Citrus Sinensis ID: 043041

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-----
MYLDLSNNLLSGRLPDCWPLFDRLRILDLANNNFSGKIPDSMGSLPNIQILSLHNNSLTGELPSSLQNCSLLILMDLGRNALSGEIPKWIGESLPKLIVLSLMSNKFHGIIPFQLCYLPFIQILDLSSNNIPGIIPKCFNNFTAMAQEKSSVLSVTSEYWFAGGLQLTTAGDFFSGQAVLTWKGSQYQYQNTLGLVKMLDLSSNKLGGEVPEEIMDLVGLIAMNLSRNNLTGQITPKIGQLKSLDFLDLSRNRFFGGIPSSLSLLSGLSVMDLSYNNLSGKIPSGTQLQSFNASTYAGNELCGLPLPNKCPDGDLPPRPGKDDANTREEEDQFITLGFYVSLILGFFSGFWGFCGTLLVKSSWRHRYYNFLTGIENWFYMTAVVNIAKLQRRFRS
cEEEcccccccccccccccccccccEEEccccccEEcccccccccccccEEEEcccEEcccccHHHHccccccEEEcccccccccccccHHcccccccEEEccccccEEEccccccccccccEEEcccccccccccccccHHHHcccccccccccccccEEcccccccccccEEEEEEEEEEcccEEEEccccccEEEEEcccccccccccHHHHccccccccccccccccccccccHHccccccHHHcccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcEEEEHHHHHHHHHHHHHcc
cEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHHHcccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccHHHHHHHcccccccccccccHccccccEEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHccccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHHccHHHccccccccccccHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MYLDLSNnllsgrlpdcwplfdrLRILDLAnnnfsgkipdsmgslpniqilslhnnsltgelpsslqncSLLILMDLGrnalsgeipkwigesLPKLIVLSLMsnkfhgiipfqlcylpfiqildlssnnipgiipkcfNNFTAMAQEKSSVLSVTSeywfagglqlttagdffsgqavltwkgsqyQYQNTLGLVKMLDlssnklggevpEEIMDLVGLIAMNlsrnnltgqitpkigqlksldfldlsrnrffggipsslsllsglsvmdlsynnlsgkipsgtqlqsfnastyagnelcglplpnkcpdgdlpprpgkddantreeEDQFITLGFYVSLILGFFSGFWGFCGTLLVKSSWRHRYYNFLTGIENWFYMTAVVNIAKLQRRFRS
MYLDLSNNLLSGRLPDCWPLFDRLRILDLANNNFSGKIPDSMGSLPNIQILSLHNNSLTGELPSSLQNCSLLILMDLGRNALSGEIPKWIGESLPKLIVLSLMSNKFHGIIPFQLCYLPFIQILDLSSNNIPGIIPKCFNNFTAMAQEKSSVLSVTSEYWFAGGLQLTTAGDFFSGQAVLTWKGSQYQYQNTLGLVKMLDLSSNKLGGEVPEEIMDLVGLIAMNLSRNNLTGQITPKIGQLKSLDFLDLSRNRFFGGIPSSLSLLSGLSVMDLSYNNLSGKIPSGTQLQSFNASTYAGNELCGLPLPNKCPDGDLPPRPGKDDANTREEEDQFITLGFYVSLILGFFSGFWGFCGTLLVKSSWRHRYYNFLTGIENWFYMTAVVNIAKLQRRFRS
MYLDLSNNLLSGRLPDCWPLFDRLRILDLANNNFSGKIPDSMGSLPNIQILSLHNNSLTGELPSSLQNCSLLILMDLGRNALSGEIPKWIGESLPKLIVLSLMSNKFHGIIPFQLCYLPFIQILDLSSNNIPGIIPKCFNNFTAMAQEKSSVLSVTSEYWFAGGLQLTTAGDFFSGQAVLTWKGSQYQYQNTLGLVKMLDLSSNKLGGEVPEEIMDLVGLIAMNLSRNNLTGQITPKIGQLKSLDFLDLSRNRFFGGIPsslsllsglsvmdlsYNNLSGKIPSGTQLQSFNASTYAGNELCGLPLPNKCPDGDLPPRPGKDDANTREEEDQFITLGFYVSLILGFFSGFWGFCGTLLVKSSWRHRYYNFLTGIENWFYMTAVVNIAKLQRRFRS
*******NLLSGRLPDCWPLFDRLRILDLANNNFSGKIPDSMGSLPNIQILSLHNNSLTGELPSSLQNCSLLILMDLGRNALSGEIPKWIGESLPKLIVLSLMSNKFHGIIPFQLCYLPFIQILDLSSNNIPGIIPKCFNNFTAMAQEKSSVLSVTSEYWFAGGLQLTTAGDFFSGQAVLTWKGSQYQYQNTLGLVKMLDLSSNKLGGEVPEEIMDLVGLIAMNLSRNNLTGQITPKIGQLKSLDFLDLSRNRFFGGIPSSLSLLSGLSVMDLSYNNLSGKIP***QLQSFNASTYAGNELCGLP**************************QFITLGFYVSLILGFFSGFWGFCGTLLVKSSWRHRYYNFLTGIENWFYMTAVVNIAKL******
MYLDLSNNLLSGRLPDCWPLFDRLRILDLANNNFSGKIPDSMGSLPNIQILSLHNNSLTGELPSSLQNCSLLILMDLGRNALSGEIPKWIGESLPKLIVLSLMSNKFHGIIPFQLCYLPFIQILDLSSNNIPGIIPKCFNNFTAMAQEKSSVLSVTSEYWFAGGLQLTTAGDFFSGQAVLTWKGSQYQYQNTLGLVKMLDLSSNKLGGEVPEEIMDLVGLIAMNLSRNNLTGQITPKIGQLKSLDFLDLSRNRFFGGIPSSLSLLSGLSVMDLSYNNLSGKIPSGTQLQSFNASTYAGNELCGLPLP**************************ITLGFYVSLILGFFSGFWGFCGTLLVKSSWRHRYYNFLTGIENWFYMTAVVNIAKLQRRF**
MYLDLSNNLLSGRLPDCWPLFDRLRILDLANNNFSGKIPDSMGSLPNIQILSLHNNSLTGELPSSLQNCSLLILMDLGRNALSGEIPKWIGESLPKLIVLSLMSNKFHGIIPFQLCYLPFIQILDLSSNNIPGIIPKCFNNFTAMAQEKSSVLSVTSEYWFAGGLQLTTAGDFFSGQAVLTWKGSQYQYQNTLGLVKMLDLSSNKLGGEVPEEIMDLVGLIAMNLSRNNLTGQITPKIGQLKSLDFLDLSRNRFFGGIPSSLSLLSGLSVMDLSYNNLSGKIPSGTQLQSFNASTYAGNELCGLPLPNKCPDGDLPPRPGKDDANTREEEDQFITLGFYVSLILGFFSGFWGFCGTLLVKSSWRHRYYNFLTGIENWFYMTAVVNIAKLQRRFRS
MYLDLSNNLLSGRLPDCWPLFDRLRILDLANNNFSGKIPDSMGSLPNIQILSLHNNSLTGELPSSLQNCSLLILMDLGRNALSGEIPKWIGESLPKLIVLSLMSNKFHGIIPFQLCYLPFIQILDLSSNNIPGIIPKCFNNFTAMAQEKSSVLSVTSEYWFAGGLQLTTAGDFFSGQAVLTWKGSQYQYQNTLGLVKMLDLSSNKLGGEVPEEIMDLVGLIAMNLSRNNLTGQITPKIGQLKSLDFLDLSRNRFFGGIPSSLSLLSGLSVMDLSYNNLSGKIPSGTQLQSFNASTYAGNELCGLPLPNKCP*******************DQFITLGFYVSLILGFFSGFWGFCGTLLVKSSWRHRYYNFLTGIENWFYMTAVVNIAKLQRRFR*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYLDLSNNLLSGRLPDCWPLFDRLRILDLANNNFSGKIPDSMGSLPNIQILSLHNNSLTGELPSSLQNCSLLILMDLGRNALSGEIPKWIGESLPKLIVLSLMSNKFHGIIPFQLCYLPFIQILDLSSNNIPGIIPKCFNNFTAMAQEKSSVLSVTSEYWFAGGLQLTTAGDFFSGQAVLTWKGSQYQYQNTLGLVKMLDLSSNKLGGEVPEEIMDLVGLIAMNLSRNNLTGQITPKIGQLKSLDFLDLSRNRFFGGIPSSLSLLSGLSVMDLSYNNLSGKIPSGTQLQSFNASTYAGNELCGLPLPNKCPDGDLPPRPGKDDANTREEEDQFITLGFYVSLILGFFSGFWGFCGTLLVKSSWRHRYYNFLTGIENWFYMTAVVNIAKLQRRFRS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query395 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 no no 0.924 0.430 0.323 3e-40
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.931 0.304 0.335 1e-37
Q8L899 1207 Systemin receptor SR160 O N/A no 0.931 0.304 0.335 2e-37
Q9ZPS9 1143 Serine/threonine-protein no no 0.782 0.270 0.359 8e-37
O22476 1196 Protein BRASSINOSTEROID I no no 0.774 0.255 0.338 3e-36
Q9LJF3 1164 Receptor-like protein kin no no 0.883 0.299 0.330 2e-34
O49545 1003 Leucine-rich repeat recep no no 0.777 0.306 0.328 9e-34
Q9SYQ8 980 Receptor protein kinase C no no 0.774 0.312 0.294 4e-33
Q9ZWC8 1166 Serine/threonine-protein no no 0.888 0.301 0.321 9e-33
Q9M0G7 1013 Leucine-rich repeat recep no no 0.701 0.273 0.343 3e-32
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  166 bits (420), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 126/390 (32%), Positives = 194/390 (49%), Gaps = 25/390 (6%)

Query: 2   YLDLSNNLLSGRLPDCWPLFD-RLRILDLANNNFSGKIPDSMGSLPNIQILSLHNNSLTG 60
           +LDLSNNL SG +P C   F   ++ L+L +NNFSG +PD       +  L + +N L G
Sbjct: 471 FLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNFSGTLPDIFSKATELVSLDVSHNQLEG 530

Query: 61  ELPSSLQNCSLLILMDLGRNALSGEIPKWIGESLPKLIVLSLMSNKFHGIIPFQLCYLPF 120
           + P SL NC  L L+++  N +    P W+ ESLP L VL+L SNKF+G +  +   + F
Sbjct: 531 KFPKSLINCKALELVNVESNKIKDIFPSWL-ESLPSLHVLNLRSNKFYGPLYHRHASIGF 589

Query: 121 --IQILDLSSNNIPGIIPKC-FNNFTAMAQEKSSVLSVTSEYWFAGGLQLTTAGDFFSGQ 177
             ++I+D+S NN  G +P   F+N+  M      +    +E+W           D +  +
Sbjct: 590 QSLRIIDISHNNFSGTLPPYYFSNWKDMTTLTEEMDQYMTEFW--------RYADSYYHE 641

Query: 178 AVLTWKGSQYQYQNTLGLVKMLDLSSNKLGGEVPEEIMDLVGLIAMNLSRNNLTGQITPK 237
             +  KG    ++      + +D S NK+ G +PE +  L  L  +NLS N  T  I   
Sbjct: 642 MEMVNKGVDMSFERIRRDFRAIDFSGNKINGNIPESLGYLKELRVLNLSGNAFTSVIPRF 701

Query: 238 IGQLKSLDFLDLSRNRFFGGIPSSLSLLSGLSVMDLSYNNLSGKIPSGTQLQSFNASTYA 297
           +  L  L+ LD+SRN+  G IP  L+ LS LS M+ S+N L G +P GTQ Q    S++ 
Sbjct: 702 LANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQGPVPRGTQFQRQKCSSFL 761

Query: 298 GNE-LCGLPLPNKCPD-GDLPPRPGKDDANTREEEDQFITLGFYVSLILGFFSGFWGFCG 355
            N  L G  L + C D G L P     +  +  EE+ F     +V+  + +  G    CG
Sbjct: 762 DNPGLYG--LEDICRDTGALNPTSQLPEDLSEAEENMFN----WVAAAIAYGPGV--LCG 813

Query: 356 TLL--VKSSWRHRYYNFLTGIENWFYMTAV 383
            ++    +S  H ++    G +    +T+V
Sbjct: 814 LVIGHFYTSHNHEWFTEKFGRKQHKALTSV 843
Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description
>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 Back     alignment and function description
>sp|O49545|BAME1_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 OS=Arabidopsis thaliana GN=BAM1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SYQ8|CLV1_ARATH Receptor protein kinase CLAVATA1 OS=Arabidopsis thaliana GN=CLV1 PE=1 SV=3 Back     alignment and function description
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9M0G7|PXL2_ARATH Leucine-rich repeat receptor-like protein kinase PXL2 OS=Arabidopsis thaliana GN=PXL2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query395
359490164 1198 PREDICTED: LRR receptor-like serine/thre 0.982 0.323 0.528 1e-109
225464712 1021 PREDICTED: receptor-like protein 12-like 0.951 0.368 0.542 1e-108
302143722 750 unnamed protein product [Vitis vinifera] 0.979 0.516 0.525 1e-106
359490560 1010 PREDICTED: LRR receptor-like serine/thre 0.979 0.383 0.525 1e-106
225466147 1024 PREDICTED: LRR receptor-like serine/thre 0.979 0.377 0.508 1e-106
302143729 641 unnamed protein product [Vitis vinifera] 0.913 0.563 0.557 1e-104
359490572 975 PREDICTED: probable LRR receptor-like se 0.913 0.370 0.557 1e-104
225462661 1485 PREDICTED: LRR receptor-like serine/thre 0.974 0.259 0.529 1e-104
147807651 971 hypothetical protein VITISV_018647 [Viti 0.977 0.397 0.517 1e-104
359490576 972 PREDICTED: LRR receptor-like serine/thre 0.977 0.397 0.520 1e-104
>gi|359490164|ref|XP_002268910.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  402 bits (1034), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 214/405 (52%), Positives = 286/405 (70%), Gaps = 17/405 (4%)

Query: 1    MYLDLSNNLLSGRLPDCWPLFDRLRILDLANNNFSGKIPDSMGSLPNIQILSLHNNSLTG 60
            + LDLSNN L+G LP+CW  ++RL +L+L NN FSG+IP+S GSL +I+ L L NN+LTG
Sbjct: 801  VLLDLSNNSLTGGLPNCWAQWERLVVLNLENNRFSGQIPNSFGSLRSIRTLHLRNNNLTG 860

Query: 61   ELPSSLQNCSLLILMDLGRNALSGEIPKWIGESLPKLIVLSLMSNKFHGIIPFQLCYLPF 120
            ELP S +NC+ L  +DLG+N LSG+IP+WIG SLP LIVL+L SN+F G+I  +LC L  
Sbjct: 861  ELPLSFKNCTKLRFIDLGKNRLSGKIPEWIGGSLPNLIVLNLGSNRFSGVICPELCQLKN 920

Query: 121  IQILDLSSNNIPGIIPKCFNNFTAMAQEKSSVLSVTSEYWFAGGLQLTTAGDF-----FS 175
            IQILDLS+NNI G++P+C   FTAM ++ S V++    Y F    +    G       + 
Sbjct: 921  IQILDLSNNNILGVVPRCVGGFTAMTKKGSLVIAYN--YSFTQNGRCRDDGCMPINASYV 978

Query: 176  GQAVLTWKGSQYQYQNTLGLVKMLDLSSNKLGGEVPEEIMDLVGLIAMNLSRNNLTGQIT 235
             +A++ WK  ++ +++TLGLVK +DLSSNKL GE+PEE++DL+ L+++NLSRNNLT  I 
Sbjct: 979  DRAMVRWKEREFDFKSTLGLVKSIDLSSNKLSGEIPEEVIDLIELVSLNLSRNNLTRLIP 1038

Query: 236  PKIGQLKSLDFLDLSRNRFFGGIPSSLSLLSGLSVMDLSYNNLSGKIPSGTQLQSFNAST 295
             +IGQLKSL+ LDLS+N+ FG IP+SL  +S LSV+DLS NNLSGKIP GTQLQSFN  +
Sbjct: 1039 TRIGQLKSLEVLDLSQNQLFGEIPASLVEISDLSVLDLSDNNLSGKIPQGTQLQSFNIDS 1098

Query: 296  YAGN-ELCGLPLPNKCPDGDLPPRPGKDDANTREEEDQFITLG----FYVSLILGFFSGF 350
            Y GN  LCGLPL  KC +  +     K  + T   ED+    G    FY+S+ LGF  GF
Sbjct: 1099 YKGNPALCGLPLLKKCSEDKI-----KQGSPTYNIEDKIQQDGNDMWFYISVALGFIVGF 1153

Query: 351  WGFCGTLLVKSSWRHRYYNFLTGIENWFYMTAVVNIAKLQRRFRS 395
            WG CGTLL+ +SWR+ Y+ FL  I++W YM   +N+A+LQR F+S
Sbjct: 1154 WGVCGTLLLNNSWRYAYFQFLNKIKDWLYMIIAINMARLQRSFQS 1198

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225464712|ref|XP_002276171.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143722|emb|CBI22583.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490560|ref|XP_002266431.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225466147|ref|XP_002270042.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143729|emb|CBI22590.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490572|ref|XP_003634116.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225462661|ref|XP_002266475.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147807651|emb|CAN64389.1| hypothetical protein VITISV_018647 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490576|ref|XP_003634117.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query395
TAIR|locus:2129246891 RLP50 "receptor like protein 5 0.873 0.387 0.338 1.2e-44
TAIR|locus:2037308976 RLP14 "AT1G74180" [Arabidopsis 0.807 0.326 0.376 1.6e-44
TAIR|locus:2119535725 RLP48 "receptor like protein 4 0.858 0.467 0.336 1.1e-43
TAIR|locus:20373131000 RLP13 "AT1G74170" [Arabidopsis 0.903 0.357 0.332 3.4e-43
TAIR|locus:22050051019 RLP7 "AT1G47890" [Arabidopsis 0.898 0.348 0.343 4.2e-42
TAIR|locus:2046585808 RLP27 "receptor like protein 2 0.845 0.413 0.343 7e-42
TAIR|locus:2119430741 RLP47 "receptor like protein 4 0.893 0.476 0.329 9.9e-42
TAIR|locus:2046357890 RLP23 "receptor like protein 2 0.843 0.374 0.339 9.9e-42
TAIR|locus:2087253884 RLP39 "AT3G24900" [Arabidopsis 0.848 0.378 0.342 2.1e-41
TAIR|locus:2086979890 RLP42 "receptor like protein 4 0.837 0.371 0.346 3.5e-41
TAIR|locus:2129246 RLP50 "receptor like protein 50" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 478 (173.3 bits), Expect = 1.2e-44, P = 1.2e-44
 Identities = 127/375 (33%), Positives = 198/375 (52%)

Query:     3 LDLSNNLLSGRLPDCWPLFDR-LRILDLANNNFSGKIPDSMGSLPN-IQILSLHNNSLTG 60
             L LSNN  SG +P C+ + ++ L IL L NN+ SG IP+   SL   ++ L + +N L+G
Sbjct:   525 LVLSNNNFSGSIPPCFEISNKTLSILHLRNNSLSGVIPEE--SLHGYLRSLDVGSNRLSG 582

Query:    61 ELPSSLQNCSLLILMDLGRNALSGEIPKWIGESLPKLIVLSLMSNKFHGII--PFQLCYL 118
             + P SL NCS L  +++  N ++   P W+ +SLP L +L L SN+FHG I  P      
Sbjct:   583 QFPKSLINCSYLQFLNVEENRINDTFPSWL-KSLPNLQLLVLRSNEFHGPIFSPGDSLSF 641

Query:   119 PFIQILDLSSNNIPGIIPK-CFNNFTAMAQEKSSVLSVTSEYWFAGGLQLTTAGDFFSGQ 177
               ++  D+S N   G++P   F  ++ M+     ++  T  +   G  Q     + F   
Sbjct:   642 SKLRFFDISENRFSGVLPSDYFVGWSVMSSFVD-IIDNTPGFTVVGDDQ-----ESFHKS 695

Query:   178 AVLTWKGSQYQYQNT-LGLVKMLDLSSNKLGGEVPEEIMDLVGLIAMNLSRNNLTGQITP 236
              VLT KG   +   +   + K +D+S N+L G++PE I  L  LI +N+S N  TG I P
Sbjct:   696 VVLTIKGLNMELVGSGFEIYKTIDVSGNRLEGDIPESIGILKELIVLNMSNNAFTGHIPP 755

Query:   237 KIGQLKSLDFLDLSRNRFFGGIPXXXXXXXXXXXXXXXYNNLSGKIPSGTQLQSFNASTY 296
              +  L +L  LDLS+NR  G IP               YN L G IP GTQ+QS N+S++
Sbjct:   756 SLSNLSNLQSLDLSQNRLSGSIPGELGELTFLARMNFSYNMLEGPIPQGTQIQSQNSSSF 815

Query:   297 AGNE-LCGLPLPNKCPDGDLPPRPGKDDANTREEEDQFITLGFYVSLILGFFSGFWGFCG 355
             A N  LCG PL  KC  G+      +++   +EE+D+ ++   +V+  +G+  G   FCG
Sbjct:   816 AENPGLCGAPLQKKC-GGE------EEEDKEKEEKDKGLS---WVAAAIGYVPGL--FCG 863

Query:   356 TLL--VKSSWRHRYY 368
               +  + +S++  ++
Sbjct:   864 LAIGHILTSYKRDWF 878
GO:0005886 "plasma membrane" evidence=ISM
GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119535 RLP48 "receptor like protein 48" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046585 RLP27 "receptor like protein 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119430 RLP47 "receptor like protein 47" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046357 RLP23 "receptor like protein 23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087253 RLP39 "AT3G24900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086979 RLP42 "receptor like protein 42" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00029949001
SubName- Full=Chromosome undetermined scaffold_51, whole genome shotgun sequence; (1117 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query395
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-41
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-41
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-41
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-39
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-27
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-18
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-18
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-14
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 8e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  156 bits (395), Expect = 1e-41
 Identities = 107/305 (35%), Positives = 154/305 (50%), Gaps = 53/305 (17%)

Query: 3   LDLSNNLLSGRLPDCWPLFDRLRILDLANNNFSGKIPDSMGSLPNIQILSLHNNSLTGEL 62
           LDLS+N LSG +P+       L IL L +NNF+GKIP ++ SLP +Q+L L +N  +GE+
Sbjct: 289 LDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEI 348

Query: 63  PSSLQNCSLLILMDLGRNALSGEIPKWIGES--LPKLIVLS------------------- 101
           P +L   + L ++DL  N L+GEIP+ +  S  L KLI+ S                   
Sbjct: 349 PKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRR 408

Query: 102 --LMSNKFHGIIPFQLCYLPFIQILDLSSNNIPGIIPKCFNNFTAMAQEKSSVLSVTSEY 159
             L  N F G +P +   LP +  LD+S+NN+ G I                     S  
Sbjct: 409 VRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRI--------------------NSRK 448

Query: 160 WFAGGLQ-LTTAGDFFSGQAVLTWKGSQYQYQNTLGLVKMLDLSSNKLGGEVPEEIMDLV 218
           W    LQ L+ A + F G    ++   +         ++ LDLS N+  G VP ++  L 
Sbjct: 449 WDMPSLQMLSLARNKFFGGLPDSFGSKR---------LENLDLSRNQFSGAVPRKLGSLS 499

Query: 219 GLIAMNLSRNNLTGQITPKIGQLKSLDFLDLSRNRFFGGIPSSLSLLSGLSVMDLSYNNL 278
            L+ + LS N L+G+I  ++   K L  LDLS N+  G IP+S S +  LS +DLS N L
Sbjct: 500 ELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQL 559

Query: 279 SGKIP 283
           SG+IP
Sbjct: 560 SGEIP 564

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 395
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.96
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.92
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.91
KOG4237498 consensus Extracellular matrix protein slit, conta 99.89
KOG4237498 consensus Extracellular matrix protein slit, conta 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.84
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.82
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.8
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.79
KOG0617264 consensus Ras suppressor protein (contains leucine 99.77
KOG0617264 consensus Ras suppressor protein (contains leucine 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.75
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
PLN03150623 hypothetical protein; Provisional 99.68
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.48
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.47
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.47
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.44
PLN03150623 hypothetical protein; Provisional 99.41
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.35
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.31
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.24
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.16
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.16
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.15
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.14
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.09
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.08
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.06
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.03
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.99
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.9
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.83
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.66
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.45
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.41
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.41
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.37
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.36
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.32
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.28
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.25
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.25
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.13
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.08
PRK15386426 type III secretion protein GogB; Provisional 98.07
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.02
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.96
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.94
PRK15386426 type III secretion protein GogB; Provisional 97.77
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.6
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.54
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.38
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.3
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.29
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.93
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.3
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.22
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.07
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.89
smart0037026 LRR Leucine-rich repeats, outliers. 94.89
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.85
KOG4308478 consensus LRR-containing protein [Function unknown 94.75
KOG4308478 consensus LRR-containing protein [Function unknown 94.73
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.46
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.16
PF04478154 Mid2: Mid2 like cell wall stress sensor; InterPro: 92.58
smart0037026 LRR Leucine-rich repeats, outliers. 91.42
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.42
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 89.43
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 86.9
KOG1947482 consensus Leucine rich repeat proteins, some prote 86.87
KOG1947482 consensus Leucine rich repeat proteins, some prote 85.21
KOG3864221 consensus Uncharacterized conserved protein [Funct 83.32
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 83.12
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 81.31
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=9.3e-37  Score=321.13  Aligned_cols=304  Identities=34%  Similarity=0.505  Sum_probs=239.1

Q ss_pred             CEEEccCCcccccCCCCccCCCCCCEEECCCCcccccCCCCCCCCCCccEEecccccCcccCchhccCCCCCCEEECCCC
Q 043041            1 MYLDLSNNLLSGRLPDCWPLFDRLRILDLANNNFSGKIPDSMGSLPNIQILSLHNNSLTGELPSSLQNCSLLILMDLGRN   80 (395)
Q Consensus         1 ~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~ls~n   80 (395)
                      ++|++++|.+++.+|..+.++++|+.|++++|.+.+.+|..+..+++|+.|++++|.+++.+|..+..+++|+.|++++|
T Consensus       287 ~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n  366 (968)
T PLN00113        287 ISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTN  366 (968)
T ss_pred             CEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCC
Confidence            46888999988888888888889999999998888888888888888888888888888888888888888888888888


Q ss_pred             cccccCchhHhhcCCCccEEEccceeeccccCccCCCCCCccEEEcccCCCCCCCCccccccccchhccccccccCcccc
Q 043041           81 ALSGEIPKWIGESLPKLIVLSLMSNKFHGIIPFQLCYLPFIQILDLSSNNIPGIIPKCFNNFTAMAQEKSSVLSVTSEYW  160 (395)
Q Consensus        81 ~l~~~ip~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~l~~~~~~~~~~~~  160 (395)
                      .+.+.+|..+. .+++|+.|++++|++.+.+|..+..+++|+.|++++|.+++..|..+..++.|+.++...........
T Consensus       367 ~l~~~~p~~~~-~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~  445 (968)
T PLN00113        367 NLTGEIPEGLC-SSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRIN  445 (968)
T ss_pred             eeEeeCChhHh-CcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccC
Confidence            88877777776 47777777777777777777777777777777777777777777777666666666544333222111


Q ss_pred             c----cC--------CccccC-CCCc--cccceEEE-----eeccccccccccCcccEEECcCCCCccCCChhhhcCcCC
Q 043041          161 F----AG--------GLQLTT-AGDF--FSGQAVLT-----WKGSQYQYQNTLGLVKMLDLSSNKLGGEVPEEIMDLVGL  220 (395)
Q Consensus       161 ~----~~--------~~~~~~-~~~~--~~~~~~~~-----~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L  220 (395)
                      .    ..        .+.+.. .+..  ......+.     +.+..+..+..++.|+.|++++|++.+.+|..+..+++|
T Consensus       446 ~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L  525 (968)
T PLN00113        446 SRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKL  525 (968)
T ss_pred             hhhccCCCCcEEECcCceeeeecCcccccccceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCC
Confidence            0    00        000000 0000  01111222     234455567788999999999999999999999999999


Q ss_pred             CEEeCCCCcCcccCCcccCCCCCCCEEECcCCccCccCcccccCCCCCCEEeCcCCcCcccCCCCcccCccccccccCC-
Q 043041          221 IAMNLSRNNLTGQITPKIGQLKSLDFLDLSRNRFFGGIPSSLSLLSGLSVMDLSYNNLSGKIPSGTQLQSFNASTYAGN-  299 (395)
Q Consensus       221 ~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~l~~l~~~~~~gN-  299 (395)
                      +.|+|++|.+++.+|..++.+++|+.|||++|++++.+|..+..+++|+.|++++|+++|.+|...++.++...++.|| 
T Consensus       526 ~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~  605 (968)
T PLN00113        526 VSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNI  605 (968)
T ss_pred             CEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCc
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999999999 


Q ss_pred             CCCCCC
Q 043041          300 ELCGLP  305 (395)
Q Consensus       300 ~lc~~~  305 (395)
                      .+|+.+
T Consensus       606 ~lc~~~  611 (968)
T PLN00113        606 DLCGGD  611 (968)
T ss_pred             cccCCc
Confidence            899754

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query395
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 8e-33
3rgx_A768 Structural Insight Into Brassinosteroid Perception 9e-33
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-17
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score =  137 bits (346), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 107/331 (32%), Positives = 157/331 (47%), Gaps = 25/331 (7%)
Query: 3   LDLSNNLLSGRLPDCWPLFDRLRILDLANNNFSGKIPDSMGSLPNIQILSLHNNSLTGEL 62
           L LS N LSG +P       +LR L L  N   G+IP  +  +  ++ L L  N LTGE+
Sbjct: 420 LHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEI 479
Query: 63  PSSLQNCSLLILMDLGRNALSGEIPKWIGESLPKLIVLSLMSNKFHGIIPFQLCYLPFIQ 122
           PS L NC+ L  + L  N L+GEIPKWIG  L  L +L L +N F G IP +L     + 
Sbjct: 480 PSGLSNCTNLNWISLSNNRLTGEIPKWIGR-LENLAILKLSNNSFSGNIPAELGDCRSLI 538
Query: 123 ILDLSSNNIPGIIPKCFNNFTAMAQEKSSVLSVTSEYWFAG-GL--QLTTAGDFFSGQAV 179
            LDL++N   G IP     F    +  ++ ++     +    G+  +   AG+    Q +
Sbjct: 539 WLDLNTNLFNGTIPAAM--FKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGI 596
Query: 180 LTWKGSQYQYQNTL------------------GLVKMLDLSSNKLGGEVPEEIMDLVGLI 221
            + + ++   +N                    G +  LD+S N L G +P+EI  +  L 
Sbjct: 597 RSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLF 656
Query: 222 AMNLSRNNLTGQITPKIGQLKSLDFLDLSRNRFFGGIPXXXXXXXXXXXXXXXYNNLSGK 281
            +NL  N+++G I  ++G L+ L+ LDLS N+  G IP                NNLSG 
Sbjct: 657 ILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGP 716
Query: 282 IPSGTQLQSFNASTYAGNE-LCGLPLPNKCP 311
           IP   Q ++F  + +  N  LCG PLP   P
Sbjct: 717 IPEMGQFETFPPAKFLNNPGLCGYPLPRCDP 747
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query395
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-92
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-59
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-59
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-58
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-51
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-50
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-48
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-44
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-39
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-29
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-70
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-35
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-29
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-21
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-15
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-39
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-36
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-35
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-35
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-34
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-34
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-33
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-31
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-29
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-27
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-19
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-36
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-35
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-32
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-31
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-31
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-31
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-30
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-23
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-35
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-33
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-32
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-31
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-31
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-28
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-27
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-26
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-34
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-33
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-33
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-29
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-28
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-26
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-23
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-32
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-31
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-29
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-27
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-27
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-26
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-25
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-17
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-29
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-29
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-25
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-20
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-12
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-19
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-16
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-14
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-17
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 9e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-13
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-21
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-13
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-18
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-16
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-14
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-12
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-12
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  291 bits (747), Expect = 6e-92
 Identities = 100/345 (28%), Positives = 146/345 (42%), Gaps = 31/345 (8%)

Query: 2   YLDLSNNLLSGRLPDCWPLFDRLRILDLANNNFSGKIPDSMGSLPNIQILSLHNNSLTGE 61
            L LS N LSG +P       +LR L L  N   G+IP  +  +  ++ L L  N LTGE
Sbjct: 422 SLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGE 481

Query: 62  LPSSLQNCSLLILMDLGRNALSGEIPKWIGESLPKLIVLSLMSNKFHGIIPFQLCYLPFI 121
           +PS L NC+ L  + L  N L+GEIPKWIG  L  L +L L +N F G IP +L     +
Sbjct: 482 IPSGLSNCTNLNWISLSNNRLTGEIPKWIG-RLENLAILKLSNNSFSGNIPAELGDCRSL 540

Query: 122 QILDLSSNNIPGIIPKCFNNFTAMAQEKSSVLSVTSEYWFAGGLQLTTAGDFFSGQAVLT 181
             LDL++N   G IP      +                   G  +            +L 
Sbjct: 541 IWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKE-----CHGAGNLLE 595

Query: 182 WKGSQYQYQNTLGLVKMLDLSSNKLGGEVPEEIMDLVGLIAMNLSRNNLTGQITPKIGQL 241
           ++G + +  N L      +++S   GG       +   ++ +++S N L+G I  +IG +
Sbjct: 596 FQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSM 655

Query: 242 KSLDFLDLSRNRFFGGIPSSLSLLSGLSVMDLSYNNLS---------------------- 279
             L  L+L  N   G IP  +  L GL+++DLS N L                       
Sbjct: 656 PYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNN 715

Query: 280 --GKIPSGTQLQSFNASTYAGN-ELCGLPLPNKCPDGDLPPRPGK 321
             G IP   Q ++F  + +  N  LCG PLP   P         +
Sbjct: 716 LSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQ 760
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query395
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.98
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.98
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.98
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.98
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.97
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.96
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.96
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.96
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.96
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.96
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.96
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.96
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.95
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.95
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.95
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.95
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.95
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.94
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.94
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.94
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.94
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.93
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.93
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.93
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.92
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.92
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.92
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.92
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.91
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.91
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.91
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.91
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.91
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.9
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.9
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.89
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.89
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.88
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.88
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.87
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.86
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.86
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.86
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.86
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.85
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.85
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.85
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.85
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.85
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.84
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.84
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.82
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.81
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.81
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.8
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.8
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.8
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.8
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.8
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.79
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.79
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.78
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.76
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.75
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.74
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.74
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.73
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.73
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.71
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.71
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.71
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.7
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.7
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.67
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.64
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.63
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.63
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.61
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.61
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.6
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.6
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.59
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.59
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.59
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.57
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.49
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.46
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.4
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.35
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.15
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.02
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.01
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.0
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.93
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.76
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.72
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.66
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.63
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.6
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.49
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.22
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.1
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.08
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.58
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.35
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.33
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.3
2k1k_A38 Ephrin type-A receptor 1; EPHA1, receptor tyrosine 86.82
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 83.43
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 80.57
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=3.3e-43  Score=360.00  Aligned_cols=311  Identities=33%  Similarity=0.476  Sum_probs=235.8

Q ss_pred             CEEEccCCcccccCCCCccCCCCCCEEECCCCcccccCCCCCCCCCCccEEecccccCcccCchhccCCCCCCEEECCCC
Q 043041            1 MYLDLSNNLLSGRLPDCWPLFDRLRILDLANNNFSGKIPDSMGSLPNIQILSLHNNSLTGELPSSLQNCSLLILMDLGRN   80 (395)
Q Consensus         1 ~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~ls~n   80 (395)
                      ++|++++|.+++.+|..+.++++|+.|++++|++++.+|..|+++++|++|++++|.+++.+|..+..+++|++|++++|
T Consensus       397 ~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N  476 (768)
T 3rgz_A          397 QELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN  476 (768)
T ss_dssp             CEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSS
T ss_pred             cEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCC
Confidence            35666777776667777777777777777777777777777777777777777777777777777777777777777777


Q ss_pred             cccccCchhHhhcCCCccEEEccceeeccccCccCCCCCCccEEEcccCCCCCCCCccccccccchhccccccccCcccc
Q 043041           81 ALSGEIPKWIGESLPKLIVLSLMSNKFHGIIPFQLCYLPFIQILDLSSNNIPGIIPKCFNNFTAMAQEKSSVLSVTSEYW  160 (395)
Q Consensus        81 ~l~~~ip~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~l~~~~~~~~~~~~  160 (395)
                      ++++.+|..+. .+++|++|++++|++++.+|.+++.+++|++|++++|.+++.+|..+..+++|+.++...........
T Consensus       477 ~l~~~~p~~l~-~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip  555 (768)
T 3rgz_A          477 DLTGEIPSGLS-NCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIP  555 (768)
T ss_dssp             CCCSCCCGGGG-GCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCC
T ss_pred             cccCcCCHHHh-cCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCC
Confidence            77766776665 47777777777777777777777777777777777777777777777777777766654433321110


Q ss_pred             cc--CCccccCC---C--------------------------------------CccccceEEEeeccccccccccCccc
Q 043041          161 FA--GGLQLTTA---G--------------------------------------DFFSGQAVLTWKGSQYQYQNTLGLVK  197 (395)
Q Consensus       161 ~~--~~~~~~~~---~--------------------------------------~~~~~~~~~~~~~~~~~~~~~l~~L~  197 (395)
                      ..  ........   .                                      ..........+.|..+..+..++.|+
T Consensus       556 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~  635 (768)
T 3rgz_A          556 AAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMM  635 (768)
T ss_dssp             GGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCC
T ss_pred             hHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhcccccc
Confidence            00  00000000   0                                      00000001234555666778889999


Q ss_pred             EEECcCCCCccCCChhhhcCcCCCEEeCCCCcCcccCCcccCCCCCCCEEECcCCccCccCcccccCCCCCCEEeCcCCc
Q 043041          198 MLDLSSNKLGGEVPEEIMDLVGLIAMNLSRNNLTGQITPKIGQLKSLDFLDLSRNRFFGGIPSSLSLLSGLSVMDLSYNN  277 (395)
Q Consensus       198 ~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~  277 (395)
                      .||+++|+++|.+|..++.++.|+.|+|++|+++|.+|..++.+++|+.|||++|+++|.+|..+..+++|++||+++|+
T Consensus       636 ~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~  715 (768)
T 3rgz_A          636 FLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNN  715 (768)
T ss_dssp             EEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSE
T ss_pred             EEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcccCCCCcccCccccccccCC-CCCCCCCCCCCCCC
Q 043041          278 LSGKIPSGTQLQSFNASTYAGN-ELCGLPLPNKCPDG  313 (395)
Q Consensus       278 l~~~~p~~~~l~~l~~~~~~gN-~lc~~~~~~~c~~~  313 (395)
                      ++|.||...++.++...+|.|| .|||.|.. .|...
T Consensus       716 l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~  751 (768)
T 3rgz_A          716 LSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RCDPS  751 (768)
T ss_dssp             EEEECCSSSSGGGSCGGGGCSCTEEESTTSC-CCCSC
T ss_pred             ccccCCCchhhccCCHHHhcCCchhcCCCCc-CCCCC
Confidence            9999999999999999999999 99999987 88644
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 395
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-21
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-11
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 1e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 90.2 bits (222), Expect = 6e-21
 Identities = 68/283 (24%), Positives = 103/283 (36%), Gaps = 7/283 (2%)

Query: 28  DLANNNFSGKIPDSMGSLPNIQILSLHNNSLTG--ELPSSLQNCSLLILMDLGRNALSGE 85
           D  N  + G + D+      +  L L   +L     +PSSL N   L  + +G       
Sbjct: 32  DCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVG 91

Query: 86  IPKWIGESLPKLIVLSLMSNKFHGIIPFQLCYLPFIQILDLSSNNIPGIIPKCFNNFTAM 145
                   L +L  L +      G IP  L  +  +  LD S N + G +P   ++   +
Sbjct: 92  PIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNL 151

Query: 146 AQEKSSVLSVTSEYWFAGGLQLTTAGDFFSGQAVLTWKGSQYQYQNTLGLVKMLDLSSNK 205
                    ++     + G            +  LT K                   S  
Sbjct: 152 VGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN----LAFVDLSRN 207

Query: 206 LGGEVPEEIMDLVGLIAMNLSRNNLTGQITPKIGQLKSLDFLDLSRNRFFGGIPSSLSLL 265
           +       +              N       K+G  K+L+ LDL  NR +G +P  L+ L
Sbjct: 208 MLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQL 267

Query: 266 SGLSVMDLSYNNLSGKIPSGTQLQSFNASTYAGN-ELCGLPLP 307
             L  +++S+NNL G+IP G  LQ F+ S YA N  LCG PLP
Sbjct: 268 KFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLP 310
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query395
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.96
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.95
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.91
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.85
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.84
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.81
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.81
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.81
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.8
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.8
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.79
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.79
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.79
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.72
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.67
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.65
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.62
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.62
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.61
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.6
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.52
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.51
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.5
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.47
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.44
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.4
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.37
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.69
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.52
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.08
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.77
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.43
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.14
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=3.7e-37  Score=280.38  Aligned_cols=254  Identities=35%  Similarity=0.590  Sum_probs=185.4

Q ss_pred             EEEccCCcccc--cCCCCccCCCCCCEEECCC-CcccccCCCCCCCCCCccEEecccccCcccCchhccCCCCCCEEECC
Q 043041            2 YLDLSNNLLSG--RLPDCWPLFDRLRILDLAN-NNFSGKIPDSMGSLPNIQILSLHNNSLTGELPSSLQNCSLLILMDLG   78 (395)
Q Consensus         2 ~L~Ls~n~l~~--~~p~~~~~l~~L~~L~Ls~-n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~ls   78 (395)
                      +|||++|.++|  .+|++++++++|++|+|++ |+++|.+|++|+++++|++|+|++|++.+..+..+..+.+|++++++
T Consensus        54 ~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~  133 (313)
T d1ogqa_          54 NLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFS  133 (313)
T ss_dssp             EEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECC
T ss_pred             EEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccc
Confidence            45666666555  3555566666666666654 55555566666666666666666666665555556666666666666


Q ss_pred             CCcccccCchhHhhcCCCccEEEccceeeccccCccCCCCCCc-cEEEcccCCCCCCCCccccccccchhccccccccCc
Q 043041           79 RNALSGEIPKWIGESLPKLIVLSLMSNKFHGIIPFQLCYLPFI-QILDLSSNNIPGIIPKCFNNFTAMAQEKSSVLSVTS  157 (395)
Q Consensus        79 ~n~l~~~ip~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L-~~L~l~~n~l~~~~~~~~~~l~~L~~l~~~~~~~~~  157 (395)
                      +|.+.+.+|..+. .++.|+++++++|.+.+.+|..+..+..+ +.+++++|++++..|..+..                
T Consensus       134 ~N~~~~~~p~~l~-~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~----------------  196 (313)
T d1ogqa_         134 YNALSGTLPPSIS-SLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFAN----------------  196 (313)
T ss_dssp             SSEEESCCCGGGG-GCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGG----------------
T ss_pred             cccccccCchhhc-cCcccceeeccccccccccccccccccccccccccccccccccccccccc----------------
Confidence            6665555555554 36666666666666665566555555544 55566666555544443322                


Q ss_pred             cccccCCccccCCCCccccceEEEeeccccccccccCcccEEECcCCCCccCCChhhhcCcCCCEEeCCCCcCcccCCcc
Q 043041          158 EYWFAGGLQLTTAGDFFSGQAVLTWKGSQYQYQNTLGLVKMLDLSSNKLGGEVPEEIMDLVGLIAMNLSRNNLTGQITPK  237 (395)
Q Consensus       158 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~  237 (395)
                                                         +. ...++++.+...+.+|..+..++.++.+++++|.+++.+| .
T Consensus       197 -----------------------------------l~-~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~  239 (313)
T d1ogqa_         197 -----------------------------------LN-LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-K  239 (313)
T ss_dssp             -----------------------------------CC-CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-G
T ss_pred             -----------------------------------cc-cccccccccccccccccccccccccccccccccccccccc-c
Confidence                                               22 3579999999999999999999999999999999997655 6


Q ss_pred             cCCCCCCCEEECcCCccCccCcccccCCCCCCEEeCcCCcCcccCCCCcccCccccccccCC-CCCCCCCCCCC
Q 043041          238 IGQLKSLDFLDLSRNRFFGGIPSSLSLLSGLSVMDLSYNNLSGKIPSGTQLQSFNASTYAGN-ELCGLPLPNKC  310 (395)
Q Consensus       238 ~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~l~~l~~~~~~gN-~lc~~~~~~~c  310 (395)
                      ++.+++|+.|+|++|+++|.+|..++++++|++|+|++|+++|.+|+...+++|+.+++.|| .+||.|++ .|
T Consensus       240 ~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~~l~g~plp-~c  312 (313)
T d1ogqa_         240 VGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLP-AC  312 (313)
T ss_dssp             CCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSSEEESTTSS-CC
T ss_pred             cccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHHhCCCccccCCCCC-CC
Confidence            88999999999999999999999999999999999999999999999888999999999999 79998875 66
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure