Citrus Sinensis ID: 043038


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-
MPNLTKFTQLLFRSLDSNNMSGLLPLISSNLVYLGLSDNSFLGSISHFLCDKINETKRLEALKLNDNYLQGELPDCWMSDQNLKILKLSNNKFIGNLPNSFGSLAFLVWLDLGKNRLFGTIPATLKNCTALESLDVERFSRMVVLNLRSNKFHGPLPTRFCDLAILQILDIADNNLSGAIPNYINNVTGMVTTNSFSRSAQQHLHVPLDVDVILMEKASVVSREEVVEYNEILNLVMVTIVSRNDLLKNVPLEVRNLKATQSLNFSHNTFT
cccccccccccEEEccccccccccccccccccEEEccccccEEEccHHHHHcccccccccEEEcccccccccccccccccccccEEEccccccEEcccccccccccccEEEcccccccccccHHHHccccccEEcccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHHHHHHccccccccccccccccccccEEEEEEEEEEEccccHHHHHHHHcEEEEEcccccccccccHHHHcccccccccccccccc
ccccccccccEEEEEccccccccccHHcccccEEEcccccccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccHEEEcccccccccccHHHccHHHHHHcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccc
MPNLTKFTQLLFRSLdsnnmsgllplissnlvylglsdnsflGSISHFLCDKINETKRLEALKLNDnylqgelpdcwmsdqnlKILKLSNnkfignlpnsfgSLAFLVWLDlgknrlfgtipatlknctalesldVERFSRMVVLNLrsnkfhgplptrfcDLAILQILDIadnnlsgaipnyiNNVTGMVttnsfsrsaqqhlhvpldVDVILMEKASVVSREEVVEYNEILNLVMVTIVSrndllknvplevrnlkatqslnfshntft
MPNLTKFTQLLFRSLDSNNMSGLLPLISSNLVYLGLSDNSFLGSISHFLCDKINETKRLEALKLNDNYLQGELPDCWMSDQNLKILKLSNNKFIGNLPNSFGSLAFLVWLDLGKNRLFGTIPATLKNCTALESLDVERFSRMVVLNLRsnkfhgplPTRFCDLAILQILDIADNNLSGAIPNYINNVTGMVTTNSFSRSAQQHLHVPLDVDVILMEKASVVSREEVVEYNEILNLVMVTIVSRNDLLKNVPLEvrnlkatqslnfshntft
MPNLTKFTQLLFRSLDSNNMSGLLPLISSNLVYLGLSDNSFLGSISHFLCDKINETKRLEALKLNDNYLQGELPDCWMSDQNLKILKLSNNKFIGNLPNSFGSLAFLVWLDLGKNRLFGTIPATLKNCTALESLDVERFSRMVVLNLRSNKFHGPLPTRFCDLAILQILDIADNNLSGAIPNYINNVTGMVTTNSFSRSAQQHLHVPLDVDVILMEKASVVSREEVVEYNEILNLVMVTIVSRNDLLKNVPLEVRNLKATQSLNFSHNTFT
******FTQLLFRSLDSNNMSGLLPLISSNLVYLGLSDNSFLGSISHFLCDKINETKRLEALKLNDNYLQGELPDCWMSDQNLKILKLSNNKFIGNLPNSFGSLAFLVWLDLGKNRLFGTIPATLKNCTALESLDVERFSRMVVLNLRSNKFHGPLPTRFCDLAILQILDIADNNLSGAIPNYINNVTGMVTTNSFSRSAQQHLHVPLDVDVILMEKASVVSREEVVEYNEILNLVMVTIVSRNDLLKNVPLEVRNL**************
MPNLTKFTQLLFRSLDSNNMSGLLPLISSNLVYLGLSDNSFLGSISHFLCDKINETKRLEALKLNDNYLQGELPDCWMSDQNLKILKLSNNKFIGNLPNSFGSLAFLVWLDLGKNRLFGTIPATLKNCTALESLDVERFSRMVVLNLRSNKFHGPLPTRFCDLAILQILDIADNNLSGAIPNYINNVTGMVTT**********LHVPLDVDVILMEKASVVSREEVVEYNEILNLVMVTIVSRNDLLKNVPLEVRNLKATQSLNFSHNTFT
MPNLTKFTQLLFRSLDSNNMSGLLPLISSNLVYLGLSDNSFLGSISHFLCDKINETKRLEALKLNDNYLQGELPDCWMSDQNLKILKLSNNKFIGNLPNSFGSLAFLVWLDLGKNRLFGTIPATLKNCTALESLDVERFSRMVVLNLRSNKFHGPLPTRFCDLAILQILDIADNNLSGAIPNYINNVTGMVTTNSFSRSAQQHLHVPLDVDVILMEKASVVSREEVVEYNEILNLVMVTIVSRNDLLKNVPLEVRNLKATQSLNFSHNTFT
MPNLTKFTQLLFRSLDSNNMSGLLPLISSNLVYLGLSDNSFLGSISHFLCDKINETKRLEALKLNDNYLQGELPDCWMSDQNLKILKLSNNKFIGNLPNSFGSLAFLVWLDLGKNRLFGTIPATLKNCTALESLDVERFSRMVVLNLRSNKFHGPLPTRFCDLAILQILDIADNNLSGAIPNYINNVTGMVTTNSFSRSAQQHLHVPLDVDVILMEKASVVSREEVVEYNEILNLVMVTIVSRNDLLKNVPLEVRNLKATQSLNFS*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPNLTKFTQLLFRSLDSNNMSGLLPLISSNLVYLGLSDNSFLGSISHFLCDKINETKRLEALKLNDNYLQGELPDCWMSDQNLKILKLSNNKFIGNLPNSFGSLAFLVWLDLGKNRLFGTIPATLKNCTALESLDVERFSRMVVLNLRSNKFHGPLPTRFCDLAILQILDIADNNLSGAIPNYINNVTGMVTTNSFSRSAQQHLHVPLDVDVILMEKASVVSREEVVEYNEILNLVMVTIVSRNDLLKNVPLEVRNLKATQSLNFSHNTFT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query271 2.2.26 [Sep-21-2011]
Q9C9H7 847 Receptor-like protein 12 no no 0.940 0.301 0.298 8e-22
O49318 1124 Probable leucine-rich rep no no 0.937 0.225 0.303 7e-19
Q9SCT4 836 Probably inactive leucine no no 0.653 0.211 0.321 3e-18
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.959 0.207 0.293 2e-17
O82318 960 Probably inactive leucine no no 0.937 0.264 0.299 3e-17
C0LGQ9 1037 Probable LRR receptor-lik no no 0.789 0.206 0.291 4e-17
O22938 890 Leucine-rich repeat recep no no 0.678 0.206 0.331 6e-17
Q9SHI2 1101 Leucine-rich repeat recep no no 0.859 0.211 0.275 9e-17
Q9FL28 1173 LRR receptor-like serine/ no no 0.874 0.202 0.281 1e-16
C0LGQ5 1249 LRR receptor-like serine/ no no 0.926 0.200 0.288 4e-16
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  104 bits (259), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 95/318 (29%), Positives = 138/318 (43%), Gaps = 63/318 (19%)

Query: 2   PNLTKFTQLLFRSLDSNNMSGLLP---------LISSN--------------LVYLGLSD 38
           P ++K   LL   L  NN+ G +P         ++S N              +  L L+ 
Sbjct: 393 PTISKLVNLLHLDLSKNNLEGEVPACLWRLNTMVLSHNSFSSFENTSQEEALIEELDLNS 452

Query: 39  NSFLGSISHFLCDKINETKRLEALKLNDNYLQGELPDCWMS-DQNLKILKLSNNKFIGNL 97
           NSF G I + +C    +   L  L L++N   G +P C  +   ++K L L +N F G L
Sbjct: 453 NSFQGPIPYMIC----KLSSLGFLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNFSGTL 508

Query: 98  PNSFGSLAFLVWLDLGKNRLFGTIPATLKNCTALESLDV-------------ERFSRMVV 144
           P+ F     LV LD+  N+L G  P +L NC ALE ++V             E    + V
Sbjct: 509 PDIFSKATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLPSLHV 568

Query: 145 LNLRSNKFHGPLPTRFCDLAI--LQILDIADNNLSGAI-PNYINNVTGMVT--------T 193
           LNLRSNKF+GPL  R   +    L+I+DI+ NN SG + P Y +N   M T         
Sbjct: 569 LNLRSNKFYGPLYHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDMTTLTEEMDQYM 628

Query: 194 NSFSRSAQQHLHVPLDVDVILMEKASVVSREEVVEYNEILNLVMVTIVSRNDLLKNVPLE 253
             F R A  + H           +  +V++   + +  I         S N +  N+P  
Sbjct: 629 TEFWRYADSYYH-----------EMEMVNKGVDMSFERIRRDFRAIDFSGNKINGNIPES 677

