Citrus Sinensis ID: 043050


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140--
TRRNEPTVKGTITFDENSTIAISPVNFNGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAWVSTLHAAQLVLKAHKEAVNSLSGNGSAKLGTVATVVAAANSTAQECSKEIEAAMQISLRNALGTMTNRITDGPMDDLSIMK
ccccccccccEEEEccccEEEEEccccccccccccEEEEEcccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccc
cccccccccEEEEEEcccEEEEcccccccccccccEEEEEEccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHcc
trrneptvkgtitfdenstiaispvnfnglpkydgccfyigtpqkkdyflcaetpGAARAWVSTLHAAQLVLKAHKEAVNslsgngsaklGTVATVVAAANSTAQECSKEIEAAMQISLRNALGTmtnritdgpmddlsimk
trrneptvkgtitfdenstiaiSPVNFNGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAWVSTLHAAQLVLKAHKEAVNSLSGNGSAKLGTVATVVAAANSTAQECSKEIEAAMQISLRNalgtmtnritdgpmddlsimk
TRRNEPTVKGTITFDENSTIAISPVNFNGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAWVSTLHAAQLVLKAHKEAVNSLSGNGSAKLGtvatvvaaanstaQECSKEIEAAMQISLRNALGTMTNRITDGPMDDLSIMK
**********TITFDENSTIAISPVNFNGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAWVSTLHAAQLVLKAHKEAVNSLSGNGSAKLGTVATVVAAAN***************I*************************
******T****ITFDENSTIAISPVNFNGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAWVSTLHAAQLVLKA*************AKLGTVATVVAAANSTAQECSKEIEAAMQISLRN************PMDDLSIMK
*********GTITFDENSTIAISPVNFNGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAWVSTLHAAQLVLKAHKEAVNSLSGNGSAKLGTVATVVAAANSTAQECSKEIEAAMQISLRNALGTMTNRITDGPMDDLSIMK
******TVKGTITFDENSTIAISPVNFNGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAWVSTLHAAQLVLKAHKEAVNSLSGNGSAKLGTVATVVAAANSTAQECSKEIEAAMQISLRNALGT***********DL****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TRRNEPTVKGTITFDENSTIAISPVNFNGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAWVSTLHAAQLVLKAHKEAVNSLSGNGSAKLGTVATVVAAANSTAQECSKEIEAAMQISLRNALGTMTNRITDGPMDDLSIMK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query142
357494193 492 hypothetical protein MTR_5g091000 [Medic 0.992 0.286 0.914 1e-72
356553844 490 PREDICTED: uncharacterized protein LOC10 0.992 0.287 0.914 1e-72
356501455 490 PREDICTED: uncharacterized protein LOC10 0.992 0.287 0.914 2e-72
255558688 499 conserved hypothetical protein [Ricinus 1.0 0.284 0.894 5e-72
224082584 501 predicted protein [Populus trichocarpa] 1.0 0.283 0.887 9e-72
225446797 500 PREDICTED: uncharacterized protein LOC10 0.992 0.282 0.879 2e-69
449502140 487 PREDICTED: uncharacterized protein LOC10 0.992 0.289 0.843 7e-67
449460032 490 PREDICTED: uncharacterized protein LOC10 0.992 0.287 0.843 8e-67
224066555 501 predicted protein [Populus trichocarpa] 1.0 0.283 0.880 1e-66
42570991 381 Pleckstrin homology (PH) domain-containi 1.0 0.372 0.830 3e-66
>gi|357494193|ref|XP_003617385.1| hypothetical protein MTR_5g091000 [Medicago truncatula] gi|355518720|gb|AET00344.1| hypothetical protein MTR_5g091000 [Medicago truncatula] Back     alignment and taxonomy information
 Score =  276 bits (707), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 131/141 (92%)

Query: 2   RRNEPTVKGTITFDENSTIAISPVNFNGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAW 61
           RRNEPTVKGTI FD NSTI +SPVNFNGLPKYDGCC YIGTPQKKDYFLCAETPGAARAW
Sbjct: 63  RRNEPTVKGTILFDANSTITVSPVNFNGLPKYDGCCIYIGTPQKKDYFLCAETPGAARAW 122

Query: 62  VSTLHAAQLVLKAHKEAVNSLSGNGSAKLGTVATVVAAANSTAQECSKEIEAAMQISLRN 121
           VSTLHA QLVLKAHKEAVNSLSGNGS KLGTVATVVAAANSTA ECSKEIEAAMQISLRN
Sbjct: 123 VSTLHATQLVLKAHKEAVNSLSGNGSTKLGTVATVVAAANSTASECSKEIEAAMQISLRN 182

