEGEKELCSHCCVVQLSS
***************PSGHLILASFCLREPGPRSNISNWLASYNPSNNTWSHVSHIPDLLENHVLKGFSIVSLGDSVYIIGGLLCHKERAHNSDESDDFVDAYDKVLAWVLRYNVKSNEWTRCAPLSVPRYDFACTVCDNKIYVAGGKSNLFSAKGTASAEVYHPELDQWTPLPNMSTLRYKCVGVTWQGKIHVVSGFAQRADSDGSVHFTERSSAEVYDTQAGKWDLVARMWQLDIPPNQIVEVDNRLFSSGDCLKAWKGHIESYDGELNMWDEVNGSCLQT************EDWPPIQRLYLTMAPIGTHLYFLAGYRMAGELARTMSMVHIFDTAAKSDAWRSFEPIVEEGEKELCSHCCVVQLSS
*DSLTSSPSPPTERNPSGHLILASFCLREPGPRSNISNWLASYNPSNNTWSHVSHIPDLLENHVLKGFSIVSLGDSVYIIGGLLCHK***************YDKVLAWVLRYNVKSNEWTRCAPLSVPRYDFACTVCDNKIYVAGGKSNLFSAKGTASAEVYHPELDQWTPLPNMSTLRYKCVGVTWQGKIHVVSGFAQRADSDGSVHFTERSSAEVYDTQAGKWDLVARMWQLDIPPNQIVEVDNRLFSSGDCLKAWKGHIESYDGELNMWDEVNGSCLQTLSSPVSTSSTNTEDWPPIQRLYLTMAPIGTHLYFLAGYRMAGELARTMSMVHIFDTAAKSDAWRSFEPIVEEGEKELCSHCCVVQLSS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSLTSSPSPPTERNPSGHLILASFCLREPGPRSNISNWLASYNPSNNTWSHVSHIPDLLENHVLKGFSIVSLGDSVYIIGGLLCHKERAHNSDESDDFVDAYDKVLAWVLRYNVKSNEWTRCAPLSVPRYDFACTVCDNKIYVAGGKSNLFSAKGTASAEVYHPELDQWTPLPNMSTLRYKCVGVTWQGKIHVVSGFAQRADSDGSVHFTERSSAEVYDTQAGKWDLVARMWQLDIPPNQIVEVDNRLFSSGDCLKAWKGHIESYDGELNMWDEVNGSCLQTLSSPVSTSSTNTEDWPPIQRLYLTMAPIGTHLYFLAGYRMAGELARTMSMVHIFDTAAKSDAWRSFEPIVEEGEKELCSHCCVVQLSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query371 2.2.26 [Sep-21-2011]
Q0WW40383 F-box/kelch-repeat protei yes no 0.536 0.519 0.286 3e-18
P59280629 Kelch-like protein 8 OS=M yes no 0.584 0.344 0.276 6e-16
Q9P2G9620 Kelch-like protein 8 OS=H yes no 0.592 0.354 0.270 5e-15
Q8VCK5604 Kelch-like protein 20 OS= no no 0.514 0.316 0.277 6e-13
D3Z8N4609 Kelch-like protein 20 OS= no no 0.514 0.313 0.277 7e-13
Q9Y2M5609 Kelch-like protein 20 OS= no no 0.514 0.313 0.277 7e-13
Q08DK3609 Kelch-like protein 20 OS= no no 0.514 0.313 0.277 7e-13
Q5R7B8609 Kelch-like protein 20 OS= no no 0.514 0.313 0.277 8e-13
B4GRJ2628 Kelch-like protein diablo N/A no 0.431 0.254 0.282 9e-13
Q2M0J9628 Kelch-like protein diablo yes no 0.431 0.254 0.282 1e-12
>sp|Q0WW40|FBK5_ARATH F-box/kelch-repeat protein At1g16250 OS=Arabidopsis thaliana GN=At1g16250 PE=2 SV=1 Back     alignment and function desciption
 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 63/220 (28%), Positives = 106/220 (48%), Gaps = 21/220 (9%)

Query: 37  SNWLASYNPSNNTWSHVSHIPDLLENHVLKGFSIVSLGDSVYIIGGLLCHKERAHNSDES 96
           + W+A Y+P  + W  +     + +     GF+ V + + + +IGG  C+      +   
Sbjct: 71  NQWVA-YDPEADRWHPLPRTRAVQDGWHHSGFACVCVSNCLLVIGG--CY------APSV 121

Query: 97  DDFVDAYDKVLAWVLRYNVKSNEWTRCAPLSVPRYDFACTVCDNKIYVAGGKSNLFSAKG 156
             F      V   V+R++    +W   A +  PR  FACT    K+YVAGG+ NL  ++G
Sbjct: 122 SSFPHQKPVVTKDVMRFDPFKKQWKMVASMRTPRTHFACTSVSGKVYVAGGR-NLTHSRG 180

Query: 157 TASAEVYHPELDQWTPLPNMSTLRYKCVGVTWQGKIHVVSGFAQRADSDGSVHFTERSSA 216
             SAEVY P  D+W  LP M   +  C G++++G  HV+S           V F E++S+
Sbjct: 181 IPSAEVYDPVADRWEELPAMPRPQMDCSGLSYRGCFHVLS---------DQVGFAEQNSS 231

Query: 217 EVYDTQAGKWDLVARMWQLDIPPNQIVEV--DNRLFSSGD 254
           EV++ +   W  V  +W         V+V  ++R+++  D
Sbjct: 232 EVFNPRDMTWSTVEDVWPFSRAMQFAVQVMKNDRVYTIVD 271

Arabidopsis thaliana (taxid: 3702)
>sp|P59280|KLHL8_MOUSE Kelch-like protein 8 OS=Mus musculus GN=Klhl8 PE=2 SV=2 Back     alignment and function description
>sp|Q9P2G9|KLHL8_HUMAN Kelch-like protein 8 OS=Homo sapiens GN=KLHL8 PE=2 SV=4 Back     alignment and function description
>sp|Q8VCK5|KLH20_MOUSE Kelch-like protein 20 OS=Mus musculus GN=Klhl20 PE=2 SV=2 Back     alignment and function description
>sp|D3Z8N4|KLH20_RAT Kelch-like protein 20 OS=Rattus norvegicus GN=Klhl20 PE=3 SV=1 Back     alignment and function description
>sp|Q9Y2M5|KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens GN=KLHL20 PE=1 SV=4 Back     alignment and function description
>sp|Q08DK3|KLH20_BOVIN Kelch-like protein 20 OS=Bos taurus GN=KLHL20 PE=2 SV=3 Back     alignment and function description
>sp|Q5R7B8|KLH20_PONAB Kelch-like protein 20 OS=Pongo abelii GN=KLHL20 PE=2 SV=3 Back     alignment and function description
>sp|B4GRJ2|KLHDB_DROPE Kelch-like protein diablo OS=Drosophila persimilis GN=dbo PE=3 SV=1 Back     alignment and function description
>sp|Q2M0J9|KLHDB_DROPS Kelch-like protein diablo OS=Drosophila pseudoobscura pseudoobscura GN=dbo PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query371
224113999335 predicted protein [Populus trichocarpa] 0.897 0.994 0.719 1e-142
224078904357 predicted protein [Populus trichocarpa] 0.929 0.966 0.674 1e-138
255560788385 conserved hypothetical protein [Ricinus 0.924 0.890 0.684 1e-135
356549387373 PREDICTED: kelch-like protein 8-like [Gl 0.938 0.932 0.646 1e-132
255644465373 unknown [Glycine max] 0.938 0.932 0.640 1e-131
356555080373 PREDICTED: kelch-like protein 8-like [Gl 0.938 0.932 0.646 1e-131
297739259369 unnamed protein product [Vitis vinifera] 0.975 0.981 0.615 1e-131
357446433369 Kelch-like protein [Medicago truncatula] 0.951 0.956 0.606 1e-127
359496826367 PREDICTED: influenza virus NS1A-binding 0.911 0.920 0.608 1e-124
147825260332 hypothetical protein VITISV_021766 [Viti 0.886 0.990 0.621 1e-123
>gi|224113999|ref|XP_002316638.1| predicted protein [Populus trichocarpa] gi|222859703|gb|EEE97250.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  511 bits (1316), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 241/335 (71%), Positives = 281/335 (83%), Gaps = 2/335 (0%)