Query: 254 VRNLKATQSLNFSHNTFT 271
           +  LK  + LN S N FT
Sbjct: 678 LGYLKELRVLNLSGNAFT 695




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9SCT4|IMK2_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 OS=Arabidopsis thaliana GN=IMK2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ9|Y4294_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g20940 OS=Arabidopsis thaliana GN=At4g20940 PE=1 SV=1 Back     alignment and function description
>sp|O22938|Y2182_ARATH Leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 OS=Arabidopsis thaliana GN=At2g41820 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query271
255543977 1075 serine/threonine-protein kinase bri1, pu 0.940 0.237 0.422 2e-48
224072885 1024 predicted protein [Populus trichocarpa] 0.922 0.244 0.441 1e-47
255543959 602 serine-threonine protein kinase, plant-t 0.922 0.415 0.437 3e-47
255547794 909 serine-threonine protein kinase, plant-t 0.966 0.288 0.405 3e-47
209970607 1045 M18S-3Ap [Malus floribunda] 0.937 0.243 0.401 2e-45
350284751 980 receptor-like protein [Malus baccata] 0.929 0.257 0.404 2e-44
14330716 980 HcrVf2 protein [Malus floribunda] gi|350 0.929 0.257 0.404 2e-44
350284749 980 receptor-like protein [Malus baccata] 0.929 0.257 0.404 2e-44
209970625 974 HB09p [Malus floribunda] 0.904 0.251 0.405 4e-44
209970618 967 M18-S3Bp [Malus floribunda] 0.929 0.260 0.402 4e-44
>gi|255543977|ref|XP_002513051.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] gi|223548062|gb|EEF49554.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  198 bits (503), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 115/272 (42%), Positives = 156/272 (57%), Gaps = 17/272 (6%)

Query: 15  LDSNNMSGLLPLISSNLVYLGLSDNSFLGSISHFLCDKINETKRLEALKLNDNYLQGELP 74
           + SNN  G +P  SSNL  L LS NSF GSI +FLC K+ E K++E L L  N L GE+P
Sbjct: 653 MSSNNFRGPVPYFSSNLSALDLSSNSFTGSIINFLCYKMQEVKKMEVLNLGGNLLSGEIP 712

Query: 75  DCWMSDQNLKILKLSNNKFIGNLPNSFGSLAFLVWLDLGKNRLFGTIPATLKNCTALESL 134
           DCW+S Q+L  + LSNNKF GN+P S G+L+FL  +    N L G IP +++NC  L +L
Sbjct: 713 DCWLSWQSLTAINLSNNKFTGNIPKSIGTLSFLESVHFANNDLSGDIPLSIQNCRKLFTL 772

Query: 135 DV--------------ERFSRMVVLNLRSNKFHGPLPTRFCDLAILQILDIADNNLSGAI 180
           D               +    M++L LR NK HG +P   C +A LQILD+ADNN S  I
Sbjct: 773 DFSGNKLVGKIPSWIGKSIPDMIILILRGNKLHGQIPEEICRMASLQILDLADNNFSSMI 832

Query: 181 PNYINNVTGMVTTN-SFSRSAQQHLHVPLDVDVILMEKASVVSREEVVEYNEILNLVMVT 239
           P+  +N +GMV  N SF        +V      IL++ A +V +  V EY+ IL  V   
Sbjct: 833 PSCFSNFSGMVKVNDSFGSLTFDQSNV--GPSPILIDSAILVIKGRVAEYSTILGFVKAI 890

Query: 240 IVSRNDLLKNVPLEVRNLKATQSLNFSHNTFT 271
            +S N+L   +P+ + +L   QSL+FS N+ T
Sbjct: 891 DLSNNNLSGEIPMNITSLVGLQSLSFSQNSLT 922