Query: 122 ALGTMTNRITDGPMDDLSIMK 142
           ALG M NR TDGPMDDL+IMK
Sbjct: 183 ALGMMPNRTTDGPMDDLTIMK 203




Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356553844|ref|XP_003545261.1| PREDICTED: uncharacterized protein LOC100792926 [Glycine max] Back     alignment and taxonomy information
>gi|356501455|ref|XP_003519540.1| PREDICTED: uncharacterized protein LOC100820315 [Glycine max] Back     alignment and taxonomy information
>gi|255558688|ref|XP_002520368.1| conserved hypothetical protein [Ricinus communis] gi|223540415|gb|EEF41984.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224082584|ref|XP_002306753.1| predicted protein [Populus trichocarpa] gi|222856202|gb|EEE93749.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225446797|ref|XP_002283267.1| PREDICTED: uncharacterized protein LOC100254120 [Vitis vinifera] gi|302143523|emb|CBI22084.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449502140|ref|XP_004161554.1| PREDICTED: uncharacterized protein LOC101223787 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449460032|ref|XP_004147750.1| PREDICTED: uncharacterized protein LOC101215308 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224066555|ref|XP_002302134.1| predicted protein [Populus trichocarpa] gi|222843860|gb|EEE81407.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|42570991|ref|NP_973569.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] gi|330253358|gb|AEC08452.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query142
TAIR|locus:2052831 504 SWAP70 [Arabidopsis thaliana ( 1.0 0.281 0.739 1.1e-53
TAIR|locus:2052831 SWAP70 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 555 (200.4 bits), Expect = 1.1e-53, P = 1.1e-53
 Identities = 105/142 (73%), Positives = 116/142 (81%)

Query:     1 TRRNEPTVKGTITFDENSTIAISPVNFNGLPKYDGCCFYIGTPQKKDYFLCAETPGAARA 60
             TRRNEPT+KGTI FDENSTI+ISPVNF GLPKY+GCC YIGTPQKKDYFLCAETPGAA+A
Sbjct:    66 TRRNEPTIKGTILFDENSTISISPVNFQGLPKYNGCCIYIGTPQKKDYFLCAETPGAAKA 125

Query:    61 WVSTLHAAQLVLKAHKEAVNSLSGNGSAKLGXXXXXXXXXXXXXQECSKEIEAAMQISLR 120
             WV+TLHA QLVLKAHKEAV SLSG+GSA LG              ECS+EI+AAMQISLR
Sbjct:   126 WVTTLHATQLVLKAHKEAVESLSGSGSATLGTVATVVAAANSTALECSREIQAAMQISLR 185

Query:   121 NALGTMTNRITDGPMDDLSIMK 142
             NAL    N+  DGP+DDL+IMK
Sbjct:   186 NALKITPNKPIDGPLDDLTIMK 207


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.316   0.130   0.385    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      142       129   0.00091  102 3  11 22  0.42    31
                                                     29  0.41    33


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  581 (62 KB)
  Total size of DFA:  132 KB (2083 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  10.66u 0.09s 10.75t   Elapsed:  00:00:02
  Total cpu time:  10.66u 0.09s 10.75t   Elapsed:  00:00:02
  Start:  Tue May 21 03:26:26 2013   End:  Tue May 21 03:26:28 2013


GO:0005543 "phospholipid binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0007165 "signal transduction" evidence=ISS
GO:0035091 "phosphatidylinositol binding" evidence=ISS
GO:0009505 "plant-type cell wall" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
pfam00169101 pfam00169, PH, PH domain 7e-05
smart00233102 smart00233, PH, Pleckstrin homology domain 1e-04
cd01235106 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (als 2e-04
cd13266106 cd13266, PH_Skap_family, Src kinase-associated pho 0.001
cd13381106 cd13381, PH_Skap-hom_Skap2, Src kinase-associated 0.001
>gnl|CDD|215766 pfam00169, PH, PH domain Back     alignment and domain information
 Score = 39.4 bits (92), Expect = 7e-05
 Identities = 16/61 (26%), Positives = 27/61 (44%), Gaps = 4/61 (6%)

Query: 9   KGTITFDENSTIAISPVNFNGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAWVSTLHAA 68
           KG+I       +   P + +G  K    CF I T  ++ + L AE+    + WV  + +A
Sbjct: 44  KGSIPLSG-CQVTKVPDSEDGKRKN---CFEIRTGDRETFLLQAESEEERKEWVKAIRSA 99

Query: 69  Q 69
            
Sbjct: 100 I 100


PH stands for pleckstrin homology. Length = 101

>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain Back     alignment and domain information
>gnl|CDD|241268 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (also called Human MTMR5) Pleckstrin Homology (PH) domain Back     alignment and domain information
>gnl|CDD|241420 cd13266, PH_Skap_family, Src kinase-associated phosphoprotein family Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241532 cd13381, PH_Skap-hom_Skap2, Src kinase-associated phosphoprotein homolog and Skap 2 Pleckstrin homology (PH) domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 142
cd01235101 PH_SETbf Set binding factor Pleckstrin Homology (P 98.47
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 98.11
cd01251103 PH_centaurin_alpha Centaurin alpha Pleckstrin homo 98.03
cd0126595 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain 97.94
cd0125094 PH_centaurin Centaurin Pleckstrin homology (PH) do 97.83
cd0126096 PH_CNK Connector enhancer of KSR (Kinase suppresso 97.82
cd01266108 PH_Gab Gab (Grb2-associated binder) pleckstrin hom 97.8
cd0124691 PH_oxysterol_bp Oxysterol binding protein (OSBP) P 97.71
cd01233100 Unc104 Unc-104 pleckstrin homology (PH) domain. Un 97.66
cd01236104 PH_outspread Outspread Pleckstrin homology (PH) do 97.47
cd0082196 PH Pleckstrin homology (PH) domain. Pleckstrin hom 97.47
cd01238106 PH_Tec Tec pleckstrin homology (PH) domain. Tec pl 97.45
cd0124791 PH_GPBP Goodpasture antigen binding protein (GPBP) 97.28
cd01252125 PH_cytohesin Cytohesin Pleckstrin homology (PH) do 97.07
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 96.99
cd01254121 PH_PLD Phospholipase D (PLD) pleckstrin homology ( 96.79
cd01264101 PH_melted Melted pleckstrin homology (PH) domain. 96.57
cd0124598 PH_RasGAP_CG5898 RAS GTPase-activating protein (GA 96.44
cd01257101 PH_IRS Insulin receptor substrate (IRS) pleckstrin 96.33
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 96.02
cd01253104 PH_beta_spectrin Beta-spectrin pleckstrin homology 95.16
cd0124498 PH_RasGAP_CG9209 RAS_GTPase activating protein (GA 95.1
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 95.03
cd0122297 PH_clg Clg (common-site lymphoma/leukemia guanine 93.0
cd01248115 PH_PLC Phospholipase C (PLC) pleckstrin homology ( 92.73
cd0122099 PH_CDEP Chondrocyte-derived ezrin-like domain cont 92.2
PF15413112 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE 90.83
cd01241102 PH_Akt Akt pleckstrin homology (PH) domain. Akt pl 88.81
cd01232114 PH_TRIO Trio pleckstrin homology (PH) domain. Trio 84.11
cd01230117 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 81.86
cd01218104 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain 80.49
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain Back     alignment and domain information
Probab=98.47  E-value=8.4e-07  Score=59.44  Aligned_cols=63  Identities=24%  Similarity=0.418  Sum_probs=46.3

Q ss_pred             CCCCCcceeEEeecCceeeeeccccCCCCC-Cc-ceeEEeccccceeeEEeecChHHHHHHHHHHHH
Q 043050            3 RNEPTVKGTITFDENSTIAISPVNFNGLPK-YD-GCCFYIGTPQKKDYFLCAETPGAARAWVSTLHA   67 (142)
Q Consensus         3 r~e~~~rg~I~fda~sTvtiSpvNfhg~~k-yD-gCCfYIgt~~kk~yfLcAETp~aAraWv~tlrA   67 (142)
                      ..|..++|.|.++...+|.+...+. +.|+ .+ .+||-|-| .++-|||+|||+..++.|+..||.
T Consensus        35 ~~~~~~~g~I~L~~~~~v~~~~~~~-~~~~~~~~~~~f~i~t-~~r~~~~~a~s~~e~~~Wi~ai~~   99 (101)
T cd01235          35 FEDTAEKGCIDLAEVKSVNLAQPGM-GAPKHTSRKGFFDLKT-SKRTYNFLAENINEAQRWKEKIQQ   99 (101)
T ss_pred             CCCCccceEEEcceeEEEeecCCCC-CCCCCCCCceEEEEEe-CCceEEEECCCHHHHHHHHHHHHh
Confidence            3568899999999988887644332 3333 22 34555545 566899999999999999999986



Set binding factor Pleckstrin Homology (PH) domain. Set binding factor is a myotubularin-related pseudo-phosphatase consisting of a Denn domain, a Gram domain, an inactive phosphatase domain, a SID motif and a C-terminal PH domain. Its PH domain is predicted to bind lipids based upon its ability to respond to phosphatidylinositol 3-kinase .