Query: 37  SNWLASYNPSNNTWSHVSHIPDLLENHVLKGFSIVSLGDSVYIIGGLLCHKERA-HNSDE 95
           SNW+  YNPSNNTWS+VS IP L+ENHVLKGF++V+LGDS+YIIGGL C + R  HN DE
Sbjct: 1   SNWIECYNPSNNTWSYVSSIPGLIENHVLKGFAMVTLGDSIYIIGGLQCSRARPPHNLDE 60

Query: 96  SDDFVDAYDKVLAWVLRYNVKSNEWTRCAPLSVPRYDFACTVCDNKIYVAGGKSNLFSAK 155
           SD+F+D   +VL  VLRYNV+S++W++C PL VPRYDFAC +C+NKIYVAGGK +L S +
Sbjct: 61  SDEFIDLGVEVLRSVLRYNVRSSQWSQCTPLGVPRYDFACAICENKIYVAGGKPSLDSRR 120

Query: 156 GTASAEVYHPELDQWTPLPNMSTLRYKCVGVTWQGKIHVVSGFAQRADSDGSVHF-TERS 214
           G + AEVY P L+ W PLP MSTLRYKCVGVTWQGKIHVV GFA R DSD +V F TERS
Sbjct: 121 GISCAEVYDPTLNVWNPLPGMSTLRYKCVGVTWQGKIHVVGGFAMRGDSDKTVPFITERS 180

Query: 215 SAEVYDTQAGKWDLVARMWQLDIPPNQIVEVDNRLFSSGDCLKAWKGHIESYDGELNMWD 274
           SAEVYD Q GKWDL A MWQLD+PPNQIVE+D RLFSSGDCLKAWKGHIE+YDG+LN+W+
Sbjct: 181 SAEVYDPQTGKWDLAAGMWQLDVPPNQIVEIDGRLFSSGDCLKAWKGHIEAYDGKLNIWN 240

Query: 275 EVNGSCLQTLSSPVSTSSTNTEDWPPIQRLYLTMAPIGTHLYFLAGYRMAGELARTMSMV 334
            V+GS LQTLSSP+STS  + E+WPPIQR+YLTMAPIGT L+F+AGYRMAGEL+R MSMV
Sbjct: 241 VVDGSHLQTLSSPISTSEASDENWPPIQRIYLTMAPIGTQLFFMAGYRMAGELSRIMSMV 300

Query: 335 HIFDTAAKSDAWRSFEPIVEEGEKELCSHCCVVQL 369
            IFDT A   AWRS EP+ EEG KELCSHCCVV++
Sbjct: 301 LIFDTTATRHAWRSSEPMEEEGVKELCSHCCVVRI 335

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224078904|ref|XP_002305674.1| predicted protein [Populus trichocarpa] gi|222848638|gb|EEE86185.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255560788|ref|XP_002521407.1| conserved hypothetical protein [Ricinus communis] gi|223539306|gb|EEF40897.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356549387|ref|XP_003543075.1| PREDICTED: kelch-like protein 8-like [Glycine max] Back     alignment and taxonomy information
>gi|255644465|gb|ACU22736.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356555080|ref|XP_003545867.1| PREDICTED: kelch-like protein 8-like [Glycine max] Back     alignment and taxonomy information
>gi|297739259|emb|CBI28910.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357446433|ref|XP_003593494.1| Kelch-like protein [Medicago truncatula] gi|355482542|gb|AES63745.1| Kelch-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|359496826|ref|XP_003635348.1| PREDICTED: influenza virus NS1A-binding protein homolog [Vitis vinifera] gi|296088904|emb|CBI38453.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147825260|emb|CAN73262.1| hypothetical protein VITISV_021766 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query371
TAIR|locus:2032855383 AT1G16250 "AT1G16250" [Arabido 0.590 0.571 0.288 2.1e-18
MGI|MGI:2179430629 Klhl8 "kelch-like 8" [Mus musc 0.407 0.240 0.327 4.4e-13
FB|FBgn0034396620 CG15097 [Drosophila melanogast 0.436 0.261 0.280 1.1e-11
TAIR|locus:2008773376 AT1G67480 "AT1G67480" [Arabido 0.285 0.281 0.361 2.4e-11
TAIR|locus:2077299352 AT3G63220 "AT3G63220" [Arabido 0.423 0.446 0.308 3.3e-11
UNIPROTKB|Q96PQ7755 KLHL5 "Kelch-like protein 5" [ 0.460 0.226 0.286 1.7e-10
UNIPROTKB|B4GRJ2628 dbo "Kelch-like protein diablo 0.296 0.175 0.330 2e-10
UNIPROTKB|Q2M0J9628 dbo "Kelch-like protein diablo 0.296 0.175 0.330 2e-10
UNIPROTKB|B0WWP2582 dbo "Kelch-like protein diablo 0.296 0.189 0.322 2.1e-10
UNIPROTKB|Q7QGL0582 dbo "Kelch-like protein diablo 0.296 0.189 0.322 2.1e-10
TAIR|locus:2032855 AT1G16250 "AT1G16250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 240 (89.5 bits), Expect = 2.1e-18, P = 2.1e-18
 Identities = 71/246 (28%), Positives = 118/246 (47%)

Query:    37 SNWLASYNPSNNTWSHVSHIPDLLENHVLKGFSIVSLGDSVYIIGGLLCHKERAHNSDES 96
             + W+A Y+P  + W  +     + +     GF+ V + + + +IGG  C+      +   
Sbjct:    71 NQWVA-YDPEADRWHPLPRTRAVQDGWHHSGFACVCVSNCLLVIGG--CY------APSV 121

Query:    97 DDFVDAYDKVLAWVLRYNVKSNEWTRCAPLSVPRYDFACTVCDNKIYVAGGKSNLFSAKG 156
               F      V   V+R++    +W   A +  PR  FACT    K+YVAGG+ NL  ++G
Sbjct:   122 SSFPHQKPVVTKDVMRFDPFKKQWKMVASMRTPRTHFACTSVSGKVYVAGGR-NLTHSRG 180

Query:   157 TASAEVYHPELDQWTPLPNMSTLRYKCVGVTWQGKIHVVSGFAQRADSDGSVHFTERSSA 216
               SAEVY P  D+W  LP M   +  C G++++G  HV+S      D  G   F E++S+
Sbjct:   181 IPSAEVYDPVADRWEELPAMPRPQMDCSGLSYRGCFHVLS------DQVG---FAEQNSS 231

Query:   217 EVYDTQAGKWDLVARMWQLDIPPNQIVEV--DNRLFSSGDCLKAW-KGHIESYDGELNMW 273
             EV++ +   W  V  +W         V+V  ++R+++  D    W +  I++ D +   W
Sbjct:   232 EVFNPRDMTWSTVEDVWPFSRAMQFAVQVMKNDRVYTIVD----WGESLIKTRDTDEGEW 287

Query:   274 DEVNGS 279
               V GS
Sbjct:   288 YNV-GS 292
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
MGI|MGI:2179430 Klhl8 "kelch-like 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0034396 CG15097 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:2008773 AT1G67480 "AT1G67480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077299 AT3G63220 "AT3G63220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q96PQ7 KLHL5 "Kelch-like protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B4GRJ2 dbo "Kelch-like protein diablo" [Drosophila persimilis (taxid:7234)] Back     alignment and assigned GO terms
UNIPROTKB|Q2M0J9 dbo "Kelch-like protein diablo" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms
UNIPROTKB|B0WWP2 dbo "Kelch-like protein diablo" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms
UNIPROTKB|Q7QGL0 dbo "Kelch-like protein diablo" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.XI.2031.1
hypothetical protein (335 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query371
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 1e-13
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 6e-11
pfam0134446 pfam01344, Kelch_1, Kelch motif 3e-10
smart0061247 smart00612, Kelch, Kelch domain 1e-07
smart0061247 smart00612, Kelch, Kelch domain 2e-06
pfam1396450 pfam13964, Kelch_6, Kelch motif 6e-06
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 6e-06
pfam1396450 pfam13964, Kelch_6, Kelch motif 1e-05
TIGR03548323 TIGR03548, mutarot_permut, cyclically-permuted mut 1e-04
pfam0134446 pfam01344, Kelch_1, Kelch motif 2e-04
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 5e-04
TIGR03547346 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family 0.002
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information 
 Score = 71.3 bits (175), Expect = 1e-13
 Identities = 43/191 (22%), Positives = 77/191 (40%), Gaps = 31/191 (16%)

Query: 42  SYNPSNNTWSHVSHIPDLLENHVLKGFSIVSLGDSVYIIGGLLCHKERAHNSDESDDFVD 101
           +Y  + +  S ++ I D   ++V    S+V L + +Y IGG                 ++
Sbjct: 265 NYITNYSPLSEINTIID--IHYVYCFGSVV-LNNVIYFIGG-----------------MN 304

Query: 102 AYDKVLAWVLRYNVKSNEWTRCAPLSVPRYDFACTVCDNKIYVAGGKSNLFSAKGTASAE 161
             +  +  V+ Y+ K+  W +   L  PR +   TV +N+IYV GG  N  S     + E
Sbjct: 305 KNNLSVNSVVSYDTKTKSWNKVPELIYPRKNPGVTVFNNRIYVIGGIYNSIS---LNTVE 361

Query: 162 VYHPELDQWTPLPNMSTLRYKCVGVTWQGKIHVVSGFAQRADSDGSVHFTERSSAEVYDT 221
            + P   +W   P +   RY    V     I+V+ G ++  +   +V        E +  
Sbjct: 362 SWKPGESKWREEPPLIFPRYNPCVVNVNNLIYVIGGISKNDELLKTV--------ECFSL 413

Query: 222 QAGKWDLVARM 232
              KW   + +
Sbjct: 414 NTNKWSKGSPL 424

Length = 534
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 371
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PLN02153341 epithiospecifier protein 100.0
PLN02193470 nitrile-specifier protein 100.0
PLN02153341 epithiospecifier protein 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PLN02193470 nitrile-specifier protein 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PHA02713557 hypothetical protein; Provisional 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
KOG1230521 consensus Protein containing repeated kelch motifs 99.96
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.96
KOG0379482 consensus Kelch repeat-containing proteins [Genera 99.95
KOG1230 521 consensus Protein containing repeated kelch motifs 99.95
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.93
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.92
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.88
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.8
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.46
PF1396450 Kelch_6: Kelch motif 99.29
PF1396450 Kelch_6: Kelch motif 99.26
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.19
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.05
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.98
PF1341549 Kelch_3: Galactose oxidase, central domain 98.94
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.92
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.9
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.85
PF1341549 Kelch_3: Galactose oxidase, central domain 98.81
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.78
smart0061247 Kelch Kelch domain. 98.72
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.68
smart0061247 Kelch Kelch domain. 98.65
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.63
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.6
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.5
PLN02772398 guanylate kinase 98.44
PF1385442 Kelch_5: Kelch motif 98.37
PF1385442 Kelch_5: Kelch motif 98.35
PLN02772 398 guanylate kinase 98.3
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.22
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.15
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.1
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.01
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.86
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.79
PF03089337 RAG2: Recombination activating protein 2; InterPro 97.76
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.56
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.1
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.08
smart00284255 OLF Olfactomedin-like domains. 96.97
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 96.96
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 96.84
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 96.8
PF12768 281 Rax2: Cortical protein marker for cell polarity 96.43
PF12768281 Rax2: Cortical protein marker for cell polarity 96.4
KOG2055514 consensus WD40 repeat protein [General function pr 96.4
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.32
KOG2055514 consensus WD40 repeat protein [General function pr 95.92
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.74
KOG0310 487 consensus Conserved WD40 repeat-containing protein 95.47
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 95.41
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 95.38
PRK04792448 tolB translocation protein TolB; Provisional 95.3
PRK04922433 tolB translocation protein TolB; Provisional 95.22
KOG0310 487 consensus Conserved WD40 repeat-containing protein 95.0
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 95.0
PRK00178430 tolB translocation protein TolB; Provisional 94.95
PF12217367 End_beta_propel: Catalytic beta propeller domain o 94.81
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 94.58
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 94.49
PRK04922433 tolB translocation protein TolB; Provisional 94.35
PRK04792448 tolB translocation protein TolB; Provisional 94.19
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 94.13
KOG0281499 consensus Beta-TrCP (transducin repeats containing 94.08
smart00284255 OLF Olfactomedin-like domains. 94.0
PLN00181793 protein SPA1-RELATED; Provisional 93.89
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 93.84
PRK05137435 tolB translocation protein TolB; Provisional 93.5
PTZ00421 493 coronin; Provisional 93.49
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 93.42
PRK11028330 6-phosphogluconolactonase; Provisional 93.2
PRK05137435 tolB translocation protein TolB; Provisional 93.09
PRK04043419 tolB translocation protein TolB; Provisional 92.87
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 92.86
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 92.68
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 92.66
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 92.57
PRK13684334 Ycf48-like protein; Provisional 92.48
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 92.43
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 92.43
PRK00178430 tolB translocation protein TolB; Provisional 92.22
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 92.11
COG4880603 Secreted protein containing C-terminal beta-propel 92.0
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 91.89
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 91.67
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 91.59
PRK02889427 tolB translocation protein TolB; Provisional 91.5
KOG0266456 consensus WD40 repeat-containing protein [General 91.07
KOG3545249 consensus Olfactomedin and related extracellular m 90.85
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 90.41
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 90.32
PRK03629429 tolB translocation protein TolB; Provisional 90.16
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 89.92
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 89.63
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 89.15
PRK03629429 tolB translocation protein TolB; Provisional 89.07
PLN00033398 photosystem II stability/assembly factor; Provisio 88.61
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 88.46
COG4946 668 Uncharacterized protein related to the periplasmic 88.21
COG1520370 FOG: WD40-like repeat [Function unknown] 88.18
PF13859310 BNR_3: BNR repeat-like domain; PDB: 3B69_A. 87.58
KOG0316307 consensus Conserved WD40 repeat-containing protein 87.51
PRK11028330 6-phosphogluconolactonase; Provisional 87.34
KOG2321 703 consensus WD40 repeat protein [General function pr 86.92
PTZ00420 568 coronin; Provisional 86.86
KOG0316307 consensus Conserved WD40 repeat-containing protein 86.56
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 86.54
PRK02889427 tolB translocation protein TolB; Provisional 86.38
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 86.03
PLN00181793 protein SPA1-RELATED; Provisional 85.64
PRK01742429 tolB translocation protein TolB; Provisional 85.56
PLN029191057 haloacid dehalogenase-like hydrolase family protei 85.43
PRK04043419 tolB translocation protein TolB; Provisional 85.33
PLN00033398 photosystem II stability/assembly factor; Provisio 84.88
KOG0646 476 consensus WD40 repeat protein [General function pr 84.34
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 82.86
PTZ00421 493 coronin; Provisional 82.57
PF12217367 End_beta_propel: Catalytic beta propeller domain o 81.51
KOG0289506 consensus mRNA splicing factor [General function p 81.44
KOG0265338 consensus U5 snRNP-specific protein-like factor an 81.41
PTZ00420 568 coronin; Provisional 81.23
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 80.86
PRK10115 686 protease 2; Provisional 80.46
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 80.32
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 80.18
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 80.12
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 80.01
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=2.8e-46  Score=365.69  Aligned_cols=284  Identities=26%  Similarity=0.460  Sum_probs=248.4

Q ss_pred             ceEEEEeeecCCCCCCCccccceeEEeCCCCceeccCCCCcccccccccceEEEEECCEEEEEcCcccccCCCCCCCCCC
Q 042957           18 GHLILASFCLREPGPRSNISNWLASYNPSNNTWSHVSHIPDLLENHVLKGFSIVSLGDSVYIIGGLLCHKERAHNSDESD   97 (371)
Q Consensus        18 ~~~i~~g~~~~~~~~~~~~~~~~~~yd~~~~~W~~~~~~~~~~~~~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~   97 (371)
                      +.++++||..+    .....+.+.+|||.++.|..+++|+     .+|..+++++++++||++||.+.            
T Consensus       285 ~~l~~vGG~~~----~~~~~~~ve~yd~~~~~w~~~a~m~-----~~r~~~~~~~~~~~lYv~GG~~~------------  343 (571)
T KOG4441|consen  285 GKLVAVGGYNR----QGQSLRSVECYDPKTNEWSSLAPMP-----SPRCRVGVAVLNGKLYVVGGYDS------------  343 (571)
T ss_pred             CeEEEECCCCC----CCcccceeEEecCCcCcEeecCCCC-----cccccccEEEECCEEEEEccccC------------
Confidence            33444555443    2456788999999999999999998     56889999999999999999962            


Q ss_pred             ccccccccccceEEEEECCCCeeeecCCCCCCCCCeeEEEECCEEEEEcCCCCCCCCCCCceEEEEeCCCCceEeCCCCC
Q 042957           98 DFVDAYDKVLAWVLRYNVKSNEWTRCAPLSVPRYDFACTVCDNKIYVAGGKSNLFSAKGTASAEVYHPELDQWTPLPNMS  177 (371)
Q Consensus        98 ~~~~~~~~~~~~v~~yd~~~~~W~~~~~~~~~r~~~~~~~~~~~lyv~GG~~~~~~~~~~~~~~~yd~~t~~W~~~~~~p  177 (371)
                           +...++.+|+||+.+++|..+++|..+|..++++++++.||++||.+   +...++++|+||+.+++|+.+++|+
T Consensus       344 -----~~~~l~~ve~YD~~~~~W~~~a~M~~~R~~~~v~~l~g~iYavGG~d---g~~~l~svE~YDp~~~~W~~va~m~  415 (571)
T KOG4441|consen  344 -----GSDRLSSVERYDPRTNQWTPVAPMNTKRSDFGVAVLDGKLYAVGGFD---GEKSLNSVECYDPVTNKWTPVAPML  415 (571)
T ss_pred             -----CCcccceEEEecCCCCceeccCCccCccccceeEEECCEEEEEeccc---cccccccEEEecCCCCcccccCCCC
Confidence                 23568999999999999999999999999999999999999999998   5567889999999999999999999


Q ss_pred             CCceeeEEEEECCEEEEEecccCCCCCCCCccccccCeeEEEECCCCceeeccccccCCCCCCeEEEECCEEEEEcCCCC
Q 042957          178 TLRYKCVGVTWQGKIHVVSGFAQRADSDGSVHFTERSSAEVYDTQAGKWDLVARMWQLDIPPNQIVEVDNRLFSSGDCLK  257 (371)
Q Consensus       178 ~~~~~~~~~~~~~~lyv~GG~~~~~~~~~~~~~~~~~~v~~yd~~t~~W~~~~~~~~~~~~~~~~~~~~~~iyv~GG~~~  257 (371)
                      .+|..+++++++++||++||......        +++++++|||.+++|+.+++|+.++.. +++++++++||++||...
T Consensus       416 ~~r~~~gv~~~~g~iYi~GG~~~~~~--------~l~sve~YDP~t~~W~~~~~M~~~R~~-~g~a~~~~~iYvvGG~~~  486 (571)
T KOG4441|consen  416 TRRSGHGVAVLGGKLYIIGGGDGSSN--------CLNSVECYDPETNTWTLIAPMNTRRSG-FGVAVLNGKIYVVGGFDG  486 (571)
T ss_pred             cceeeeEEEEECCEEEEEcCcCCCcc--------ccceEEEEcCCCCceeecCCccccccc-ceEEEECCEEEEECCccC
Confidence            99999999999999999999887764        568999999999999999999999875 589999999999999865


Q ss_pred             -CccCeEEEEeCCCCceEeecCcccccCCCCcccCCCCCCCCCCceeeeeeEeeeCCeEEEEcceeecccccceeeEEEE
Q 042957          258 -AWKGHIESYDGELNMWDEVNGSCLQTLSSPVSTSSTNTEDWPPIQRLYLTMAPIGTHLYFLAGYRMAGELARTMSMVHI  336 (371)
Q Consensus       258 -~~~~~~~~yd~~~~~W~~~~~~~~~~l~~~~~~~~~~~~~~~p~~r~~~~~~~~~~~l~v~GG~~~~~~~~~~~~~v~~  336 (371)
                       .....+++||+.+++|+.+     ++|..+               |..+++++++++||++||.+..    ..+.+|+.
T Consensus       487 ~~~~~~VE~ydp~~~~W~~v-----~~m~~~---------------rs~~g~~~~~~~ly~vGG~~~~----~~l~~ve~  542 (571)
T KOG4441|consen  487 TSALSSVERYDPETNQWTMV-----APMTSP---------------RSAVGVVVLGGKLYAVGGFDGN----NNLNTVEC  542 (571)
T ss_pred             CCccceEEEEcCCCCceeEc-----ccCccc---------------cccccEEEECCEEEEEecccCc----cccceeEE
Confidence             2346699999999999999     888766               9999999999999999997765    78999999


Q ss_pred             eecccccccccccCccccccccccccceeeEEe
Q 042957          337 FDTAAKSDAWRSFEPIVEEGEKELCSHCCVVQL  369 (371)
Q Consensus       337 ~d~~~~~~~W~~~~~~p~~~~~~~~~~~~~~~~  369 (371)
                      |||+++  +|+..+. |.   ......+|++..
T Consensus       543 ydp~~d--~W~~~~~-~~---~~~~~~~~~~~~  569 (571)
T KOG4441|consen  543 YDPETD--TWTEVTE-PE---SGRGGAGVAVIP  569 (571)
T ss_pred             cCCCCC--ceeeCCC-cc---ccccCcceEEec
Confidence            999998  9999999 63   444445555543

>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>COG4880 Secreted protein containing C-terminal beta-propeller domain distantly related to WD-40 repeats [General function prediction only] Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3545 consensus Olfactomedin and related extracellular matrix glycoproteins [Extracellular structures] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PF13859 BNR_3: BNR repeat-like domain; PDB: 3B69_A Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query371
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 2e-12
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 2e-12
1x2j_A316 Structural Basis For The Defects Of Human Lung Canc 9e-12
2dyh_A318 Crystal Structure Of The Keap1 Protein In Complexed 1e-11
4asc_A315 Crystal Structure Of The Kelch Domain Of Human Kbtb 4e-11
1zgk_A308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 2e-10
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 1e-08
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 3e-08
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 1e-07
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 3e-07
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 4e-07
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure 
Iteration: 1

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 99/244 (40%), Gaps = 41/244 (16%)
Query: 38  NWLASYNPSNNTWSHVSHIPDLLENHVLKGFSIVSLGDSVYIIGGLLCHKERAHNSDESD 97
           ++L +YNPS+ TW              L    +   G +  ++GGLL      +NS + +
Sbjct: 40  SYLEAYNPSDGTWLR------------LADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGN 87
Query: 98  DFVDAYDKVLAWVLRYNVKSNEWTRCAPLSVPRYDFACTVCDNKIYVAGGKSNLFSAKGT 157
               A D        YN  +N+W+ CAP+SVPR      V D  IY  GG          
Sbjct: 88  TDSSALDC-------YNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHN-- 138
Query: 158 ASAEVYHPELDQWTPLPNMSTLRYKCVGVTWQGKIHVVSGFAQRADSDGSVHFTERSSAE 217
            S E Y PE D+W  +  M T R           ++ V GF      DG+      +SAE
Sbjct: 139 -SVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGF------DGTNRL---NSAE 188
Query: 218 VYDTQAGKWDLVARMWQLDIPPNQIVEVDNRLFSSG-----DCLKAWKGHIESYDGELNM 272
            Y  +  +W ++  M  +       V + N ++++G     D L +    +E YD E   
Sbjct: 189 CYYPERNEWRMITAMNTIRSGAGVCV-LHNCIYAAGGYDGQDQLNS----VERYDVETET 243
Query: 273 WDEV 276
           W  V
Sbjct: 244 WTFV 247
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure
>pdb|4ASC|A Chain A, Crystal Structure Of The Kelch Domain Of Human Kbtbd5 Length = 315 Back     alignment and structure
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query371
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-40
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 3e-40
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 6e-26
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-23
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 4e-10
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 4e-40
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 4e-38
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-36
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-25
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-22
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 5e-11
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 9e-40
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-38
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 3e-14
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-39
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-37
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-30
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 4e-25
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 3e-39
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 4e-39
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 4e-29
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-22
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-13
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-37
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-36
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-28
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-24
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 4e-22
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 1e-19
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 3e-19
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 4e-18
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 4e-13
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 3e-11
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 6e-08
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 2e-06
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 5e-05
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 1e-07
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 1e-06
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 9e-06
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 8e-04
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
 Score =  144 bits (365), Expect = 1e-40
 Identities = 59/310 (19%), Positives = 94/310 (30%), Gaps = 76/310 (24%)

Query: 34  SNISNWLASYNPSNNTWSHVSHIPDLLENHVLKGFSIVSLGDSVYIIGGLLCHKERAHNS 93
             +S +   ++  ++ W  +   P L        F +    +S+Y++GG           
Sbjct: 63  DPMSAYFLQFDHLDSEWLGM---PPLPSPR--CLFGLGEALNSIYVVGG----------R 107

Query: 94  DESDDFVDAYDKVLAWVLRYNVKSNEWTRCAPLSVPRYDFACTVCDNKIYVAGGKSNLFS 153
           +  D      ++ L  V+ Y+  S +W    PL    Y        + +YV GGK +   
Sbjct: 108 EIKDG-----ERCLDSVMCYDRLSFKWGESDPLPYVVYGHTVLSHMDLVYVIGGKGS--D 160

Query: 154 AKGTASAEVYHPELDQWTPLPNMSTLRYKCVGVTWQGKIHVVSGFAQRADSDGSVHFTER 213
            K      VY P+  +W  L  M T R         G+I V +G         +      
Sbjct: 161 RKCLNKMCVYDPKKFEWKELAPMQTARSLFGATVHDGRIIVAAGV------TDTGLT--- 211

Query: 214 SSAEVYDTQAGKWDLVARMWQLDIPPNQ------IVEVDNRLF----------SSGDCLK 257
           SSAEVY     KW              Q      +V +   L+           SG+ + 
Sbjct: 212 SSAEVYSITDNKWAPFEAF-------PQERSSLSLVSLVGTLYAIGGFATLETESGELVP 264

Query: 258 AWKGHIESYDGELNMWDEVNGSCLQTLSSPVSTSSTNTEDWPPIQRLYLTMAPIGTHLYF 317
                I  Y+ E   W+ V                                  +   L  
Sbjct: 265 TELNDIWRYNEEEKKWEGV----------------------LREIAYAAGATFLPVRLNV 302

Query: 318 LAGYRMAGEL 327
           L   +MA  L
Sbjct: 303 LRLTKMAENL 312
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query371
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 100.0
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.97
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.45
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.43
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.28
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.06
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.06
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.02
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.88
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.88
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.73
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.73
3jrp_A379 Fusion protein of protein transport protein SEC13 97.63
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.62
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.53
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.52
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.49
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.47
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.47
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.4
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.36
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.35
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.34
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 97.3
3jrp_A379 Fusion protein of protein transport protein SEC13 97.27
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.25
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.22
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.22
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.2
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.18
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.17
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.15
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.15
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.14
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.14
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 97.13
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.12
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.1
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.1
2pm7_B297 Protein transport protein SEC13, protein transport 97.09
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 97.08
3v9f_A 781 Two-component system sensor histidine kinase/RESP 97.06
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.04
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.04
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.04
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.93
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.93
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.9
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 96.9
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.89
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.89
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.88
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.84
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.83
3jro_A 753 Fusion protein of protein transport protein SEC13 96.77
3v9f_A 781 Two-component system sensor histidine kinase/RESP 96.76
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 96.76
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.75
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 96.72
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.71
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 96.7
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.69
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 96.67
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.66
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.65
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 96.63
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.63
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 96.62
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 96.61
3jro_A 753 Fusion protein of protein transport protein SEC13 96.61
4a2l_A 795 BT_4663, two-component system sensor histidine kin 96.58
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.57
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.54
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 96.54
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 96.52
4a2l_A 795 BT_4663, two-component system sensor histidine kin 96.52
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.45
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 96.43
4g56_B357 MGC81050 protein; protein arginine methyltransfera 96.42
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 96.42
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.41
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 96.41
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 96.41
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 96.39
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 96.34
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.33
2pm7_B297 Protein transport protein SEC13, protein transport 96.23
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 96.23
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 96.2
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 96.18
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.18
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.17
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 96.14
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.12
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.07
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 96.04
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 95.99
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 95.98
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 95.98
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 95.92
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 95.88
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.87
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 95.86
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.86
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 95.83
4e54_B435 DNA damage-binding protein 2; beta barrel, double 95.81
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 95.78
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 95.77
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 95.75
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 95.74
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 95.72
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 95.71
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 95.69
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 95.66
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 95.63
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 95.63
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 95.62
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 95.58
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.55
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 95.53
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 95.5
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 95.45
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 95.4
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 95.4
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 95.37
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 95.34
2p4o_A306 Hypothetical protein; putative lactonase, structur 95.29
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 95.29
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 95.29
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 95.27
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 95.19
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 95.11
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 95.03
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 95.01
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 94.98
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 94.98
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 94.97
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 94.89
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 94.89
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 94.89
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 94.88
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 94.74
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 94.74
2xyi_A430 Probable histone-binding protein CAF1; transcripti 94.7
3ott_A 758 Two-component system sensor histidine kinase; beta 94.68
3ott_A758 Two-component system sensor histidine kinase; beta 94.67
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 94.61
2xyi_A430 Probable histone-binding protein CAF1; transcripti 94.59
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 94.53
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 94.52
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 94.52
4e54_B435 DNA damage-binding protein 2; beta barrel, double 94.51
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 94.42
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 94.41
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 94.4
2fp8_A322 Strictosidine synthase; six bladed beta propeller 94.38
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 94.33
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 94.27
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 94.2
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 94.19
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 94.17
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 94.12
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 94.03
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 93.98
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 93.92
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 93.76
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 93.7
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 93.63
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 93.63
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 93.62
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 93.59
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 93.52
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 93.52
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 93.34
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 93.26
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 93.18
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 93.17
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 93.13
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 93.09
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 93.06
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 93.0
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 92.95
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 92.85
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 92.76
3v65_B386 Low-density lipoprotein receptor-related protein; 92.73
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 92.7
2fp8_A322 Strictosidine synthase; six bladed beta propeller 92.61
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 92.56
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 92.52
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 92.48
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 92.39
2ymu_A577 WD-40 repeat protein; unknown function, two domain 92.39
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 92.37
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 92.34
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 92.17
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 92.1
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 92.04
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 91.97
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 91.86
1itv_A195 MMP9; adaptive molecular recognition, beta propell 91.72
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 91.69
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 91.64
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 91.61
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 91.57
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 91.48
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 91.3
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 91.26
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 91.25
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 91.12
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 91.09
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 91.01
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 90.73
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 90.61
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 90.42
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 90.29
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 90.16
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 89.84
3p5b_L400 Low density lipoprotein receptor variant; B-propel 89.79
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 89.7
3v65_B386 Low-density lipoprotein receptor-related protein; 89.65
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 89.39
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 89.22
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 88.95
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 88.81
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 88.75
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 88.69
2ymu_A577 WD-40 repeat protein; unknown function, two domain 88.58
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 88.5
1itv_A195 MMP9; adaptive molecular recognition, beta propell 88.36
3p5b_L400 Low density lipoprotein receptor variant; B-propel 88.3
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 88.22
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 88.12
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, he 87.89
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 87.65
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 87.2
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 86.6
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 86.36
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 86.29
3lp9_A227 LS-24; SEED albumin, plant protein; HET: SPM; 2.20 85.77
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 85.01
3ju4_A 670 Endo-N-acetylneuraminidase; endonf, polysia, high- 84.67
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 84.65
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 84.63
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 84.57
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 84.43
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 84.21
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 83.53
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 83.36
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 82.65
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 81.03
2ece_A462 462AA long hypothetical selenium-binding protein; 80.6
2p4o_A306 Hypothetical protein; putative lactonase, structur 80.51
1k32_A 1045 Tricorn protease; protein degradation, substrate g 80.29
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
Probab=100.00  E-value=2.6e-47  Score=350.17  Aligned_cols=271  Identities=25%  Similarity=0.426  Sum_probs=237.4

Q ss_pred             ccccceeEEeCCCCceeccCCCCcccccccccceEEEEECCEEEEEcCcccccCCCCCCCCCCccccccccccceEEEEE
Q 042957           35 NISNWLASYNPSNNTWSHVSHIPDLLENHVLKGFSIVSLGDSVYIIGGLLCHKERAHNSDESDDFVDAYDKVLAWVLRYN  114 (371)
Q Consensus        35 ~~~~~~~~yd~~~~~W~~~~~~~~~~~~~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~yd  114 (371)
                      ...+++++||+.+++|..++++|     .+|..|++++++++|||+||.....              ......+++++||
T Consensus        36 ~~~~~~~~~d~~~~~W~~~~~~p-----~~r~~~~~~~~~~~lyv~GG~~~~~--------------~~~~~~~~~~~~d   96 (308)
T 1zgk_A           36 QSLSYLEAYNPSNGTWLRLADLQ-----VPRSGLAGCVVGGLLYAVGGRNNSP--------------DGNTDSSALDCYN   96 (308)
T ss_dssp             SBCCCEEEEETTTTEEEECCCCS-----SCCBSCEEEEETTEEEEECCEEEET--------------TEEEECCCEEEEE
T ss_pred             CCcceEEEEcCCCCeEeECCCCC-----cccccceEEEECCEEEEECCCcCCC--------------CCCeecceEEEEC
Confidence            45688999999999999998887     5689999999999999999983110              0335678999999


Q ss_pred             CCCCeeeecCCCCCCCCCeeEEEECCEEEEEcCCCCCCCCCCCceEEEEeCCCCceEeCCCCCCCceeeEEEEECCEEEE
Q 042957          115 VKSNEWTRCAPLSVPRYDFACTVCDNKIYVAGGKSNLFSAKGTASAEVYHPELDQWTPLPNMSTLRYKCVGVTWQGKIHV  194 (371)
Q Consensus       115 ~~~~~W~~~~~~~~~r~~~~~~~~~~~lyv~GG~~~~~~~~~~~~~~~yd~~t~~W~~~~~~p~~~~~~~~~~~~~~lyv  194 (371)
                      +.+++|++++++|.+|..|+++.++++||++||...   ....+++++||+.+++|+.++++|.+|..+++++++++||+
T Consensus        97 ~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~---~~~~~~~~~yd~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv  173 (308)
T 1zgk_A           97 PMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHG---CIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYA  173 (308)
T ss_dssp             TTTTEEEECCCCSSCCBTCEEEEETTEEEEECCEET---TEECCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEE
T ss_pred             CCCCeEeECCCCCcCccccEEEEECCEEEEEcCCCC---CcccccEEEECCCCCeEeECCCCCccccceEEEEECCEEEE
Confidence            999999999999999999999999999999999863   34578899999999999999999999999999999999999


Q ss_pred             EecccCCCCCCCCccccccCeeEEEECCCCceeeccccccCCCCCCeEEEECCEEEEEcCCCC-CccCeEEEEeCCCCce
Q 042957          195 VSGFAQRADSDGSVHFTERSSAEVYDTQAGKWDLVARMWQLDIPPNQIVEVDNRLFSSGDCLK-AWKGHIESYDGELNMW  273 (371)
Q Consensus       195 ~GG~~~~~~~~~~~~~~~~~~v~~yd~~t~~W~~~~~~~~~~~~~~~~~~~~~~iyv~GG~~~-~~~~~~~~yd~~~~~W  273 (371)
                      +||.....         ..+++++||+.+++|+.+..+|.++.. ++++.++++||++||... ...+++++||+++++|
T Consensus       174 ~GG~~~~~---------~~~~~~~yd~~~~~W~~~~~~p~~r~~-~~~~~~~~~iyv~GG~~~~~~~~~v~~yd~~~~~W  243 (308)
T 1zgk_A          174 VGGFDGTN---------RLNSAECYYPERNEWRMITAMNTIRSG-AGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETW  243 (308)
T ss_dssp             ECCBCSSC---------BCCCEEEEETTTTEEEECCCCSSCCBS-CEEEEETTEEEEECCBCSSSBCCCEEEEETTTTEE
T ss_pred             EeCCCCCC---------cCceEEEEeCCCCeEeeCCCCCCcccc-ceEEEECCEEEEEeCCCCCCccceEEEEeCCCCcE
Confidence            99987654         457899999999999999999888764 678889999999999854 3457899999999999


Q ss_pred             EeecCcccccCCCCcccCCCCCCCCCCceeeeeeEeeeCCeEEEEcceeecccccceeeEEEEeecccccccccccCccc
Q 042957          274 DEVNGSCLQTLSSPVSTSSTNTEDWPPIQRLYLTMAPIGTHLYFLAGYRMAGELARTMSMVHIFDTAAKSDAWRSFEPIV  353 (371)
Q Consensus       274 ~~~~~~~~~~l~~~~~~~~~~~~~~~p~~r~~~~~~~~~~~l~v~GG~~~~~~~~~~~~~v~~~d~~~~~~~W~~~~~~p  353 (371)
                      +.+     ++++.+               |..++++.++++|||+||.+..    ....++++||++++  +|+.++.||
T Consensus       244 ~~~-----~~~p~~---------------r~~~~~~~~~~~i~v~GG~~~~----~~~~~v~~yd~~~~--~W~~~~~~p  297 (308)
T 1zgk_A          244 TFV-----APMKHR---------------RSALGITVHQGRIYVLGGYDGH----TFLDSVECYDPDTD--TWSEVTRMT  297 (308)
T ss_dssp             EEC-----CCCSSC---------------CBSCEEEEETTEEEEECCBCSS----CBCCEEEEEETTTT--EEEEEEECS
T ss_pred             EEC-----CCCCCC---------------ccceEEEEECCEEEEEcCcCCC----cccceEEEEcCCCC--EEeecCCCC
Confidence            999     777654               9999999999999999998653    56789999999998  999999999


Q ss_pred             cccccccccceeeE
Q 042957          354 EEGEKELCSHCCVV  367 (371)
Q Consensus       354 ~~~~~~~~~~~~~~  367 (371)
                          .+++.|+|++
T Consensus       298 ----~~r~~~~~~~  307 (308)
T 1zgk_A          298 ----SGRSGVGVAV  307 (308)
T ss_dssp             ----SCCBSCEEEE
T ss_pred             ----CCcccceeEe
Confidence                5778888876
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3lp9_A LS-24; SEED albumin, plant protein; HET: SPM; 2.20A {Lathyrus sativus} PDB: 3s0l_A 3v6n_A 4hsd_A 3s18_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 371
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 3e-09
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 4e-04
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 3e-08
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 4e-07
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 1e-06
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 1e-06
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 1e-04
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 3e-04
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 55.3 bits (131), Expect = 3e-09
 Identities = 46/318 (14%), Positives = 81/318 (25%), Gaps = 56/318 (17%)

Query: 73  LGDSVYIIGGLLCHKERAHNSDESDDFVDAYDKVLAWVLRYNVKSNEWTRCAPLSVPRYD 132
           +G  +Y  GG                    + + L+++  YN  +  W R A L VPR  
Sbjct: 3   VGRLIYTAGGY-------------------FRQSLSYLEAYNPSNGTWLRLADLQVPRSG 43

Query: 133 FACTVCDNKIYVAGGKSNLFSAKGTASAEVYHPELDQWTPLPNMSTLRYKCVGVTWQGKI 192
            A  V    +Y  GG++N       +SA   +  +          ++    +GV      
Sbjct: 44  LAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGH 103

Query: 193 HVVSGFAQRADSDGSVHFTERSSAEVYDTQ-----------------------AGKWDLV 229
               G +       SV   E    E +                              + +
Sbjct: 104 IYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRL 163

Query: 230 ARMWQLDIPPNQIVEVDNRLFSSGDCLKAWKGHIESYDGELNMWDEVNGSCLQTLSSPVS 289
                     N+   +                +     G  +  D++N          V 
Sbjct: 164 NSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERY----DVE 219

Query: 290 TSSTNTEDWPPIQRLYLTMAPIGTHLYFLAGYRMAGELARTMSMVHIFDTAAKSDAWRSF 349
           T +         +R  L +      +Y L GY         +  V  +D    +D W   
Sbjct: 220 TETWTFVAPMKHRRSALGITVHQGRIYVLGGYDG----HTFLDSVECYDP--DTDTWSEV 273

Query: 350 EPIVEEGEKELCSHCCVV 367
             +              V
Sbjct: 274 TRMTS----GRSGVGVAV 287
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query371
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.97
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.95
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.22
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.74
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.73
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.58
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.55
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 96.42
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.35
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 96.26
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 95.99
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 95.94
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 95.93
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 95.9
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 95.81
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 95.63
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 95.59
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 95.49
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 95.34
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 94.87
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 94.77
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 94.64
d1tbga_340 beta1-subunit of the signal-transducing G protein 94.54
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 94.53
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 94.42
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 94.05
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 93.95
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 93.88
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 93.63
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 93.51
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 93.51
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 93.5
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 93.27
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 93.26
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 92.54
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 92.33
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 92.31
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 91.65
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 91.53
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 91.44
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 91.24
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 91.08
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 91.05
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 90.06
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 89.98
d1tbga_340 beta1-subunit of the signal-transducing G protein 89.18
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 88.94
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 88.87
d1flga_ 582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 87.51
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 86.64
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 86.29
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 86.03
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 85.11
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 84.89
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 84.03
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 83.6
d1v0ea1516 Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 34 82.89
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 80.8
d1v0ea1516 Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 34 80.1
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.3e-42  Score=311.03  Aligned_cols=270  Identities=25%  Similarity=0.427  Sum_probs=236.5

Q ss_pred             cccceeEEeCCCCceeccCCCCcccccccccceEEEEECCEEEEEcCcccccCCCCCCCCCCccccccccccceEEEEEC
Q 042957           36 ISNWLASYNPSNNTWSHVSHIPDLLENHVLKGFSIVSLGDSVYIIGGLLCHKERAHNSDESDDFVDAYDKVLAWVLRYNV  115 (371)
Q Consensus        36 ~~~~~~~yd~~~~~W~~~~~~~~~~~~~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~yd~  115 (371)
                      ..+.+++||+.+++|++++++|     .+|++|++++++++|||+||.....              ......+++|+||+
T Consensus        17 ~~~~~~~yd~~t~~W~~~~~~p-----~~R~~~~~~~~~~~iyv~GG~~~~~--------------~~~~~~~~~~~yd~   77 (288)
T d1zgka1          17 SLSYLEAYNPSNGTWLRLADLQ-----VPRSGLAGCVVGGLLYAVGGRNNSP--------------DGNTDSSALDCYNP   77 (288)
T ss_dssp             BCCCEEEEETTTTEEEECCCCS-----SCCBSCEEEEETTEEEEECCEEEET--------------TEEEECCCEEEEET
T ss_pred             CCceEEEEECCCCeEEECCCCC-----CccceeEEEEECCEEEEEeCcccCC--------------CCccccchhhhccc
Confidence            4688999999999999999887     5689999999999999999985322              13456789999999


Q ss_pred             CCCeeeecCCCCCCCCCeeEEEECCEEEEEcCCCCCCCCCCCceEEEEeCCCCceEeCCCCCCCceeeEEEEECCEEEEE
Q 042957          116 KSNEWTRCAPLSVPRYDFACTVCDNKIYVAGGKSNLFSAKGTASAEVYHPELDQWTPLPNMSTLRYKCVGVTWQGKIHVV  195 (371)
Q Consensus       116 ~~~~W~~~~~~~~~r~~~~~~~~~~~lyv~GG~~~~~~~~~~~~~~~yd~~t~~W~~~~~~p~~~~~~~~~~~~~~lyv~  195 (371)
                      .+++|++++++|.+|..|++++.+++||++||..   .....+.++.||+.+++|...+.++..|..++++..++++|++
T Consensus        78 ~~~~w~~~~~~p~~r~~~~~~~~~~~i~~~gg~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~  154 (288)
T d1zgka1          78 MTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSH---GCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAV  154 (288)
T ss_dssp             TTTEEEECCCCSSCCBTCEEEEETTEEEEECCEE---TTEECCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEE
T ss_pred             ccccccccccccceecceeccccceeeEEeccee---cccccceeeeeccccCccccccccccccccceeeeeeecceEe
Confidence            9999999999999999999999999999999986   3345788999999999999999999999999999999999999


Q ss_pred             ecccCCCCCCCCccccccCeeEEEECCCCceeeccccccCCCCCCeEEEECCEEEEEcCCCC-CccCeEEEEeCCCCceE
Q 042957          196 SGFAQRADSDGSVHFTERSSAEVYDTQAGKWDLVARMWQLDIPPNQIVEVDNRLFSSGDCLK-AWKGHIESYDGELNMWD  274 (371)
Q Consensus       196 GG~~~~~~~~~~~~~~~~~~v~~yd~~t~~W~~~~~~~~~~~~~~~~~~~~~~iyv~GG~~~-~~~~~~~~yd~~~~~W~  274 (371)
                      ||.....         ....++.||+.+++|.....++..+. .++++..+++|+++||... ....++++||+.+++|+
T Consensus       155 GG~~~~~---------~~~~~~~~d~~~~~~~~~~~~~~~~~-~~~~~~~~~~i~i~GG~~~~~~~~~~~~~~~~~~~~~  224 (288)
T d1zgka1         155 GGFDGTN---------RLNSAECYYPERNEWRMITAMNTIRS-GAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWT  224 (288)
T ss_dssp             CCBCSSC---------BCCCEEEEETTTTEEEECCCCSSCCB-SCEEEEETTEEEEECCBCSSSBCCCEEEEETTTTEEE
T ss_pred             cCccccc---------ccceEEEeeccccccccccccccccc-cccccceeeeEEEecCccccccccceeeeeecceeee
Confidence            9987654         45789999999999999987776655 4578899999999999854 34578999999999999


Q ss_pred             eecCcccccCCCCcccCCCCCCCCCCceeeeeeEeeeCCeEEEEcceeecccccceeeEEEEeecccccccccccCcccc
Q 042957          275 EVNGSCLQTLSSPVSTSSTNTEDWPPIQRLYLTMAPIGTHLYFLAGYRMAGELARTMSMVHIFDTAAKSDAWRSFEPIVE  354 (371)
Q Consensus       275 ~~~~~~~~~l~~~~~~~~~~~~~~~p~~r~~~~~~~~~~~l~v~GG~~~~~~~~~~~~~v~~~d~~~~~~~W~~~~~~p~  354 (371)
                      .+     ++++.+               |..|+++.++++|||+||.+..    ..+.++++||++++  +|+.+++|| 
T Consensus       225 ~~-----~~~p~~---------------r~~~~~~~~~~~l~v~GG~~~~----~~~~~v~~yd~~~~--~W~~~~~~p-  277 (288)
T d1zgka1         225 FV-----APMKHR---------------RSALGITVHQGRIYVLGGYDGH----TFLDSVECYDPDTD--TWSEVTRMT-  277 (288)
T ss_dssp             EC-----CCCSSC---------------CBSCEEEEETTEEEEECCBCSS----CBCCEEEEEETTTT--EEEEEEECS-
T ss_pred             cc-----cCccCc---------------ccceEEEEECCEEEEEecCCCC----eecceEEEEECCCC--EEEECCCCC-
Confidence            99     666544               9999999999999999998654    67789999999998  999999999 


Q ss_pred             ccccccccceeeE
Q 042957          355 EGEKELCSHCCVV  367 (371)
Q Consensus       355 ~~~~~~~~~~~~~  367 (371)
                         .++..|+++|
T Consensus       278 ---~~R~~~~~~~  287 (288)
T d1zgka1         278 ---SGRSGVGVAV  287 (288)
T ss_dssp             ---SCCBSCEEEE
T ss_pred             ---CCcEeEEEEE
Confidence               6788888776
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v0ea1 b.68.1.2 (A:245-760) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v0ea1 b.68.1.2 (A:245-760) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]} Back     information, alignment and structure