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224072885|ref|XP_002303927.1| predicted protein [Populus trichocarpa] gi|222841359|gb|EEE78906.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255543959|ref|XP_002513042.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223548053|gb|EEF49545.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255547794|ref|XP_002514954.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223546005|gb|EEF47508.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|209970607|gb|ACJ03066.1| M18S-3Ap [Malus floribunda] Back     alignment and taxonomy information
>gi|350284751|gb|AEQ27747.1| receptor-like protein [Malus baccata] Back     alignment and taxonomy information
>gi|14330716|emb|CAC40826.1| HcrVf2 protein [Malus floribunda] gi|350284757|gb|AEQ27750.1| receptor-like protein [Malus micromalus] Back     alignment and taxonomy information
>gi|350284749|gb|AEQ27746.1| receptor-like protein [Malus baccata] Back     alignment and taxonomy information
>gi|209970625|gb|ACJ03073.1| HB09p [Malus floribunda] Back     alignment and taxonomy information
>gi|209970618|gb|ACJ03070.1| M18-S3Bp [Malus floribunda] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query271
TAIR|locus:2173777 792 RLP54 "receptor like protein 5 0.608 0.208 0.349 7.9e-23
TAIR|locus:2085537 894 RLP34 "AT3G11010" [Arabidopsis 0.583 0.176 0.337 2.6e-22
TAIR|locus:2044767905 AT2G34930 "AT2G34930" [Arabido 0.848 0.254 0.315 4.8e-22
TAIR|locus:2144392 957 RLP53 "receptor like protein 5 0.583 0.165 0.36 1.3e-21
TAIR|locus:2825384 847 RLP12 "AT1G71400" [Arabidopsis 0.852 0.272 0.325 1.9e-21
TAIR|locus:2160791 1102 AT5G63930 [Arabidopsis thalian 0.915 0.225 0.284 2.8e-21
TAIR|locus:2094603 835 RLP37 "receptor like protein 3 0.693 0.225 0.311 3.7e-21
TAIR|locus:2037313 1000 RLP13 "AT1G74170" [Arabidopsis 0.667 0.181 0.331 4e-21
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.952 0.206 0.298 4.4e-21
TAIR|locus:2046525 1124 AT2G33170 [Arabidopsis thalian 0.937 0.225 0.303 4.8e-21
TAIR|locus:2173777 RLP54 "receptor like protein 54" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 242 (90.2 bits), Expect = 7.9e-23, Sum P(2) = 7.9e-23
 Identities = 66/189 (34%), Positives = 99/189 (52%)

Query:    15 LDSNNMSGLLPLISSNLVYLGLSDNSFLGSISHFLCDKINETKRLEALKLNDNYLQGELP 74
             L SN   G  P+I   +  +  S+N F G I    C +     RL  L L++N   G +P
Sbjct:   382 LSSNAFKGSFPIIPPYVNIMAASNNYFTGGIPLIFCKRY----RLSLLDLSNNNFSGTIP 437

Query:    75 DCWMS-DQNLKILKLSNNKFIGNLPNSFGSLAFLVWLDLGKNRLFGTIPATLKNCTALES 133
              C  +    L+ LKLSNN   G LP+    L   V LD+G N++ G +P +L NCT L+ 
Sbjct:   438 RCLTNVSLGLEALKLSNNSLTGRLPDIEDRL---VLLDVGHNQISGKLPRSLVNCTTLKF 494

Query:   134 LDVE-------------RFSRMVVLNLRSNKFHGPLPTRFCDLAI--LQILDIADNNLSG 178
             L+VE               +R+ ++ LRSN+FHGP+ +    L+   L+I+DI+ N+ +G
Sbjct:   495 LNVEGNHINDTFPFWLKALTRLEIIVLRSNRFHGPISSPEVSLSFTALRIIDISRNSFNG 554

Query:   179 AIP-NYINN 186
             ++P NY  N
Sbjct:   555 SLPQNYFAN 563


GO:0005886 "plasma membrane" evidence=ISM
GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009617 "response to bacterium" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0035304 "regulation of protein dephosphorylation" evidence=RCA
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160791 AT5G63930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094603 RLP37 "receptor like protein 37" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046525 AT2G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00031679
hypothetical protein (1024 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query271
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-24
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-18
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-17
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-16
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-16
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  102 bits (256), Expect = 1e-24
 Identities = 69/194 (35%), Positives = 96/194 (49%), Gaps = 23/194 (11%)

Query: 15  LDSNNMSGLLP--LISSNLVY-LGLSDNSFLGSISHFLCDKINETKRLEALKLNDNYLQG 71
           L  N+ SG LP       LVY L +S+N+  G I+     +  +   L+ L L  N   G
Sbjct: 411 LQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRIN----SRKWDMPSLQMLSLARNKFFG 466

Query: 72  ELPDCWMSDQNLKILKLSNNKFIGNLPNSFGSLAFLVWLDLGKNRLFGTIPATLKNCTAL 131
            LPD + S   L+ L LS N+F G +P   GSL+ L+ L L +N+L G IP  L +C  L
Sbjct: 467 GLPDSFGSK-RLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKL 525

Query: 132 ESLDVERFSRMVVLNLRSNKFHGPLPTRFCDLAILQILDIADNNLSGAIPNYINNVTGMV 191
            SLD           L  N+  G +P  F ++ +L  LD++ N LSG IP  + NV  +V
Sbjct: 526 VSLD-----------LSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLV 574