>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain Back     alignment and domain information
>cd00821 PH Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain Back     alignment and domain information
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain Back     alignment and domain information
>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01264 PH_melted Melted pleckstrin homology (PH) domain Back     alignment and domain information
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01248 PH_PLC Phospholipase C (PLC) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain Back     alignment and domain information
>PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C Back     alignment and domain information
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain Back     alignment and domain information
>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain Back     alignment and domain information
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 5e-10
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 3e-09
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 1e-08
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 1e-07
3aj4_A112 Pleckstrin homology domain-containing family B ME; 1e-07
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 4e-07
2yry_A122 Pleckstrin homology domain-containing family A mem 8e-07
2dkp_A128 Pleckstrin homology domain-containing family A mem 1e-06
1u5e_A211 SRC-associated adaptor protein; novel dimerization 2e-06
2d9y_A117 Pleckstrin homology domain-containing protein fami 2e-06
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 3e-06
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 4e-06
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 4e-06
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 4e-06
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 4e-06
2d9v_A130 Pleckstrin homology domain-containing protein fami 5e-06
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 5e-06
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 5e-06
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 8e-06
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 2e-05
3rcp_A103 Pleckstrin homology domain-containing family A ME; 3e-05
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 3e-05
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 1e-04
3cxb_B112 Pleckstrin homology domain-containing family M mem 1e-04
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 2e-04
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 3e-04
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 4e-04
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 5e-04
1v5p_A126 Pleckstrin homology domain-containing, family A; T 5e-04
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 7e-04
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 Back     alignment and structure
 Score = 52.8 bits (127), Expect = 5e-10
 Identities = 14/68 (20%), Positives = 24/68 (35%)

Query: 1   TRRNEPTVKGTITFDENSTIAISPVNFNGLPKYDGCCFYIGTPQKKDYFLCAETPGAARA 60
             R +   KG I   E   +A            D   F+     ++ Y  CA+   +A+ 
Sbjct: 42  DHRMDTECKGVIDLAEVEAVAPGTPTIGAPKTVDEKAFFDVKTTRRVYNFCAQDVPSAQQ 101

Query: 61  WVSTLHAA 68
           WV  + + 
Sbjct: 102 WVDRIQSC 109


>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 123 Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Length = 106 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query142
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 98.35
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 98.32
3aj4_A112 Pleckstrin homology domain-containing family B ME; 98.3
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 98.3
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 98.28
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 98.26
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 98.25
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 98.23
2yry_A122 Pleckstrin homology domain-containing family A mem 98.22
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 98.21
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 98.21
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 98.21
3rcp_A103 Pleckstrin homology domain-containing family A ME; 98.2
2d9y_A117 Pleckstrin homology domain-containing protein fami 98.2
1v88_A130 Oxysterol binding protein-related protein 8; vesic 98.15
2dkp_A128 Pleckstrin homology domain-containing family A mem 98.15
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 98.13
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 98.09
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 98.08
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 98.07
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 98.05
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 98.0
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 97.96
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 97.94
1v5p_A126 Pleckstrin homology domain-containing, family A; T 97.94
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 97.89
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 97.89
2d9v_A130 Pleckstrin homology domain-containing protein fami 97.88
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 97.8
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 97.77
1u5e_A211 SRC-associated adaptor protein; novel dimerization 97.75
3tca_A291 Amyloid beta A4 precursor protein-binding family 1 97.71
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 97.64
3cxb_B112 Pleckstrin homology domain-containing family M mem 97.63
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 97.61
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 97.59
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 97.52
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 97.51
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 97.48
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 97.41
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 97.34
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 97.29
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 97.28
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 97.22
1wi1_A126 Calcium-dependent activator protein for secretion, 97.19
3a8p_A263 T-lymphoma invasion and metastasis-inducing protei 97.17
1qqg_A264 IRS-1, insulin receptor substrate 1; beta-sandwhic 97.13
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 97.12
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 97.05
2r09_A347 Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph 96.98
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 96.94
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 96.84
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 96.53
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 96.48
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 96.25
4h8s_A407 DCC-interacting protein 13-beta; BAR domain, pleck 96.07
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 95.87
2d9w_A127 Docking protein 2; PH domain, structural genomics, 95.83
1mai_A131 Phospholipase C delta-1; pleckstrin, inositol tris 95.62
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 94.06
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 93.84
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 93.64
1w1g_A151 HPDK1, 3-phosphoinositide dependent protein kinase 93.36
4gmv_A281 RAS-associated and pleckstrin homology domains-CO 92.88
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 90.23
3a8n_A279 TIAM-1, T-lymphoma invasion and metastasis-inducin 88.76
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 87.17
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 86.15
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 85.8
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 84.33
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 84.24
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 83.07
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 80.37
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
Probab=98.35  E-value=2.4e-06  Score=55.67  Aligned_cols=62  Identities=21%  Similarity=0.389  Sum_probs=50.0

Q ss_pred             CCCCCcceeEEeecCceeeeeccccCCCCCCcceeEEeccccceeeEEeecChHHHHHHHHHHHHHHH
Q 043050            3 RNEPTVKGTITFDENSTIAISPVNFNGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAWVSTLHAAQL   70 (142)
Q Consensus         3 r~e~~~rg~I~fda~sTvtiSpvNfhg~~kyDgCCfYIgt~~kk~yfLcAETp~aAraWv~tlrAa~l   70 (142)
                      .+|..++|.|.++....|...|-     .+...+||.|-||. +.|+|+|||+.....|+..|+.+..
T Consensus        42 ~~~~~~~g~i~L~~~~~v~~~~~-----~~~~~~~F~i~~~~-r~~~l~a~s~~e~~~Wi~ai~~~~~  103 (115)
T 2dn6_A           42 EDLKDKKGDILLDENCCVESLPD-----KDGKKCLFLVKCFD-KTFEISASDKKKKQEWIQAIHSTIH  103 (115)
T ss_dssp             TTCSSEEEEECCCTTCEEEEECC-----CTTCCSEEEEECSS-CEEEEECSSHHHHHHHHHHHHHHHH
T ss_pred             CCCcccCcEEEecCcEEEEECCC-----CCCCeeEEEEEeCC-CEEEEEcCCHHHHHHHHHHHHHHHH
Confidence            35678999999998888877653     22345899998875 5799999999999999999987654



>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Back     alignment and structure
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Back     alignment and structure
>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 142
d1v5ua_117 b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M 1e-06
d2i5fa1104 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie 1e-06
d1u5ea1209 b.55.1.1 (A:14-222) Src-associated adaptor protein 2e-06
d1x1ga1116 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie 3e-05
d1upqa_107 b.55.1.1 (A:) Phosphoinositol 3-phosphate binding 7e-05
d1v5ma_136 b.55.1.1 (A:) SH2 and PH domain-containing adapter 1e-04
d1wi1a_126 b.55.1.1 (A:) Calcium-dependent activator protein 2e-04
d1u5da1106 b.55.1.1 (A:108-213) Src kinase-associated phospho 2e-04
d1eaza_103 b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 3e-04
d1u5fa1111 b.55.1.1 (A:109-219) Src-associated adaptor protei 4e-04
d1droa_122 b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila 0.001
d1wg7a_150 b.55.1.1 (A:) Dedicator of cytokinesis protein 9, 0.003
d1wjma_123 b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), 0.003
d1plsa_113 b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta 0.004
d1btka_169 b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom 0.004
d1btna_106 b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), 0.004
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 Back     information, alignment and structure

class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Pleckstrin-homology domain (PH domain)
domain: SET binding factor 1, Sbf1
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 42.3 bits (98), Expect = 1e-06
 Identities = 14/66 (21%), Positives = 24/66 (36%)

Query: 3   RNEPTVKGTITFDENSTIAISPVNFNGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAWV 62
           R +   KG I   E   +A            D   F+     ++ Y  CA+   +A+ WV
Sbjct: 44  RMDTECKGVIDLAEVEAVAPGTPTIGAPKTVDEKAFFDVKTTRRVYNFCAQDVPSAQQWV 103

Query: 63  STLHAA 68
             + + 
Sbjct: 104 DRIQSC 109


>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query142
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 98.86
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 98.68
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 98.39
d1u5ea1209 Src-associated adaptor protein Skap2 {Mouse (Mus m 98.29
d1wi1a_126 Calcium-dependent activator protein for secretion, 98.24
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 98.19
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 98.12
d2coaa1112 Protein kinase c, d2 type {Human (Homo sapiens) [T 98.1
d1upqa_107 Phosphoinositol 3-phosphate binding protein-1, PEP 98.07
d1omwa2119 G-protein coupled receptor kinase 2 (beta-adrenerg 98.02
d1v5ma_136 SH2 and PH domain-containing adapter protein APS { 98.01
d1wg7a_150 Dedicator of cytokinesis protein 9, DOCK9 {Human ( 98.0
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 98.0
d1eaza_103 Tapp1 {Human (Homo sapiens) [TaxId: 9606]} 97.99
d1u5da1106 Src kinase-associated phosphoprotein SKAP55 (SCAP1 97.98
d2coca199 FYVE, RhoGEF and PH domain containing protein 3, F 97.97
d1btna_106 beta-spectrin {Mouse (Mus musculus), brain [TaxId: 97.9
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 97.81
d2cofa195 KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} 97.78
d1droa_122 beta-spectrin {Fruit fly (Drosophila melanogaster) 97.75
d1wjma_123 beta-spectrin {Human (Homo sapiens), brain 2 isofo 97.73
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 97.71
d1v5pa_126 Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} 97.64
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 97.6
d1unqa_118 Rac-alpha serine/threonine kinase {Human (Homo sap 97.54
d1qqga1103 Insulin receptor substrate 1, IRS-1 {Human (Homo s 97.46
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 97.36
d1v89a_118 Rho-GTPase-activating protein 25 (KIAA0053) {Human 97.28
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 97.28
d1x1fa1136 Signal-transducing adaptor protein 1, STAP-1 {Huma 97.18
d2j59m1133 Rho GTPase-activating protein 21 {Human (Homo sapi 97.14
d1v88a_130 Oxysterol binding protein-related protein 8 (ORP-8 97.11
d2elba2101 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 97.09
d2dyna_111 Dynamin {Human (Homo sapiens) [TaxId: 9606]} 97.03
d1fgya_127 Grp1 {Mouse (Mus musculus) [TaxId: 10090]} 96.72
d1w1ha_147 3-phosphoinositide dependent protein kinase-1 {Hum 95.69
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 95.25
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 94.69
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 93.02
d1ki1b2142 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 91.65
d2zkmx3131 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 91.36
d1dbha2133 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 89.84
d1kz7a2147 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 85.4
d2dfka2162 Rho guanine nucleotide exchange factor 9, Collybis 82.23
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Pleckstrin-homology domain (PH domain)
domain: SET binding factor 1, Sbf1
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=98.86  E-value=1.4e-09  Score=69.64  Aligned_cols=66  Identities=21%  Similarity=0.403  Sum_probs=57.1

Q ss_pred             CCCCCcceeEEeecCceeeeeccccCCCCCCcceeEEeccccceeeEEeecChHHHHHHHHHHHHH
Q 043050            3 RNEPTVKGTITFDENSTIAISPVNFNGLPKYDGCCFYIGTPQKKDYFLCAETPGAARAWVSTLHAA   68 (142)
Q Consensus         3 r~e~~~rg~I~fda~sTvtiSpvNfhg~~kyDgCCfYIgt~~kk~yfLcAETp~aAraWv~tlrAa   68 (142)
                      .+|..++|+|.++....|.+...+.+.....+.+||++.+...+.|||||||+...+.||..|+.+
T Consensus        44 ~~~~~p~g~i~l~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~s~~e~~~Wv~~l~~a  109 (117)
T d1v5ua_          44 RMDTECKGVIDLAEVEAVAPGTPTIGAPKTVDEKAFFDVKTTRRVYNFCAQDVPSAQQWVDRIQSC  109 (117)
T ss_dssp             SSCSSCCCEEEGGGEEEEECCCCCTTSCSSSCTTTCEEEEESSCEEEEECSSHHHHHHHHHHHHTT
T ss_pred             ccccCcceEEEecceEEEeecccccccccccccceEEEeeCCCcEEEEEeCCHHHHHHHHHHHHHH
Confidence            567899999999999999988888888877777766666666779999999999999999999865



>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx3 b.55.1.1 (X:11-141) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure