Citrus Sinensis ID: 043038
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 271 | ||||||
| 255543977 | 1075 | serine/threonine-protein kinase bri1, pu | 0.940 | 0.237 | 0.422 | 2e-48 | |
| 224072885 | 1024 | predicted protein [Populus trichocarpa] | 0.922 | 0.244 | 0.441 | 1e-47 | |
| 255543959 | 602 | serine-threonine protein kinase, plant-t | 0.922 | 0.415 | 0.437 | 3e-47 | |
| 255547794 | 909 | serine-threonine protein kinase, plant-t | 0.966 | 0.288 | 0.405 | 3e-47 | |
| 209970607 | 1045 | M18S-3Ap [Malus floribunda] | 0.937 | 0.243 | 0.401 | 2e-45 | |
| 350284751 | 980 | receptor-like protein [Malus baccata] | 0.929 | 0.257 | 0.404 | 2e-44 | |
| 14330716 | 980 | HcrVf2 protein [Malus floribunda] gi|350 | 0.929 | 0.257 | 0.404 | 2e-44 | |
| 350284749 | 980 | receptor-like protein [Malus baccata] | 0.929 | 0.257 | 0.404 | 2e-44 | |
| 209970625 | 974 | HB09p [Malus floribunda] | 0.904 | 0.251 | 0.405 | 4e-44 | |
| 209970618 | 967 | M18-S3Bp [Malus floribunda] | 0.929 | 0.260 | 0.402 | 4e-44 |
| >gi|255543977|ref|XP_002513051.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] gi|223548062|gb|EEF49554.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 198 bits (503), Expect = 2e-48, Method: Compositional matrix adjust.
Identities = 115/272 (42%), Positives = 156/272 (57%), Gaps = 17/272 (6%)
Query: 15 LDSNNMSGLLPLISSNLVYLGLSDNSFLGSISHFLCDKINETKRLEALKLNDNYLQGELP 74
+ SNN G +P SSNL L LS NSF GSI +FLC K+ E K++E L L N L GE+P
Sbjct: 653 MSSNNFRGPVPYFSSNLSALDLSSNSFTGSIINFLCYKMQEVKKMEVLNLGGNLLSGEIP 712
Query: 75 DCWMSDQNLKILKLSNNKFIGNLPNSFGSLAFLVWLDLGKNRLFGTIPATLKNCTALESL 134
DCW+S Q+L + LSNNKF GN+P S G+L+FL + N L G IP +++NC L +L
Sbjct: 713 DCWLSWQSLTAINLSNNKFTGNIPKSIGTLSFLESVHFANNDLSGDIPLSIQNCRKLFTL 772
Query: 135 DV--------------ERFSRMVVLNLRSNKFHGPLPTRFCDLAILQILDIADNNLSGAI 180
D + M++L LR NK HG +P C +A LQILD+ADNN S I
Sbjct: 773 DFSGNKLVGKIPSWIGKSIPDMIILILRGNKLHGQIPEEICRMASLQILDLADNNFSSMI 832
Query: 181 PNYINNVTGMVTTN-SFSRSAQQHLHVPLDVDVILMEKASVVSREEVVEYNEILNLVMVT 239
P+ +N +GMV N SF +V IL++ A +V + V EY+ IL V
Sbjct: 833 PSCFSNFSGMVKVNDSFGSLTFDQSNV--GPSPILIDSAILVIKGRVAEYSTILGFVKAI 890
Query: 240 IVSRNDLLKNVPLEVRNLKATQSLNFSHNTFT 271
+S N+L +P+ + +L QSL+FS N+ T
Sbjct: 891 DLSNNNLSGEIPMNITSLVGLQSLSFSQNSLT 922
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224072885|ref|XP_002303927.1| predicted protein [Populus trichocarpa] gi|222841359|gb|EEE78906.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255543959|ref|XP_002513042.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223548053|gb|EEF49545.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255547794|ref|XP_002514954.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223546005|gb|EEF47508.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|209970607|gb|ACJ03066.1| M18S-3Ap [Malus floribunda] | Back alignment and taxonomy information |
|---|
| >gi|350284751|gb|AEQ27747.1| receptor-like protein [Malus baccata] | Back alignment and taxonomy information |
|---|
| >gi|14330716|emb|CAC40826.1| HcrVf2 protein [Malus floribunda] gi|350284757|gb|AEQ27750.1| receptor-like protein [Malus micromalus] | Back alignment and taxonomy information |
|---|
| >gi|350284749|gb|AEQ27746.1| receptor-like protein [Malus baccata] | Back alignment and taxonomy information |
|---|
| >gi|209970625|gb|ACJ03073.1| HB09p [Malus floribunda] | Back alignment and taxonomy information |
|---|
| >gi|209970618|gb|ACJ03070.1| M18-S3Bp [Malus floribunda] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 271 | ||||||
| TAIR|locus:2173777 | 792 | RLP54 "receptor like protein 5 | 0.608 | 0.208 | 0.349 | 7.9e-23 | |
| TAIR|locus:2085537 | 894 | RLP34 "AT3G11010" [Arabidopsis | 0.583 | 0.176 | 0.337 | 2.6e-22 | |
| TAIR|locus:2044767 | 905 | AT2G34930 "AT2G34930" [Arabido | 0.848 | 0.254 | 0.315 | 4.8e-22 | |
| TAIR|locus:2144392 | 957 | RLP53 "receptor like protein 5 | 0.583 | 0.165 | 0.36 | 1.3e-21 | |
| TAIR|locus:2825384 | 847 | RLP12 "AT1G71400" [Arabidopsis | 0.852 | 0.272 | 0.325 | 1.9e-21 | |
| TAIR|locus:2160791 | 1102 | AT5G63930 [Arabidopsis thalian | 0.915 | 0.225 | 0.284 | 2.8e-21 | |
| TAIR|locus:2094603 | 835 | RLP37 "receptor like protein 3 | 0.693 | 0.225 | 0.311 | 3.7e-21 | |
| TAIR|locus:2037313 | 1000 | RLP13 "AT1G74170" [Arabidopsis | 0.667 | 0.181 | 0.331 | 4e-21 | |
| TAIR|locus:2156349 | 1252 | GSO2 "GASSHO 2" [Arabidopsis t | 0.952 | 0.206 | 0.298 | 4.4e-21 | |
| TAIR|locus:2046525 | 1124 | AT2G33170 [Arabidopsis thalian | 0.937 | 0.225 | 0.303 | 4.8e-21 |
| TAIR|locus:2173777 RLP54 "receptor like protein 54" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 242 (90.2 bits), Expect = 7.9e-23, Sum P(2) = 7.9e-23
Identities = 66/189 (34%), Positives = 99/189 (52%)
Query: 15 LDSNNMSGLLPLISSNLVYLGLSDNSFLGSISHFLCDKINETKRLEALKLNDNYLQGELP 74
L SN G P+I + + S+N F G I C + RL L L++N G +P
Sbjct: 382 LSSNAFKGSFPIIPPYVNIMAASNNYFTGGIPLIFCKRY----RLSLLDLSNNNFSGTIP 437
Query: 75 DCWMS-DQNLKILKLSNNKFIGNLPNSFGSLAFLVWLDLGKNRLFGTIPATLKNCTALES 133
C + L+ LKLSNN G LP+ L V LD+G N++ G +P +L NCT L+
Sbjct: 438 RCLTNVSLGLEALKLSNNSLTGRLPDIEDRL---VLLDVGHNQISGKLPRSLVNCTTLKF 494
Query: 134 LDVE-------------RFSRMVVLNLRSNKFHGPLPTRFCDLAI--LQILDIADNNLSG 178
L+VE +R+ ++ LRSN+FHGP+ + L+ L+I+DI+ N+ +G
Sbjct: 495 LNVEGNHINDTFPFWLKALTRLEIIVLRSNRFHGPISSPEVSLSFTALRIIDISRNSFNG 554
Query: 179 AIP-NYINN 186
++P NY N
Sbjct: 555 SLPQNYFAN 563
|
|
| TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2160791 AT5G63930 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2094603 RLP37 "receptor like protein 37" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2046525 AT2G33170 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00031679 | hypothetical protein (1024 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 271 | |||
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 1e-24 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 3e-18 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 5e-17 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 3e-16 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 3e-16 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 6e-16 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 5e-12 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 1e-09 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 8e-05 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 9e-04 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 0.001 |
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
Score = 102 bits (256), Expect = 1e-24
Identities = 69/194 (35%), Positives = 96/194 (49%), Gaps = 23/194 (11%)
Query: 15 LDSNNMSGLLP--LISSNLVY-LGLSDNSFLGSISHFLCDKINETKRLEALKLNDNYLQG 71
L N+ SG LP LVY L +S+N+ G I+ + + L+ L L N G
Sbjct: 411 LQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRIN----SRKWDMPSLQMLSLARNKFFG 466
Query: 72 ELPDCWMSDQNLKILKLSNNKFIGNLPNSFGSLAFLVWLDLGKNRLFGTIPATLKNCTAL 131
LPD + S L+ L LS N+F G +P GSL+ L+ L L +N+L G IP L +C L
Sbjct: 467 GLPDSFGSK-RLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKL 525
Query: 132 ESLDVERFSRMVVLNLRSNKFHGPLPTRFCDLAILQILDIADNNLSGAIPNYINNVTGMV 191
SLD L N+ G +P F ++ +L LD++ N LSG IP + NV +V
Sbjct: 526 VSLD-----------LSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLV 574
Query: 192 TTNSFSRSAQQHLH 205
N + HLH
Sbjct: 575 QVN----ISHNHLH 584
|
Length = 968 |
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 271 | |||
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.95 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.94 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.9 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.87 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.86 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.84 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.83 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.76 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.74 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.72 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.71 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.71 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.7 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.69 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.64 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.63 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.62 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.61 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.6 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.6 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.6 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.44 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 99.35 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.34 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 99.14 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 99.12 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 99.09 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 99.05 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 99.04 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 99.02 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.99 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.98 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.91 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.9 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.89 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.89 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.79 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.78 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.67 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.62 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.52 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.48 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.41 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.31 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.27 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 98.21 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.21 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.12 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.08 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 98.0 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.98 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.95 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.9 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.86 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.64 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.51 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.43 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.26 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.14 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.11 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.5 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.37 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 96.32 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.17 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.07 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 95.86 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 95.25 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 95.16 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 95.02 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 94.4 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 93.96 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 93.9 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 91.45 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 90.29 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 89.75 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 89.17 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 89.08 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 89.08 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 88.72 | |
| smart00365 | 26 | LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | 88.57 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 84.82 |
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
Probab=99.95 E-value=3.4e-27 Score=225.66 Aligned_cols=184 Identities=35% Similarity=0.540 Sum_probs=117.0
Q ss_pred CccCCCcccEEECcCCCCCCCcccc----CCCccEEEccCCccccccchhhhhhccCCCcccEEEccCcccCCCCCcccc
Q 043038 3 NLTKFTQLLFRSLDSNNMSGLLPLI----SSNLVYLGLSDNSFLGSISHFLCDKINETKRLEALKLNDNYLQGELPDCWM 78 (271)
Q Consensus 3 ~~~~~~~L~~L~l~~n~~~~~~~~~----~~~L~~L~l~~n~~~~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~ 78 (271)
++.++++|+.|++++|.+.+.+|.. +.+|++|++++|.+++.+|.. .++.|++|++++|.+++..|..+.
T Consensus 88 ~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~------~l~~L~~L~Ls~n~~~~~~p~~~~ 161 (968)
T PLN00113 88 AIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRG------SIPNLETLDLSNNMLSGEIPNDIG 161 (968)
T ss_pred HHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCcc------ccCCCCEEECcCCcccccCChHHh
Confidence 3667788888888888887766653 457778888877776655531 255666666666666655666666
Q ss_pred CCCCCCEEEccCCcccccCCcccccCCCccEEEccCCccccccCccccCCCCccEEec-------------CCCCcccEE
Q 043038 79 SDQNLKILKLSNNKFIGNLPNSFGSLAFLVWLDLGKNRLFGTIPATLKNCTALESLDV-------------ERFSRMVVL 145 (271)
Q Consensus 79 ~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~l~l~~n~l~~~~~~~~~~l~~L~~L~l-------------~~~~~L~~L 145 (271)
.+++|++|++++|.+.+..|..+..+++|+.|++++|.+.+..|..++.+++|+.|++ ..+++|++|
T Consensus 162 ~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L 241 (968)
T PLN00113 162 SFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHL 241 (968)
T ss_pred cCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEE
Confidence 6666666666666665556666666666666666666665556666666666666655 334456666
Q ss_pred EeccCccCCCCchhhhcCccccEEeccCCccceecCcccccccCCcc
Q 043038 146 NLRSNKFHGPLPTRFCDLAILQILDIADNNLSGAIPNYINNVTGMVT 192 (271)
Q Consensus 146 ~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~ 192 (271)
++++|.+++..|..+..+++|+.|++++|.+.+.+|..+.++++|+.
T Consensus 242 ~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~ 288 (968)
T PLN00113 242 DLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLIS 288 (968)
T ss_pred ECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCE
Confidence 66666666556666666666666666666665555555555555544
|
|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 271 | ||||
| 3riz_A | 772 | Crystal Structure Of The Plant Steroid Receptor Bri | 1e-11 | ||
| 3riz_A | 772 | Crystal Structure Of The Plant Steroid Receptor Bri | 5e-08 | ||
| 3rgx_A | 768 | Structural Insight Into Brassinosteroid Perception | 2e-11 | ||
| 3rgx_A | 768 | Structural Insight Into Brassinosteroid Perception | 5e-08 | ||
| 1ogq_A | 313 | The Crystal Structure Of Pgip (Polygalacturonase In | 2e-10 |
| >pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 | Back alignment and structure |
|
| >pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 | Back alignment and structure |
| >pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 | Back alignment and structure |
| >pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 | Back alignment and structure |
| >pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 271 | |||
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-47 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-31 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 5e-31 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 5e-30 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-28 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 5e-27 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 5e-24 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 9e-24 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-23 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 7e-15 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 6e-13 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 8e-31 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 4e-28 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 1e-27 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 1e-25 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 2e-16 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 4e-20 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 4e-18 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 3e-16 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 5e-16 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-15 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 1e-14 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 5e-06 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 7e-19 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 5e-18 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 8e-18 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 7e-17 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-15 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-15 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 3e-14 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 4e-12 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 4e-04 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 4e-17 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 5e-17 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 7e-17 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 3e-16 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 8e-16 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-15 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-14 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 3e-13 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 3e-11 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-10 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-06 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-15 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 4e-15 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 7e-14 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-12 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 5e-12 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-11 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 5e-11 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-09 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-08 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 4e-15 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 7e-13 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 4e-12 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 3e-10 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 2e-14 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 6e-05 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 3e-14 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-13 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-12 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-11 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 8e-11 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-05 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-13 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-13 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-13 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 7e-13 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-12 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-12 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-09 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 8e-04 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 5e-12 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 3e-06 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 3e-04 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 2e-10 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 3e-09 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 9e-09 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 6e-06 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 1e-05 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 2e-10 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-10 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 5e-08 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-07 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 3e-10 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 5e-08 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 2e-07 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 5e-06 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 3e-10 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 6e-10 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 5e-06 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 5e-10 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-09 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 6e-09 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-08 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-07 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-04 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-04 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 6e-10 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 4e-05 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-09 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-09 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-08 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 3e-08 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-04 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 1e-09 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 7e-07 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 4e-05 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 1e-09 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 2e-07 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-09 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 1e-08 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-08 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-06 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-05 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-04 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 5e-04 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-09 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-08 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 8e-08 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-07 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-04 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 2e-09 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 1e-06 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 4e-06 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 3e-09 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 8e-08 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-07 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 3e-07 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 4e-07 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 4e-07 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 3e-09 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 3e-08 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 4e-07 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 7e-07 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 8e-06 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 7e-09 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 4e-07 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 1e-05 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 1e-05 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 3e-08 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 8e-08 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 5e-08 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 1e-06 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 4e-05 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 7e-08 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 3e-07 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 9e-07 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 4e-07 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 1e-06 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 4e-04 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 2e-06 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 7e-06 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 1e-05 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 8e-05 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 2e-06 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 2e-06 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 2e-06 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 1e-05 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-06 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 2e-06 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 3e-05 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 3e-06 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 3e-05 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 3e-06 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 3e-05 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 4e-05 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 5e-05 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 9e-05 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 5e-06 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 3e-05 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 2e-05 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 9e-04 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 2e-05 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 4e-05 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 7e-05 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 4e-05 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 8e-05 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 2e-04 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 2e-04 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 4e-04 |
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
Score = 167 bits (426), Expect = 1e-47
Identities = 66/276 (23%), Positives = 101/276 (36%), Gaps = 22/276 (7%)
Query: 14 SLDSNNMSGLLP-----LISSNLVYLGLSDNSFLGSISHFLCDKINETKRLEALKLNDNY 68
L SNN SG + + L L L +N F G I L + L +L L+ NY
Sbjct: 374 DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN----CSELVSLHLSFNY 429
Query: 69 LQGELPDCWMSDQNLKILKLSNNKFIGNLPNSFGSLAFLVWLDLGKNRLFGTIPATLKNC 128
L G +P S L+ LKL N G +P + L L L N L G IP+ L NC
Sbjct: 430 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNC 489
Query: 129 TALESLDVE-------------RFSRMVVLNLRSNKFHGPLPTRFCDLAILQILDIADNN 175
T L + + R + +L L +N F G +P D L LD+ N
Sbjct: 490 TNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNL 549
Query: 176 LSGAIPNYINNVTGMVTTNSFSRSAQQHLHVPLDVDVILMEKASVVSREEVVEYNEILNL 235
+G IP + +G + N + ++ + + E L+
Sbjct: 550 FNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLST 609
Query: 236 VMVTIVSRNDLLKNVPLEVRNLKATQSLNFSHNTFT 271
++ + N + L+ S+N +
Sbjct: 610 RNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLS 645
|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 271 | |||
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.97 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.97 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.96 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.96 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.96 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.95 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.95 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.95 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.94 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.94 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.94 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.94 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.94 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.94 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.94 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.94 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.94 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.94 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.93 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.93 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.93 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.93 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.93 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.93 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.93 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.93 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.93 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.93 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.93 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.93 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.92 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.92 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.92 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.92 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.92 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.92 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.92 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.92 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.92 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.92 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.92 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.92 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.92 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.91 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.91 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.91 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.91 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.91 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.9 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.9 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.9 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.9 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.9 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.9 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.89 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.89 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.89 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.89 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.89 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.89 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.89 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.88 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.88 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.88 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.87 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.87 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.86 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.86 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.86 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.86 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.86 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.86 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.86 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.86 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.86 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.86 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.85 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.85 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.85 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.85 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.84 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.83 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.83 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.82 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.82 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.81 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.81 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.8 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.8 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.8 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.79 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.79 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.79 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.78 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.77 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.77 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.77 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.77 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.76 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.75 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.75 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.75 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.75 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.75 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.74 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.74 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.74 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.73 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.73 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.7 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.68 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.68 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.68 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.67 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.67 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.67 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.66 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.64 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.62 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.62 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.61 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.61 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.61 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.6 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.6 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 99.59 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.59 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.58 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.57 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.56 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.55 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.54 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.53 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.48 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.45 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.45 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.41 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.39 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.36 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 99.32 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.3 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.27 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 99.25 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 99.22 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 99.15 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 99.09 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.88 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.87 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.73 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 98.69 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.55 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 98.53 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.41 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 98.35 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.24 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.2 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.16 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 98.08 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 97.76 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 97.67 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 97.63 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 97.58 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.85 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.66 |
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
Probab=99.97 E-value=5.2e-30 Score=238.23 Aligned_cols=259 Identities=28% Similarity=0.373 Sum_probs=174.4
Q ss_pred ccCCC-cccEEECcCCCCCCCcccc-----CCCccEEEccCCccccccchhhhhhccCCCcccEEEccCcccCCCCCccc
Q 043038 4 LTKFT-QLLFRSLDSNNMSGLLPLI-----SSNLVYLGLSDNSFLGSISHFLCDKINETKRLEALKLNDNYLQGELPDCW 77 (271)
Q Consensus 4 ~~~~~-~L~~L~l~~n~~~~~~~~~-----~~~L~~L~l~~n~~~~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~ 77 (271)
+.+++ +|+.|++++|.+.+..|.. +++|++|++++|.+++.+|..+.. +++|++|++++|.+++..|..|
T Consensus 363 l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~----l~~L~~L~Ls~N~l~~~~p~~l 438 (768)
T 3rgz_A 363 LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN----CSELVSLHLSFNYLSGTIPSSL 438 (768)
T ss_dssp HHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGG----CTTCCEEECCSSEEESCCCGGG
T ss_pred HHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhc----CCCCCEEECcCCcccCcccHHH
Confidence 34454 6777777777776655544 245777777777777666655544 7777777777777776677777
Q ss_pred cCCCCCCEEEccCCcccccCCcccccCCCccEEEccCCccccccCccccCCCCccEEec-------------CCCCcccE
Q 043038 78 MSDQNLKILKLSNNKFIGNLPNSFGSLAFLVWLDLGKNRLFGTIPATLKNCTALESLDV-------------ERFSRMVV 144 (271)
Q Consensus 78 ~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~l~l~~n~l~~~~~~~~~~l~~L~~L~l-------------~~~~~L~~ 144 (271)
..+++|+.|++++|.+++..|..+..+++|+.+++++|.+.+..|..+..+++|+.|++ ..+++|+.
T Consensus 439 ~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~ 518 (768)
T 3rgz_A 439 GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAI 518 (768)
T ss_dssp GGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCE
T ss_pred hcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCE
Confidence 77777777777777777667777777777777777777777667777777777777766 33456777
Q ss_pred EEeccCccCCCCchhhhcCccccEEeccCCccceecCccccccc------------------------------------
Q 043038 145 LNLRSNKFHGPLPTRFCDLAILQILDIADNNLSGAIPNYINNVT------------------------------------ 188 (271)
Q Consensus 145 L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~------------------------------------ 188 (271)
|++++|.+++.+|..+..+++|+.|++++|.++|.+|..+....
T Consensus 519 L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 598 (768)
T 3rgz_A 519 LKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQG 598 (768)
T ss_dssp EECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTT
T ss_pred EECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcccccccccccccccccccccccccccccc
Confidence 77777777777777777777777777777777766665543321
Q ss_pred ----------------------------------CCcc----ccccccccccccccccchhhhhhhhceec---cccchh
Q 043038 189 ----------------------------------GMVT----TNSFSRSAQQHLHVPLDVDVILMEKASVV---SREEVV 227 (271)
Q Consensus 189 ----------------------------------~L~~----~n~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~ 227 (271)
.++. .|.+.+. +|..+. ....+..+++. ..+.++
T Consensus 599 ~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~----ip~~l~-~l~~L~~L~Ls~N~l~g~ip 673 (768)
T 3rgz_A 599 IRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGY----IPKEIG-SMPYLFILNLGHNDISGSIP 673 (768)
T ss_dssp CCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSC----CCGGGG-GCTTCCEEECCSSCCCSCCC
T ss_pred ccchhhhccccccccccccceecccCchhhhccccccEEECcCCccccc----CCHHHh-ccccCCEEeCcCCccCCCCC
Confidence 1111 2333332 222211 11112222221 334566
Q ss_pred hHHHHHhhHhhhhhcCCcccccccHhhhccCCCCEEEccCCCCC
Q 043038 228 EYNEILNLVMVTIVSRNDLLKNVPLEVRNLKATQSLNFSHNTFT 271 (271)
Q Consensus 228 ~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~i~ 271 (271)
..++.+++|+.|||++|++.+.+|..+..++.|++|++++|+++
T Consensus 674 ~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~ 717 (768)
T 3rgz_A 674 DEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLS 717 (768)
T ss_dssp GGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEE
T ss_pred hHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCccc
Confidence 66678899999999999999899999999999999999999763
|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 271 | ||||
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 2e-08 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 1e-07 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 8e-08 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 1e-06 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 2e-06 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 3e-05 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 2e-04 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 9e-07 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 3e-05 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 2e-04 | |
| d1w8aa_ | 192 | c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga | 2e-06 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 4e-06 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 7e-04 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 5e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 0.002 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.003 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 0.004 |
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Internalin LRR domain domain: Internalin A species: Listeria monocytogenes [TaxId: 1639]
Score = 52.3 bits (124), Expect = 2e-08
Identities = 34/153 (22%), Positives = 52/153 (33%), Gaps = 23/153 (15%)
Query: 1 MPNLTKFTQLLFRSLDSNNMSGLLPLIS-SNLVYLGLSDNSFLGSISHFLCDKINETKR- 58
+ L T L L +N +S L PL + L L L N + +
Sbjct: 234 IGTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELN 293
Query: 59 ---------------LEALKLNDNYLQGELPDCWMSDQNLKILKLSNNKFIGNLPNSFGS 103
L L L N + P ++ L+ L +NNK +S +
Sbjct: 294 ENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLT--KLQRLFFANNKVSD--VSSLAN 349
Query: 104 LAFLVWLDLGKNRLFGTIPATLKNCTALESLDV 136
L + WL G N++ P L N T + L +
Sbjct: 350 LTNINWLSAGHNQISDLTP--LANLTRITQLGL 380
|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 271 | |||
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.92 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.92 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.89 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.88 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.88 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.82 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.82 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.81 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.81 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.78 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.72 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.7 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.69 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.69 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.68 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.65 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.65 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.64 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.63 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.62 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.57 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.56 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.53 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.51 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.5 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.49 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.48 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.47 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.46 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.43 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.38 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.33 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.25 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.21 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.19 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.19 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.3 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.03 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.02 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.92 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 97.41 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 97.4 |
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Polygalacturonase inhibiting protein PGIP domain: Polygalacturonase inhibiting protein PGIP species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.92 E-value=2.8e-25 Score=183.59 Aligned_cols=230 Identities=22% Similarity=0.294 Sum_probs=177.6
Q ss_pred CcccEEECcCCCCCCC--cccc---CCCccEEEccC-CccccccchhhhhhccCCCcccEEEccCcccCCCCCccccCCC
Q 043038 8 TQLLFRSLDSNNMSGL--LPLI---SSNLVYLGLSD-NSFLGSISHFLCDKINETKRLEALKLNDNYLQGELPDCWMSDQ 81 (271)
Q Consensus 8 ~~L~~L~l~~n~~~~~--~~~~---~~~L~~L~l~~-n~~~~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~ 81 (271)
.+++.|+++++.+.+. +|.. +++|++|++++ |.+++.+|..+.. +++|++|++++|++.+..+..+..+.
T Consensus 50 ~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~----L~~L~~L~Ls~N~l~~~~~~~~~~~~ 125 (313)
T d1ogqa_ 50 YRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAK----LTQLHYLYITHTNVSGAIPDFLSQIK 125 (313)
T ss_dssp CCEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGG----CTTCSEEEEEEECCEEECCGGGGGCT
T ss_pred EEEEEEECCCCCCCCCCCCChHHhcCcccccccccccccccccccccccc----ccccchhhhccccccccccccccchh
Confidence 3688899999988874 5555 57999999986 7888778776665 89999999999999877788888899
Q ss_pred CCCEEEccCCcccccCCcccccCCCccEEEccCCccccccCccccCCCCc-cEEecCC------------CCcccEEEec
Q 043038 82 NLKILKLSNNKFIGNLPNSFGSLAFLVWLDLGKNRLFGTIPATLKNCTAL-ESLDVER------------FSRMVVLNLR 148 (271)
Q Consensus 82 ~L~~L~l~~n~~~~~~~~~~~~l~~L~~l~l~~n~l~~~~~~~~~~l~~L-~~L~l~~------------~~~L~~L~l~ 148 (271)
.|+.+++++|.+...+|..+..++.++.+++++|.+.+.+|..+..+..+ +.+++.. ......++++
T Consensus 126 ~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~ 205 (313)
T d1ogqa_ 126 TLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLS 205 (313)
T ss_dssp TCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECC
T ss_pred hhcccccccccccccCchhhccCcccceeecccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence 99999999999887888889999999999999999988888888877765 5555411 1134567777
Q ss_pred cCccCCCCchhhhcCccccEEeccCCccceecCcccccccCCcc----ccccccccccccccccchhhhhhhhceecccc
Q 043038 149 SNKFHGPLPTRFCDLAILQILDIADNNLSGAIPNYINNVTGMVT----TNSFSRSAQQHLHVPLDVDVILMEKASVVSRE 224 (271)
Q Consensus 149 ~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~----~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 224 (271)
.+...+..|..+..++.++.+++++|.+.+.++ .+..++.++. .|.+.+.
T Consensus 206 ~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~------------------------- 259 (313)
T d1ogqa_ 206 RNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGT------------------------- 259 (313)
T ss_dssp SSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEEC-------------------------
T ss_pred ccccccccccccccccccccccccccccccccc-ccccccccccccCccCeeccc-------------------------
Confidence 887777778888888888888888888875443 4555555544 4444432
Q ss_pred chhhHHHHHhhHhhhhhcCCcccccccHhhhccCCCCEEEccCCC
Q 043038 225 EVVEYNEILNLVMVTIVSRNDLLKNVPLEVRNLKATQSLNFSHNT 269 (271)
Q Consensus 225 ~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~ 269 (271)
+|..++.+++|++|+|++|++.|.+|. +..+++|+.+++++|+
T Consensus 260 -iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~ 302 (313)
T d1ogqa_ 260 -LPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNK 302 (313)
T ss_dssp -CCGGGGGCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSS
T ss_pred -CChHHhCCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCc
Confidence 223334678888999999999888884 5788889999998886
|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|