Query: 192 TTNSFSRSAQQHLH 205
             N     +  HLH
Sbjct: 575 QVN----ISHNHLH 584


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 271
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.95
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.94
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.86
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.84
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.83
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.76
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.74
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.72
KOG0617264 consensus Ras suppressor protein (contains leucine 99.71
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.7
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.69
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.64
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.63
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.62
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.61
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.6
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.6
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.6
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.44
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.35
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.34
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.14
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 99.12
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.09
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.05
PLN03150623 hypothetical protein; Provisional 99.04
PLN03150623 hypothetical protein; Provisional 99.02
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.99
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.98
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.91
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.9
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.89
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.89
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.79
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.78
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.67
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.62
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.52
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.48
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.41
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.31
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.27
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.21
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.21
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.12
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.08
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.0
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.98
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.95
PRK15386 426 type III secretion protein GogB; Provisional 97.9
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.86
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.64
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.51
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.43
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.26
PRK15386 426 type III secretion protein GogB; Provisional 97.14
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.11
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.5
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.37
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.32
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.17
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.07
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.86
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.25
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.16
KOG4308 478 consensus LRR-containing protein [Function unknown 95.02
KOG4308 478 consensus LRR-containing protein [Function unknown 94.4
KOG1947482 consensus Leucine rich repeat proteins, some prote 93.96
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.9
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 91.45
KOG1947482 consensus Leucine rich repeat proteins, some prote 90.29
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.75
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.17
smart0037026 LRR Leucine-rich repeats, outliers. 89.08
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.08
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.72
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 88.57
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 84.82
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.95  E-value=3.4e-27  Score=225.66  Aligned_cols=184  Identities=35%  Similarity=0.540  Sum_probs=117.0

Q ss_pred             CccCCCcccEEECcCCCCCCCcccc----CCCccEEEccCCccccccchhhhhhccCCCcccEEEccCcccCCCCCcccc
Q 043038            3 NLTKFTQLLFRSLDSNNMSGLLPLI----SSNLVYLGLSDNSFLGSISHFLCDKINETKRLEALKLNDNYLQGELPDCWM   78 (271)
Q Consensus         3 ~~~~~~~L~~L~l~~n~~~~~~~~~----~~~L~~L~l~~n~~~~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~   78 (271)
                      ++.++++|+.|++++|.+.+.+|..    +.+|++|++++|.+++.+|..      .++.|++|++++|.+++..|..+.
T Consensus        88 ~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~------~l~~L~~L~Ls~n~~~~~~p~~~~  161 (968)
T PLN00113         88 AIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRG------SIPNLETLDLSNNMLSGEIPNDIG  161 (968)
T ss_pred             HHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCcc------ccCCCCEEECcCCcccccCChHHh
Confidence            3667788888888888887766653    457778888877776655531      255666666666666655666666


Q ss_pred             CCCCCCEEEccCCcccccCCcccccCCCccEEEccCCccccccCccccCCCCccEEec-------------CCCCcccEE
Q 043038           79 SDQNLKILKLSNNKFIGNLPNSFGSLAFLVWLDLGKNRLFGTIPATLKNCTALESLDV-------------ERFSRMVVL  145 (271)
Q Consensus        79 ~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~l~l~~n~l~~~~~~~~~~l~~L~~L~l-------------~~~~~L~~L  145 (271)
                      .+++|++|++++|.+.+..|..+..+++|+.|++++|.+.+..|..++.+++|+.|++             ..+++|++|
T Consensus       162 ~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L  241 (968)
T PLN00113        162 SFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHL  241 (968)
T ss_pred             cCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEE
Confidence            6666666666666665556666666666666666666665556666666666666655             334456666


Q ss_pred             EeccCccCCCCchhhhcCccccEEeccCCccceecCcccccccCCcc
Q 043038          146 NLRSNKFHGPLPTRFCDLAILQILDIADNNLSGAIPNYINNVTGMVT  192 (271)
Q Consensus       146 ~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~  192 (271)
                      ++++|.+++..|..+..+++|+.|++++|.+.+.+|..+.++++|+.
T Consensus       242 ~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~  288 (968)
T PLN00113        242 DLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLIS  288 (968)
T ss_pred             ECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCE
Confidence            66666666556666666666666666666665555555555555544



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query271
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-11
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-08
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-11
3rgx_A768 Structural Insight Into Brassinosteroid Perception 5e-08
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-10
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 66.6 bits (161), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 70/235 (29%), Positives = 99/235 (42%), Gaps = 43/235 (18%) Query: 1 MPNLTKFTQLLFRSLDSNNMSGLLPL----ISSNLVYLGLSDNSFLGSISHFLCDKINET 56 M L K L L N SG LP +S++L+ L LS N+F G I LC N Sbjct: 333 MDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQ--NPK 390 Query: 57 KRLEALKLNDNYLQGELPDCWMSDQNLKILKLSNNKFIGNLPNSFGSLAFL----VWLDL 112 L+ L L +N G++P + L L LS N G +P+S GSL+ L +WL++ Sbjct: 391 NTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNM 450 Query: 113 --GK------------------NRLFGTIPATLKNCTALESLD-------------VERF 139 G+ N L G IP+ L NCT L + + R Sbjct: 451 LEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRL 510 Query: 140 SRMVVLNLRSNKFHGPLPTRFCDLAILQILDIADNNLSGAIPNYINNVTGMVTTN 194 + +L L +N F G +P D L LD+ N +G IP + +G + N Sbjct: 511 ENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAAN 565
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query271
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-47
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-31
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-31
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-30
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-28
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-27
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-24
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-24
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-23
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-15
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-13
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-31
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-28
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-27
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-25
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-20
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-18
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-19
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-18
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-17
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-15
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-15
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-14
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-09
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-08
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-08
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-09
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 9e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  167 bits (426), Expect = 1e-47
 Identities = 66/276 (23%), Positives = 101/276 (36%), Gaps = 22/276 (7%)

Query: 14  SLDSNNMSGLLP-----LISSNLVYLGLSDNSFLGSISHFLCDKINETKRLEALKLNDNY 68
            L SNN SG +         + L  L L +N F G I   L +       L +L L+ NY
Sbjct: 374 DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN----CSELVSLHLSFNY 429

Query: 69  LQGELPDCWMSDQNLKILKLSNNKFIGNLPNSFGSLAFLVWLDLGKNRLFGTIPATLKNC 128
           L G +P    S   L+ LKL  N   G +P     +  L  L L  N L G IP+ L NC
Sbjct: 430 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNC 489

Query: 129 TALESLDVE-------------RFSRMVVLNLRSNKFHGPLPTRFCDLAILQILDIADNN 175
           T L  + +              R   + +L L +N F G +P    D   L  LD+  N 
Sbjct: 490 TNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNL 549

Query: 176 LSGAIPNYINNVTGMVTTNSFSRSAQQHLHVPLDVDVILMEKASVVSREEVVEYNEILNL 235
            +G IP  +   +G +  N  +     ++               +  +    E    L+ 
Sbjct: 550 FNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLST 609

Query: 236 VMVTIVSRNDLLKNVPLEVRNLKATQSLNFSHNTFT 271
                ++      +      N  +   L+ S+N  +
Sbjct: 610 RNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLS 645


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query271
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.94
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.93
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.93
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.93
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.93
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.93
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.93
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.93
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.92
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.92
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.92
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.92
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.92
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.92
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.9
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.9
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.9
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.89
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.89
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.89
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.89
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.89
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.89
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.89
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.88
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.86
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.86
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.83
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 99.83
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.82
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.81
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.8
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.8
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.79
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.79
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.78
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.75
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.67
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.67
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.67
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.66
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.64
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.62
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.62
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.61
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.6
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.58
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.57
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.56
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.54
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.53
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.45
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.45
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.41
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.39
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.36
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.32
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.3
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.27
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.25
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.22
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.15
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.88
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.87
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.73
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.69
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.55
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.53
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.41
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.35
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.24
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.2
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.16
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.08
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.76
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.67
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.63
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.58
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.85
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.66
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=99.97  E-value=5.2e-30  Score=238.23  Aligned_cols=259  Identities=28%  Similarity=0.373  Sum_probs=174.4

Q ss_pred             ccCCC-cccEEECcCCCCCCCcccc-----CCCccEEEccCCccccccchhhhhhccCCCcccEEEccCcccCCCCCccc
Q 043038            4 LTKFT-QLLFRSLDSNNMSGLLPLI-----SSNLVYLGLSDNSFLGSISHFLCDKINETKRLEALKLNDNYLQGELPDCW   77 (271)
Q Consensus         4 ~~~~~-~L~~L~l~~n~~~~~~~~~-----~~~L~~L~l~~n~~~~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~   77 (271)
                      +.+++ +|+.|++++|.+.+..|..     +++|++|++++|.+++.+|..+..    +++|++|++++|.+++..|..|
T Consensus       363 l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~----l~~L~~L~Ls~N~l~~~~p~~l  438 (768)
T 3rgz_A          363 LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN----CSELVSLHLSFNYLSGTIPSSL  438 (768)
T ss_dssp             HHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGG----CTTCCEEECCSSEEESCCCGGG
T ss_pred             HHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhc----CCCCCEEECcCCcccCcccHHH
Confidence            34454 6777777777776655544     245777777777777666655544    7777777777777776677777


Q ss_pred             cCCCCCCEEEccCCcccccCCcccccCCCccEEEccCCccccccCccccCCCCccEEec-------------CCCCcccE
Q 043038           78 MSDQNLKILKLSNNKFIGNLPNSFGSLAFLVWLDLGKNRLFGTIPATLKNCTALESLDV-------------ERFSRMVV  144 (271)
Q Consensus        78 ~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~l~l~~n~l~~~~~~~~~~l~~L~~L~l-------------~~~~~L~~  144 (271)
                      ..+++|+.|++++|.+++..|..+..+++|+.+++++|.+.+..|..+..+++|+.|++             ..+++|+.
T Consensus       439 ~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~  518 (768)
T 3rgz_A          439 GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAI  518 (768)
T ss_dssp             GGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCE
T ss_pred             hcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCE
Confidence            77777777777777777667777777777777777777777667777777777777766             33456777


Q ss_pred             EEeccCccCCCCchhhhcCccccEEeccCCccceecCccccccc------------------------------------
Q 043038          145 LNLRSNKFHGPLPTRFCDLAILQILDIADNNLSGAIPNYINNVT------------------------------------  188 (271)
Q Consensus       145 L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~------------------------------------  188 (271)
                      |++++|.+++.+|..+..+++|+.|++++|.++|.+|..+....                                    
T Consensus       519 L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  598 (768)
T 3rgz_A          519 LKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQG  598 (768)
T ss_dssp             EECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTT
T ss_pred             EECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcccccccccccccccccccccccccccccc
Confidence            77777777777777777777777777777777766665543321                                    


Q ss_pred             ----------------------------------CCcc----ccccccccccccccccchhhhhhhhceec---cccchh
Q 043038          189 ----------------------------------GMVT----TNSFSRSAQQHLHVPLDVDVILMEKASVV---SREEVV  227 (271)
Q Consensus       189 ----------------------------------~L~~----~n~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~  227 (271)
                                                        .++.    .|.+.+.    +|..+. ....+..+++.   ..+.++
T Consensus       599 ~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~----ip~~l~-~l~~L~~L~Ls~N~l~g~ip  673 (768)
T 3rgz_A          599 IRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGY----IPKEIG-SMPYLFILNLGHNDISGSIP  673 (768)
T ss_dssp             CCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSC----CCGGGG-GCTTCCEEECCSSCCCSCCC
T ss_pred             ccchhhhccccccccccccceecccCchhhhccccccEEECcCCccccc----CCHHHh-ccccCCEEeCcCCccCCCCC
Confidence                                              1111    2333332    222211 11112222221   334566


Q ss_pred             hHHHHHhhHhhhhhcCCcccccccHhhhccCCCCEEEccCCCCC
Q 043038          228 EYNEILNLVMVTIVSRNDLLKNVPLEVRNLKATQSLNFSHNTFT  271 (271)
Q Consensus       228 ~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~i~  271 (271)
                      ..++.+++|+.|||++|++.+.+|..+..++.|++|++++|+++
T Consensus       674 ~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~  717 (768)
T 3rgz_A          674 DEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLS  717 (768)
T ss_dssp             GGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEE
T ss_pred             hHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCccc
Confidence            66678899999999999999899999999999999999999763



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 271
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 2e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 52.3 bits (124), Expect = 2e-08
 Identities = 34/153 (22%), Positives = 52/153 (33%), Gaps = 23/153 (15%)

Query: 1   MPNLTKFTQLLFRSLDSNNMSGLLPLIS-SNLVYLGLSDNSFLGSISHFLCDKINETKR- 58
           +  L   T L    L +N +S L PL   + L  L L  N             +   +  
Sbjct: 234 IGTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELN 293

Query: 59  ---------------LEALKLNDNYLQGELPDCWMSDQNLKILKLSNNKFIGNLPNSFGS 103
                          L  L L  N +    P   ++   L+ L  +NNK      +S  +
Sbjct: 294 ENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLT--KLQRLFFANNKVSD--VSSLAN 349

Query: 104 LAFLVWLDLGKNRLFGTIPATLKNCTALESLDV 136
           L  + WL  G N++    P  L N T +  L +
Sbjct: 350 LTNINWLSAGHNQISDLTP--LANLTRITQLGL 380


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query271
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.92
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.88
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.88
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.82
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.82
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.81
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.81
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.7
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.64
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.63
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.57
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.56
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.53
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.51
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.5
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.47
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.46
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.43
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.38
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.33
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.21
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.19
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.19
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.3
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.03
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.02
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.92
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.41
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.4
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.92  E-value=2.8e-25  Score=183.59  Aligned_cols=230  Identities=22%  Similarity=0.294  Sum_probs=177.6

Q ss_pred             CcccEEECcCCCCCCC--cccc---CCCccEEEccC-CccccccchhhhhhccCCCcccEEEccCcccCCCCCccccCCC
Q 043038            8 TQLLFRSLDSNNMSGL--LPLI---SSNLVYLGLSD-NSFLGSISHFLCDKINETKRLEALKLNDNYLQGELPDCWMSDQ   81 (271)
Q Consensus         8 ~~L~~L~l~~n~~~~~--~~~~---~~~L~~L~l~~-n~~~~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~   81 (271)
                      .+++.|+++++.+.+.  +|..   +++|++|++++ |.+++.+|..+..    +++|++|++++|++.+..+..+..+.
T Consensus        50 ~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~----L~~L~~L~Ls~N~l~~~~~~~~~~~~  125 (313)
T d1ogqa_          50 YRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAK----LTQLHYLYITHTNVSGAIPDFLSQIK  125 (313)
T ss_dssp             CCEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGG----CTTCSEEEEEEECCEEECCGGGGGCT
T ss_pred             EEEEEEECCCCCCCCCCCCChHHhcCcccccccccccccccccccccccc----ccccchhhhccccccccccccccchh
Confidence            3688899999988874  5555   57999999986 7888778776665    89999999999999877788888899


Q ss_pred             CCCEEEccCCcccccCCcccccCCCccEEEccCCccccccCccccCCCCc-cEEecCC------------CCcccEEEec
Q 043038           82 NLKILKLSNNKFIGNLPNSFGSLAFLVWLDLGKNRLFGTIPATLKNCTAL-ESLDVER------------FSRMVVLNLR  148 (271)
Q Consensus        82 ~L~~L~l~~n~~~~~~~~~~~~l~~L~~l~l~~n~l~~~~~~~~~~l~~L-~~L~l~~------------~~~L~~L~l~  148 (271)
                      .|+.+++++|.+...+|..+..++.++.+++++|.+.+.+|..+..+..+ +.+++..            ......++++
T Consensus       126 ~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~  205 (313)
T d1ogqa_         126 TLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLS  205 (313)
T ss_dssp             TCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECC
T ss_pred             hhcccccccccccccCchhhccCcccceeecccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            99999999999887888889999999999999999988888888877765 5555411            1134567777


Q ss_pred             cCccCCCCchhhhcCccccEEeccCCccceecCcccccccCCcc----ccccccccccccccccchhhhhhhhceecccc
Q 043038          149 SNKFHGPLPTRFCDLAILQILDIADNNLSGAIPNYINNVTGMVT----TNSFSRSAQQHLHVPLDVDVILMEKASVVSRE  224 (271)
Q Consensus       149 ~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~----~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  224 (271)
                      .+...+..|..+..++.++.+++++|.+.+.++ .+..++.++.    .|.+.+.                         
T Consensus       206 ~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~-------------------------  259 (313)
T d1ogqa_         206 RNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGT-------------------------  259 (313)
T ss_dssp             SSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEEC-------------------------
T ss_pred             ccccccccccccccccccccccccccccccccc-ccccccccccccCccCeeccc-------------------------
Confidence            887777778888888888888888888875443 4555555544    4444432                         


Q ss_pred             chhhHHHHHhhHhhhhhcCCcccccccHhhhccCCCCEEEccCCC
Q 043038          225 EVVEYNEILNLVMVTIVSRNDLLKNVPLEVRNLKATQSLNFSHNT  269 (271)
Q Consensus       225 ~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~  269 (271)
                       +|..++.+++|++|+|++|++.|.+|. +..+++|+.+++++|+
T Consensus       260 -iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         260 -LPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNK  302 (313)
T ss_dssp             -CCGGGGGCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSS
T ss_pred             -CChHHhCCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCc
Confidence             223334678888999999999888884 5788889999998886



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure