Citrus Sinensis ID: 043097

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----

MADVILVNSKFTATTFANTFKKLHARGIHPVVLYPAVNVYQFDKPHSSMAAYKPVIACDSGGPVETIKNEVVGFLCNPTPQEFSLSMAKLIQEPQMAKKMGENARHHVMESFSTKIFGQHLNRLLAYVARGKED

cccccccccEEEEEEccccHHHHHHHccccEEEccccccccccHHHHHHHccccEEEcccccccEEEEcccEEEEccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccc

cccEEEcccccEEEccccHHHHHHHHHHccEEEEcccccccccEEHHHHHccccEEEEcccccEEEEEccccEEcccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccc

MADVILVNSKFTATTFANTFKKLhargihpvvlypavnvyqfdkphssmaaykpviacdsggpvetiknevvgflcnptpqeFSLSMAKLIQEPQMAKKMGENARHHVMESFSTKIFGQHLNRLLAYVARGKED

madvilvnskftaTTFANTFKKLHARGIHPVVLYPAVNVYQFDKPHSSMAAYKPVIACDSGGPVETIKNEVVGFLCNPTPQEFSLSMAKLIQEPQMAKKMGENARHHVMESFSTKIFGQHLNRLLAYVARGKED

MADVILVNSkftattfantfkkLHARGIHPVVLYPAVNVYQFDKPHSSMAAYKPVIACDSGGPVETIKNEVVGFLCNPTPQEFSLSMAKLIQEPQMAKKMGENARHHVMESFSTKIFGQHLNRLLAYVARGKED

***VILVNSKFTATTFANTFKKLHARGIHPVVLYPAVNVYQFDKPHSSMAAYKPVIACDSGGPVETIKNEVVGFLCNPTPQEF************************VMESFSTKIFGQHLNRLLAYVA*****

MADVILVNSKFTATTFANTFKKLHARGIHPVVLYPAVNVYQFDKPHSSMAAYKPVIACDSGGPVETIKNEVVGFLCNPTPQEFSLSMAKLIQEPQMAKKMGENARHHVMESFSTKIFGQHLNRLLA*VAR****

MADVILVNSKFTATTFANTFKKLHARGIHPVVLYPAVNVYQFDKPHSSMAAYKPVIACDSGGPVETIKNEVVGFLCNPTPQEFSLSMAKLIQEPQMAKKMGENARHHVMESFSTKIFGQHLNRLLAYVARGKED

*ADVILVNSKFTATTFANTFKKLHARGIHPVVLYPAVNVYQFDKPHSSMAAYKPVIACDSGGPVETIKNEVVGFLCNPTPQEFSLSMAKLIQEPQMAKKMGENARHHVMESFSTKIFGQHLNRLLAYVAR****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MADVILVNSKFTATTFANTFKKLHARGIHPVVLYPAVNVYQFDKPHSSMAAYKPVIACDSGGPVETIKNEVVGFLCNPTPQEFSLSMAKLIQEPQMAKKMGENARHHVMESFSTKIFGQHLNRLLAYVARGKED

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		134	2.2.26 [Sep-21-2011]
Q7KWM5		420	Alpha-1,3/1,6-mannosyltra	yes	no	0.582	0.185	0.444	2e-14
Q9H553		416	Alpha-1,3/1,6-mannosyltra	yes	no	0.671	0.216	0.423	8e-14
Q9DBE8		415	Alpha-1,3/1,6-mannosyltra	yes	no	0.656	0.212	0.4	2e-11
O94738		455	Alpha-1,3/1,6-mannosyltra	N/A	no	0.686	0.202	0.347	2e-09
O34413		407	Putative glycosyltransfer	yes	no	0.611	0.201	0.292	0.0001
Q59LF2		428	Alpha-1,3/1,6-mannosyltra	N/A	no	0.604	0.189	0.325	0.0003
Q6CWQ0		503	Alpha-1,3/1,6-mannosyltra	yes	no	0.283	0.075	0.536	0.0008

>sp\|Q7KWM5\|ALG2_DICDI Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Dictyostelium discoideum GN=alg2 PE=3 SV=1	Back alignment and function desciption

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 54/81 (66%)

Query: 45  PHSSMAAYKPVIACDSGGPVETIKNEVVGFLCNPTPQEFSLSMAKLIQEPQMAKKMGENA 104
           P   M A KPVIA ++GGP+ET+ +   G+LCNPT ++F+ +  K+I +P  +KKMG N 
Sbjct: 337 PLEGMYAGKPVIAVNNGGPLETVVDGKTGYLCNPTVKDFANAFNKIINDPINSKKMGING 396

Query: 105 RHHVMESFSTKIFGQHLNRLL 125
           +  V + FS K F Q+LN ++
Sbjct: 397 KQRVNDKFSFKPFAQNLNTIV 417

Mannosylates Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate.
Dictyostelium discoideum (taxid: 44689)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 2EC: 5EC: 7

>sp\|Q9H553\|ALG2_HUMAN Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Homo sapiens GN=ALG2 PE=1 SV=1	Back alignment and function description

>sp\|Q9DBE8\|ALG2_MOUSE Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Mus musculus GN=Alg2 PE=2 SV=2	Back alignment and function description

>sp\|O94738\|ALG2_RHIPU Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Rhizomucor pusillus GN=ALG2 PE=1 SV=1	Back alignment and function description

>sp\|O34413\|YTCC_BACSU Putative glycosyltransferase YtcC OS=Bacillus subtilis (strain 168) GN=ytcC PE=3 SV=1	Back alignment and function description

>sp\|Q59LF2\|ALG2_CANAL Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALG2 PE=3 SV=1	Back alignment and function description

>sp\|Q6CWQ0\|ALG2_KLULA Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ALG2 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		134
359807347		407	uncharacterized protein LOC100809168 [Gl	0.671	0.221	0.733	1e-32
356549651		407	PREDICTED: alpha-1,3/1,6-mannosyltransfe	0.671	0.221	0.722	2e-31
255569305		408	alpha-1,3-mannosyltransferase, putative	0.671	0.220	0.677	2e-30
357444311		418	Alpha-1,3-mannosyltransferase ALG2 [Medi	0.768	0.246	0.650	4e-30
224117020		413	predicted protein [Populus trichocarpa]	0.671	0.217	0.666	2e-29
449524204		260	PREDICTED: alpha-1,3/1,6-mannosyltransfe	0.656	0.338	0.622	1e-26
449438921		407	PREDICTED: alpha-1,3/1,6-mannosyltransfe	0.656	0.216	0.611	2e-26
449438699		473	PREDICTED: LOW QUALITY PROTEIN: alpha-1,	0.955	0.270	0.484	3e-26
225461697		408	PREDICTED: alpha-1,3/1,6-mannosyltransfe	0.671	0.220	0.622	1e-25
302142886		396	unnamed protein product [Vitis vinifera]	0.671	0.227	0.622	1e-25

>gi\|359807347\|ref\|NP_001241379.1\| uncharacterized protein LOC100809168 [Glycine max] gi\|255642391\|gb\|ACU21459.1\| unknown [Glycine max]	Back alignment and taxonomy information

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 75/90 (83%)

Query: 45  PHSSMAAYKPVIACDSGGPVETIKNEVVGFLCNPTPQEFSLSMAKLIQEPQMAKKMGENA 104
           P  +MAAYKPVIAC+SGGPVE+IKN V GFLC+PTPQEFSL+MAKLI +PQ A++MG  A
Sbjct: 318 PLEAMAAYKPVIACNSGGPVESIKNGVTGFLCDPTPQEFSLAMAKLINDPQEAERMGREA 377

Query: 105 RHHVMESFSTKIFGQHLNRLLAYVARGKED 134
           R HV ESFSTK FGQHLNR L  + RGKED
Sbjct: 378 RRHVAESFSTKSFGQHLNRYLVDIHRGKED 407

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356549651\|ref\|XP_003543205.1\| PREDICTED: alpha-1,3/1,6-mannosyltransferase ALG2-like [Glycine max]	Back alignment and taxonomy information

>gi\|255569305\|ref\|XP_002525620.1\| alpha-1,3-mannosyltransferase, putative [Ricinus communis] gi\|223535056\|gb\|EEF36738.1\| alpha-1,3-mannosyltransferase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|357444311\|ref\|XP_003592433.1\| Alpha-1,3-mannosyltransferase ALG2 [Medicago truncatula] gi\|355481481\|gb\|AES62684.1\| Alpha-1,3-mannosyltransferase ALG2 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|224117020\|ref\|XP_002317454.1\| predicted protein [Populus trichocarpa] gi\|222860519\|gb\|EEE98066.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449524204\|ref\|XP_004169113.1\| PREDICTED: alpha-1,3/1,6-mannosyltransferase ALG2-like, partial [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449438921\|ref\|XP_004137236.1\| PREDICTED: alpha-1,3/1,6-mannosyltransferase ALG2-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449438699\|ref\|XP_004137125.1\| PREDICTED: LOW QUALITY PROTEIN: alpha-1,3/1,6-mannosyltransferase ALG2-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|225461697\|ref\|XP_002285480.1\| PREDICTED: alpha-1,3/1,6-mannosyltransferase ALG2-like isoform 1 [Vitis vinifera] gi\|359493768\|ref\|XP_003634662.1\| PREDICTED: alpha-1,3/1,6-mannosyltransferase ALG2-like isoform 2 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|302142886\|emb\|CBI20181.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		134
TAIR\|locus:2037608		403	AT1G78800 [Arabidopsis thalian	0.768	0.255	0.557	2.5e-26
UNIPROTKB\|F1NWX1		398	ALG2 "Uncharacterized protein"	0.716	0.241	0.404	2.7e-18
DICTYBASE\|DDB_G0272730		420	alg2 "alpha-1,3-mannosyltransf	0.604	0.192	0.444	2.9e-18
UNIPROTKB\|A4FUG6		416	ALG2 "ALG2 protein" [Bos tauru	0.671	0.216	0.411	8.7e-18
UNIPROTKB\|Q9H553		416	ALG2 "Alpha-1,3/1,6-mannosyltr	0.686	0.221	0.423	3e-17
UNIPROTKB\|G3V6U3		415	Alg2 "Asparagine-linked glycos	0.671	0.216	0.411	2.9e-16
UNIPROTKB\|F6X6I6		416	ALG2 "Uncharacterized protein"	0.671	0.216	0.411	3.8e-16
UNIPROTKB\|E2R622		417	ALG2 "Uncharacterized protein"	0.671	0.215	0.411	3.8e-16
MGI\|MGI:1914731		415	Alg2 "asparagine-linked glycos	0.671	0.216	0.4	6.1e-16
UNIPROTKB\|F1SSE6		416	ALG2 "Uncharacterized protein"	0.671	0.216	0.422	1.9e-15

TAIR\|locus:2037608 AT1G78800 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 297 (109.6 bits), Expect = 2.5e-26, P = 2.5e-26
 Identities = 58/104 (55%), Positives = 76/104 (73%)

Query:    32 VLYPAVNVYQFDKPHSSMAAYKPVIACDSGGPVETIKNEVVGFLCNPTPQEFSLSMAKLI 91
             VLY   + +    P  +MAAYKPVIAC+SGGPVET+KN V G+LC PTP++FS +MA+ I
Sbjct:   300 VLYTPTDEHFGIVPLEAMAAYKPVIACNSGGPVETVKNGVTGYLCEPTPEDFSSAMARFI 359

Query:    92 QEPQMAKKMGENARHHVMESFSTKIFGQHLNRLLA-YVARGKED 134
             + P++A +MG  AR+HV+ESFS K FGQ LN+ L   V+  KED
Sbjct:   360 ENPELANRMGAEARNHVVESFSVKTFGQKLNQYLVDVVSSPKED 403

GO:0009058 "biosynthetic process" evidence=IEA

GO:0016757 "transferase activity, transferring glycosyl groups" evidence=ISS

UNIPROTKB\|F1NWX1 ALG2 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0272730 alg2 "alpha-1,3-mannosyltransferase" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|A4FUG6 ALG2 "ALG2 protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9H553 ALG2 "Alpha-1,3/1,6-mannosyltransferase ALG2" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|G3V6U3 Alg2 "Asparagine-linked glycosylation 2 homolog (Yeast, alpha-1,3-mannosyltransferase), isoform CRA_a" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F6X6I6 ALG2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|E2R622 ALG2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

MGI\|MGI:1914731 Alg2 "asparagine-linked glycosylation 2 (alpha-1,3-mannosyltransferase)" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|F1SSE6 ALG2 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		134
cd03805		392	cd03805, GT1_ALG2_like, This family is most closel	8e-27
cd03808		359	cd03808, GT1_cap1E_like, This family is most close	3e-13
cd03801		374	cd03801, GT1_YqgM_like, This family is most closel	1e-12
COG0438		381	COG0438, RfaG, Glycosyltransferase [Cell envelope	5e-12
cd03805		392	cd03805, GT1_ALG2_like, This family is most closel	1e-11
cd03798		377	cd03798, GT1_wlbH_like, This family is most closel	2e-11
cd03792		372	cd03792, GT1_Trehalose_phosphorylase, Trehalose ph	6e-11
cd03800		398	cd03800, GT1_Sucrose_synthase, This family is most	2e-10
pfam00534		158	pfam00534, Glycos_transf_1, Glycosyl transferases	4e-10
cd03794		394	cd03794, GT1_wbuB_like, This family is most closel	6e-10
cd03814		364	cd03814, GT1_like_2, This family is most closely r	4e-09
cd03795		357	cd03795, GT1_like_4, This family is most closely r	4e-09
TIGR02149		388	TIGR02149, glgA_Coryne, glycogen synthase, Coryneb	7e-08
cd03799		355	cd03799, GT1_amsK_like, This is a family of GT1 gl	1e-07
cd03807		365	cd03807, GT1_WbnK_like, This family is most closel	1e-07
cd03823		359	cd03823, GT1_ExpE7_like, This family is most close	4e-07
TIGR03999		374	TIGR03999, thiol_BshA, N-acetyl-alpha-D-glucosamin	4e-07
cd03825		365	cd03825, GT1_wcfI_like, This family is most closel	5e-07
cd03811		353	cd03811, GT1_WabH_like, This family is most closel	5e-07
cd04962		371	cd04962, GT1_like_5, This family is most closely r	1e-06
cd03821		375	cd03821, GT1_Bme6_like, This family is most closel	2e-06
cd03820		348	cd03820, GT1_amsD_like, This family is most closel	2e-06
cd03806		419	cd03806, GT1_ALG11_like, This family is most close	9e-06
cd03804		351	cd03804, GT1_wbaZ_like, This family is most closel	1e-05
cd03817		374	cd03817, GT1_UGDG_like, This family is most closel	1e-05
cd04946		407	cd04946, GT1_AmsK_like, This family is most closel	2e-05
TIGR04157		406	TIGR04157, glyco_rSAM_CFB, glycosyltransferase, GG	2e-05
cd05844		367	cd05844, GT1_like_7, Glycosyltransferases catalyze	4e-05
TIGR03087		397	TIGR03087, stp1, sugar transferase, PEP-CTERM/EpsH	9e-05
TIGR04063		397	TIGR04063, stp3, PEP-CTERM/exosortase A-associated	2e-04
cd03819		355	cd03819, GT1_WavL_like, This family is most closel	4e-04
TIGR03088		374	TIGR03088, stp2, sugar transferase, PEP-CTERM/EpsH	0.001
TIGR02470		784	TIGR02470, sucr_synth, sucrose synthase	0.002

>gnl\|CDD\|99977 cd03805, GT1_ALG2_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

 Score =  102 bits (256), Expect = 8e-27
 Identities = 38/73 (52%), Positives = 50/73 (68%)

Query: 49  MAAYKPVIACDSGGPVETIKNEVVGFLCNPTPQEFSLSMAKLIQEPQMAKKMGENARHHV 108
           M A KPVIAC+SGGP+ET+ +   GFLC PTP+EF+ +M KL  +P +A +MG   R  V
Sbjct: 320 MYAGKPVIACNSGGPLETVVDGETGFLCEPTPEEFAEAMLKLANDPDLADRMGAAGRKRV 379

Query: 109 MESFSTKIFGQHL 121
            E FST+ F + L
Sbjct: 380 KEKFSTEAFAERL 392

ALG2, a 1,3-mannosyltransferase, in yeast catalyzes the mannosylation of Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. A deficiency of this enzyme causes an abnormal accumulation of Man1GlcNAc2-PP-dolichol and Man2GlcNAc2-PP-dolichol, which is associated with a type of congenital disorders of glycosylation (CDG), designated CDG-Ii, in humans. Length = 392

>gnl\|CDD\|99980 cd03808, GT1_cap1E_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|99974 cd03801, GT1_YqgM_like, This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known	Back alignment and domain information

>gnl\|CDD\|223515 COG0438, RfaG, Glycosyltransferase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|99977 cd03805, GT1_ALG2_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|99971 cd03798, GT1_wlbH_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|99966 cd03792, GT1_Trehalose_phosphorylase, Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose	Back alignment and domain information

>gnl\|CDD\|99973 cd03800, GT1_Sucrose_synthase, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|215979 pfam00534, Glycos_transf_1, Glycosyl transferases group 1	Back alignment and domain information

>gnl\|CDD\|99968 cd03794, GT1_wbuB_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|99985 cd03814, GT1_like_2, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|99969 cd03795, GT1_like_4, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|233748 TIGR02149, glgA_Coryne, glycogen synthase, Corynebacterium family	Back alignment and domain information

>gnl\|CDD\|99972 cd03799, GT1_amsK_like, This is a family of GT1 glycosyltransferases found specifically in certain bacteria	Back alignment and domain information

>gnl\|CDD\|99979 cd03807, GT1_WbnK_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|99993 cd03823, GT1_ExpE7_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|234438 TIGR03999, thiol_BshA, N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA	Back alignment and domain information

>gnl\|CDD\|99994 cd03825, GT1_wcfI_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|99982 cd03811, GT1_WabH_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|100002 cd04962, GT1_like_5, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|99991 cd03821, GT1_Bme6_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|99990 cd03820, GT1_amsD_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|99978 cd03806, GT1_ALG11_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|99976 cd03804, GT1_wbaZ_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|99987 cd03817, GT1_UGDG_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|99997 cd04946, GT1_AmsK_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|234487 TIGR04157, glyco_rSAM_CFB, glycosyltransferase, GG-Bacteroidales peptide system	Back alignment and domain information

>gnl\|CDD\|100003 cd05844, GT1_like_7, Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds	Back alignment and domain information

>gnl\|CDD\|234105 TIGR03087, stp1, sugar transferase, PEP-CTERM/EpsH1 system associated	Back alignment and domain information

>gnl\|CDD\|234452 TIGR04063, stp3, PEP-CTERM/exosortase A-associated glycosyltransferase, Daro_2409 family	Back alignment and domain information

>gnl\|CDD\|99989 cd03819, GT1_WavL_like, This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>gnl\|CDD\|132132 TIGR03088, stp2, sugar transferase, PEP-CTERM/EpsH1 system associated	Back alignment and domain information

>gnl\|CDD\|233881 TIGR02470, sucr_synth, sucrose synthase	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		134
PRK15427		406	colanic acid biosynthesis glycosyltransferase WcaL	99.87
TIGR03088		374	stp2 sugar transferase, PEP-CTERM/EpsH1 system ass	99.86
cd03813		475	GT1_like_3 This family is most closely related to	99.83
TIGR02470		784	sucr_synth sucrose synthase. This model represents	99.82
TIGR03449		405	mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino	99.81
cd04962		371	GT1_like_5 This family is most closely related to	99.81
KOG0853		495	consensus Glycosyltransferase [Cell wall/membrane/	99.81
TIGR02472		439	sucr_P_syn_N sucrose-phosphate synthase, putative,	99.81
PLN00142		815	sucrose synthase	99.81
TIGR02468		1050	sucrsPsyn_pln sucrose phosphate synthase/possible	99.81
PLN02949		463	transferase, transferring glycosyl groups	99.8
PRK15490		578	Vi polysaccharide biosynthesis protein TviE; Provi	99.8
TIGR02918		500	accessory Sec system glycosylation protein GtfA. M	99.8
TIGR02149		388	glgA_Coryne glycogen synthase, Corynebacterium fam	99.79
cd03805		392	GT1_ALG2_like This family is most closely related	99.79
cd04946		407	GT1_AmsK_like This family is most closely related	99.79
PRK15484		380	lipopolysaccharide 1,2-N-acetylglucosaminetransfer	99.78
cd05844		367	GT1_like_7 Glycosyltransferases catalyze the trans	99.78
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	99.78
cd03818		396	GT1_ExpC_like This family is most closely related	99.78
cd03796		398	GT1_PIG-A_like This family is most closely related	99.78
PRK10307		412	putative glycosyl transferase; Provisional	99.77
PLN02871		465	UDP-sulfoquinovose:DAG sulfoquinovosyltransferase	99.77
cd03825		365	GT1_wcfI_like This family is most closely related	99.75
cd03792		372	GT1_Trehalose_phosphorylase Trehalose phosphorylas	99.74
cd03807		365	GT1_WbnK_like This family is most closely related	99.72
cd03800		398	GT1_Sucrose_synthase This family is most closely r	99.72
PLN02939		977	transferase, transferring glycosyl groups	99.72
PHA01630		331	putative group 1 glycosyl transferase	99.72
cd04949		372	GT1_gtfA_like This family is most closely related	99.71
PRK09922		359	UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D	99.71
PRK00654		466	glgA glycogen synthase; Provisional	99.71
PLN02316		1036	synthase/transferase	99.7
cd04955		363	GT1_like_6 This family is most closely related to	99.7
PRK14099		485	glycogen synthase; Provisional	99.7
TIGR02095		473	glgA glycogen/starch synthases, ADP-glucose type.	99.7
cd03814		364	GT1_like_2 This family is most closely related to	99.69
cd03799		355	GT1_amsK_like This is a family of GT1 glycosyltran	99.69
PRK10125		405	putative glycosyl transferase; Provisional	99.69
cd03822		366	GT1_ecORF704_like This family is most closely rela	99.68
cd03795		357	GT1_like_4 This family is most closely related to	99.68
cd03806		419	GT1_ALG11_like This family is most closely related	99.68
cd03821		375	GT1_Bme6_like This family is most closely related	99.68
cd04951		360	GT1_WbdM_like This family is most closely related	99.68
cd03808		359	GT1_cap1E_like This family is most closely related	99.68
cd03801		374	GT1_YqgM_like This family is most closely related	99.67
PF13524		92	Glyco_trans_1_2: Glycosyl transferases group 1	99.67
cd03816		415	GT1_ALG1_like This family is most closely related	99.66
cd03819		355	GT1_WavL_like This family is most closely related	99.66
cd03820		348	GT1_amsD_like This family is most closely related	99.66
cd03802		335	GT1_AviGT4_like This family is most closely relate	99.66
TIGR03087		397	stp1 sugar transferase, PEP-CTERM/EpsH1 system ass	99.63
PRK14098		489	glycogen synthase; Provisional	99.63
cd03791		476	GT1_Glycogen_synthase_DULL1_like This family is mo	99.62
cd03794		394	GT1_wbuB_like This family is most closely related	99.6
cd03798		377	GT1_wlbH_like This family is most closely related	99.6
cd03809		365	GT1_mtfB_like This family is most closely related	99.59
cd03823		359	GT1_ExpE7_like This family is most closely related	99.57
cd03817		374	GT1_UGDG_like This family is most closely related	99.56
cd03804		351	GT1_wbaZ_like This family is most closely related	99.54
PF00534		172	Glycos_transf_1: Glycosyl transferases group 1; In	99.54
PHA01633		335	putative glycosyl transferase group 1	99.53
PLN02846		462	digalactosyldiacylglycerol synthase	99.51
cd03811		353	GT1_WabH_like This family is most closely related	99.48
cd03812		358	GT1_CapH_like This family is most closely related	99.45
cd03793		590	GT1_Glycogen_synthase_GSY2_like Glycogen synthase,	99.43
KOG1111		426	consensus N-acetylglucosaminyltransferase complex,	99.41
PLN02501		794	digalactosyldiacylglycerol synthase	99.39
cd03788		460	GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a	99.37
TIGR02400		456	trehalose_OtsA alpha,alpha-trehalose-phosphate syn	99.34
PRK05749		425	3-deoxy-D-manno-octulosonic-acid transferase; Revi	99.34
COG0438		381	RfaG Glycosyltransferase [Cell envelope biogenesis	99.3
PLN02275		371	transferase, transferring glycosyl groups	99.29
PLN03063		797	alpha,alpha-trehalose-phosphate synthase (UDP-form	99.21
TIGR03713		519	acc_sec_asp1 accessory Sec system protein Asp1. Th	99.2
PRK00726		357	murG undecaprenyldiphospho-muramoylpentapeptide be	99.16
TIGR01133		348	murG undecaprenyldiphospho-muramoylpentapeptide be	99.13
PLN02605		382	monogalactosyldiacylglycerol synthase	99.12
PRK13608		391	diacylglycerol glucosyltransferase; Provisional	99.08
PRK13609		380	diacylglycerol glucosyltransferase; Provisional	99.06
PRK14501		726	putative bifunctional trehalose-6-phosphate syntha	99.05
cd03785		350	GT1_MurG MurG is an N-acetylglucosaminyltransferas	99.02
COG0297		487	GlgA Glycogen synthase [Carbohydrate transport and	98.95
KOG1387		465	consensus Glycosyltransferase [Cell wall/membrane/	98.91
cd04950		373	GT1_like_1 Glycosyltransferases catalyze the trans	98.9
PRK09814		333	beta-1,6-galactofuranosyltransferase; Provisional	98.9
TIGR00236		365	wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras	98.59
PRK00025		380	lpxB lipid-A-disaccharide synthase; Reviewed	98.58
KOG2941		444	consensus Beta-1,4-mannosyltransferase [Posttransl	98.56
PLN03064		934	alpha,alpha-trehalose-phosphate synthase (UDP-form	98.5
PF13692		135	Glyco_trans_1_4: Glycosyl transferases group 1; PD	98.46
PF05693		633	Glycogen_syn: Glycogen synthase; InterPro: IPR0086	98.32
TIGR02398		487	gluc_glyc_Psyn glucosylglycerol-phosphate synthase	98.32
cd01635		229	Glycosyltransferase_GTB_type Glycosyltransferases	98.28
COG4641		373	Uncharacterized protein conserved in bacteria [Fun	98.2
TIGR02919		438	accessory Sec system glycosyltransferase GtfB. Mem	98.2
cd03786		363	GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th	98.13
TIGR02094		601	more_P_ylases alpha-glucan phosphorylases. This fa	98.05
PF13844		468	Glyco_transf_41: Glycosyl transferase family 41; P	97.73
PF00982		474	Glyco_transf_20: Glycosyltransferase family 20; In	97.34
COG1519		419	KdtA 3-deoxy-D-manno-octulosonic-acid transferase	97.29
PRK10117		474	trehalose-6-phosphate synthase; Provisional	97.19
cd04299		778	GT1_Glycogen_Phosphorylase_like This family is mos	96.89
TIGR01426		392	MGT glycosyltransferase, MGT family. This model de	96.86
TIGR00215		385	lpxB lipid-A-disaccharide synthase. Lipid-A precur	96.53
TIGR03492		396	conserved hypothetical protein. This protein famil	96.5
PLN02205		854	alpha,alpha-trehalose-phosphate synthase [UDP-form	96.47
COG0381		383	WecB UDP-N-acetylglucosamine 2-epimerase [Cell env	96.17
PHA03392		507	egt ecdysteroid UDP-glucosyltransferase; Provision	96.16
COG1819		406	Glycosyl transferases, related to UDP-glucuronosyl	96.03
COG0707		357	MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami	95.9
COG0380		486	OtsA Trehalose-6-phosphate synthase [Carbohydrate	95.82
PLN02670		472	transferase, transferring glycosyl groups	95.54
TIGR03568		365	NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase,	95.49
PF00201		500	UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera	95.3
smart00672		256	CAP10 Putative lipopolysaccharide-modifying enzyme	95.23
COG3914		620	Spy Predicted O-linked N-acetylglucosamine transfe	95.16
PLN02410		451	UDP-glucoronosyl/UDP-glucosyl transferase family p	95.16
PLN02208		442	glycosyltransferase family protein	94.82
PF05686		395	Glyco_transf_90: Glycosyl transferase family 90; I	94.81
PLN02992		481	coniferyl-alcohol glucosyltransferase	94.65
cd03784		401	GT1_Gtf_like This family includes the Gtfs, a grou	94.44
PLN02210		456	UDP-glucosyl transferase	94.3
PLN02562		448	UDP-glycosyltransferase	94.03
PF02350		346	Epimerase_2: UDP-N-acetylglucosamine 2-epimerase;	93.76
PLN03004		451	UDP-glycosyltransferase	93.67
KOG3742		692	consensus Glycogen synthase [Carbohydrate transpor	93.27
PLN00414		446	glycosyltransferase family protein	93.27
PLN02448		459	UDP-glycosyltransferase family protein	93.23
PLN02554		481	UDP-glycosyltransferase family protein	93.15
PLN03007		482	UDP-glucosyltransferase family protein	93.0
PLN02152		455	indole-3-acetate beta-glucosyltransferase	92.74
PLN02167		475	UDP-glycosyltransferase family protein	92.62
PLN02764		453	glycosyltransferase family protein	92.35
PLN00164		480	glucosyltransferase; Provisional	91.71
PF15024		559	Glyco_transf_18: Glycosyltransferase family 18	91.7
PRK12446		352	undecaprenyldiphospho-muramoylpentapeptide beta-N-	91.57
PF04101		167	Glyco_tran_28_C: Glycosyltransferase family 28 C-t	91.43
PLN02173		449	UDP-glucosyl transferase family protein	91.13
PLN02207		468	UDP-glycosyltransferase	90.87
PLN02555		480	limonoid glucosyltransferase	90.8
PLN02863		477	UDP-glucoronosyl/UDP-glucosyl transferase family p	89.68
PLN03015		470	UDP-glucosyl transferase	85.46
PRK02797		322	4-alpha-L-fucosyltransferase; Provisional	85.2
KOG4626		966	consensus O-linked N-acetylglucosamine transferase	83.25
PRK10017		426	colanic acid biosynthesis protein; Provisional	82.97
COG0058		750	GlgP Glucan phosphorylase [Carbohydrate transport	82.32
PF04464		369	Glyphos_transf: CDP-Glycerol:Poly(glycerophosphate	81.99
PF13528		318	Glyco_trans_1_3: Glycosyl transferase family 1	81.16

>PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional	Back alignment and domain information

Probab=99.87  E-value=3.9e-21  Score=138.05  Aligned_cols=122  Identities=18%  Similarity=0.199  Sum_probs=104.9

Q ss_pred             ceEeecCccchhhHHHHHHHHHHcCCCCeEEeccc-----------cccccC----------------CchhhhhcCCCE
Q 043097            3 DVILVNSKFTATTFANTFKKLHARGIHPVVLYPAV-----------NVYQFD----------------KPHSSMAAYKPV   55 (134)
Q Consensus         3 ~~v~~~s~~~~~~~~~~~~~~~~~~~~~~v~~~g~-----------~~~~~~----------------~~~eAma~G~pv   55 (134)
                      .+++++.+-   ..+++.+.+.++++++.|.|+|.           ..|.|.                .+.|||+||+||
T Consensus       255 ~l~ivG~G~---~~~~l~~~~~~~~l~~~V~~~G~~~~~el~~~l~~aDv~v~pS~~~~~g~~Eg~p~~llEAma~G~PV  331 (406)
T PRK15427        255 RYRILGIGP---WERRLRTLIEQYQLEDVVEMPGFKPSHEVKAMLDDADVFLLPSVTGADGDMEGIPVALMEAMAVGIPV  331 (406)
T ss_pred             EEEEEECch---hHHHHHHHHHHcCCCCeEEEeCCCCHHHHHHHHHhCCEEEECCccCCCCCccCccHHHHHHHhCCCCE
Confidence            456666542   34568888888999999999985           122222                356899999999


Q ss_pred             EeccCCCcccceeeCceEEEecC-CHHHHHHHHHHHhc-CHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHH
Q 043097           56 IACDSGGPVETIKNEVVGFLCNP-TPQEFSLSMAKLIQ-EPQMAKKMGENARHHVMESFSTKIFGQHLNRLLAY  127 (134)
Q Consensus        56 i~s~~~~~~e~i~~~~~g~~~~~-~~~~l~~~i~~~~~-~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~  127 (134)
                      |+|+.++.+|++.++.+|+++++ |+++++++|.+++. |++.+.+|++++++++.++|+|+.+.+++.++|++
T Consensus       332 I~t~~~g~~E~v~~~~~G~lv~~~d~~~la~ai~~l~~~d~~~~~~~~~~ar~~v~~~f~~~~~~~~l~~~~~~  405 (406)
T PRK15427        332 VSTLHSGIPELVEADKSGWLVPENDAQALAQRLAAFSQLDTDELAPVVKRAREKVETDFNQQVINRELASLLQA  405 (406)
T ss_pred             EEeCCCCchhhhcCCCceEEeCCCCHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHhh
Confidence            99999999999999999999998 99999999999999 99999999999999999999999999999999976

>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated	Back alignment and domain information

>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>TIGR02470 sucr_synth sucrose synthase	Back alignment and domain information

>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase	Back alignment and domain information

>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>KOG0853 consensus Glycosyltransferase [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain	Back alignment and domain information

>PLN00142 sucrose synthase	Back alignment and domain information

>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant	Back alignment and domain information

>PLN02949 transferase, transferring glycosyl groups	Back alignment and domain information

>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>TIGR02918 accessory Sec system glycosylation protein GtfA	Back alignment and domain information

>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family	Back alignment and domain information

>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional	Back alignment and domain information

>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>PRK10307 putative glycosyl transferase; Provisional	Back alignment and domain information

>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase	Back alignment and domain information

>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose	Back alignment and domain information

>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>PLN02939 transferase, transferring glycosyl groups	Back alignment and domain information

>PHA01630 putative group 1 glycosyl transferase	Back alignment and domain information

>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding	Back alignment and domain information

>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional	Back alignment and domain information

>PRK00654 glgA glycogen synthase; Provisional	Back alignment and domain information

>PLN02316 synthase/transferase	Back alignment and domain information

>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>PRK14099 glycogen synthase; Provisional	Back alignment and domain information

>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type	Back alignment and domain information

>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria	Back alignment and domain information

>PRK10125 putative glycosyl transferase; Provisional	Back alignment and domain information

>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli	Back alignment and domain information

>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known	Back alignment and domain information

>PF13524 Glyco_trans_1_2: Glycosyl transferases group 1	Back alignment and domain information

>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated	Back alignment and domain information

>PRK14098 glycogen synthase; Provisional	Back alignment and domain information

>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases	Back alignment and domain information

>PHA01633 putative glycosyl transferase group 1	Back alignment and domain information

>PLN02846 digalactosyldiacylglycerol synthase	Back alignment and domain information

>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03793 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, which is most closely related to the GT1 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis	Back alignment and domain information

>KOG1111 consensus N-acetylglucosaminyltransferase complex, subunit PIG-A/SPT14, required for phosphatidylinositol biosynthesis/Sulfolipid synthase [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Lipid transport and metabolism]	Back alignment and domain information

>PLN02501 digalactosyldiacylglycerol synthase	Back alignment and domain information

>cd03788 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor	Back alignment and domain information

>TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming]	Back alignment and domain information

>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed	Back alignment and domain information

>COG0438 RfaG Glycosyltransferase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PLN02275 transferase, transferring glycosyl groups	Back alignment and domain information

>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional	Back alignment and domain information

>TIGR03713 acc_sec_asp1 accessory Sec system protein Asp1	Back alignment and domain information

>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional	Back alignment and domain information

>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	Back alignment and domain information

>PLN02605 monogalactosyldiacylglycerol synthase	Back alignment and domain information

>PRK13608 diacylglycerol glucosyltransferase; Provisional	Back alignment and domain information

>PRK13609 diacylglycerol glucosyltransferase; Provisional	Back alignment and domain information

>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional	Back alignment and domain information

>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis	Back alignment and domain information

>COG0297 GlgA Glycogen synthase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG1387 consensus Glycosyltransferase [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds	Back alignment and domain information

>PRK09814 beta-1,6-galactofuranosyltransferase; Provisional	Back alignment and domain information

>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase	Back alignment and domain information

>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed	Back alignment and domain information

>KOG2941 consensus Beta-1,4-mannosyltransferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional	Back alignment and domain information

>PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A	Back alignment and domain information

>PF05693 Glycogen_syn: Glycogen synthase; InterPro: IPR008631 This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3	Back alignment and domain information

>TIGR02398 gluc_glyc_Psyn glucosylglycerol-phosphate synthase	Back alignment and domain information

>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds	Back alignment and domain information

>COG4641 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>TIGR02919 accessory Sec system glycosyltransferase GtfB	Back alignment and domain information

>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc)	Back alignment and domain information

>TIGR02094 more_P_ylases alpha-glucan phosphorylases	Back alignment and domain information

>PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A	Back alignment and domain information

>PF00982 Glyco_transf_20: Glycosyltransferase family 20; InterPro: IPR001830 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases	Back alignment and domain information

>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK10117 trehalose-6-phosphate synthase; Provisional	Back alignment and domain information

>cd04299 GT1_Glycogen_Phosphorylase_like This family is most closely related to the oligosaccharide phosphorylase domain family and other unidentified sequences	Back alignment and domain information

>TIGR01426 MGT glycosyltransferase, MGT family	Back alignment and domain information

>TIGR00215 lpxB lipid-A-disaccharide synthase	Back alignment and domain information

>TIGR03492 conserved hypothetical protein	Back alignment and domain information

>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming]	Back alignment and domain information

>COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional	Back alignment and domain information

>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms]	Back alignment and domain information

>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>COG0380 OtsA Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PLN02670 transferase, transferring glycosyl groups	Back alignment and domain information

>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing	Back alignment and domain information

>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule	Back alignment and domain information

>smart00672 CAP10 Putative lipopolysaccharide-modifying enzyme	Back alignment and domain information

>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein	Back alignment and domain information

>PLN02208 glycosyltransferase family protein	Back alignment and domain information

>PF05686 Glyco_transf_90: Glycosyl transferase family 90; InterPro: IPR006598 Cryptococcus neoformans is a pathogenic fungus which most commonly affects the central nervous system and causes fatal meningoencephalitis primarily in patients with AIDS	Back alignment and domain information

>PLN02992 coniferyl-alcohol glucosyltransferase	Back alignment and domain information

>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin	Back alignment and domain information

>PLN02210 UDP-glucosyl transferase	Back alignment and domain information

>PLN02562 UDP-glycosyltransferase	Back alignment and domain information

>PF02350 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5	Back alignment and domain information

>PLN03004 UDP-glycosyltransferase	Back alignment and domain information

>KOG3742 consensus Glycogen synthase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PLN00414 glycosyltransferase family protein	Back alignment and domain information

>PLN02448 UDP-glycosyltransferase family protein	Back alignment and domain information

>PLN02554 UDP-glycosyltransferase family protein	Back alignment and domain information

>PLN03007 UDP-glucosyltransferase family protein	Back alignment and domain information

>PLN02152 indole-3-acetate beta-glucosyltransferase	Back alignment and domain information

>PLN02167 UDP-glycosyltransferase family protein	Back alignment and domain information

>PLN02764 glycosyltransferase family protein	Back alignment and domain information

>PLN00164 glucosyltransferase; Provisional	Back alignment and domain information

>PF15024 Glyco_transf_18: Glycosyltransferase family 18	Back alignment and domain information

>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed	Back alignment and domain information

>PF04101 Glyco_tran_28_C: Glycosyltransferase family 28 C-terminal domain; InterPro: IPR007235 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases	Back alignment and domain information

>PLN02173 UDP-glucosyl transferase family protein	Back alignment and domain information

>PLN02207 UDP-glycosyltransferase	Back alignment and domain information

>PLN02555 limonoid glucosyltransferase	Back alignment and domain information

>PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein	Back alignment and domain information

>PLN03015 UDP-glucosyl transferase	Back alignment and domain information

>PRK02797 4-alpha-L-fucosyltransferase; Provisional	Back alignment and domain information

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>PRK10017 colanic acid biosynthesis protein; Provisional	Back alignment and domain information

>COG0058 GlgP Glucan phosphorylase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF04464 Glyphos_transf: CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase ; InterPro: IPR007554 Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of Gram-positive bacteria	Back alignment and domain information

>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		134
2x6q_A		416	Trehalose-synthase TRET; biosynthetic protein; 2.2	3e-16
2jjm_A		394	Glycosyl transferase, group 1 family protein; anth	2e-15
2f9f_A		177	First mannosyl transferase (WBAZ-1); alpha-beta pr	2e-15
2r60_A		499	Glycosyl transferase, group 1; rossmann-fold; 1.80	6e-14
3s28_A		816	Sucrose synthase 1; glycosyltransferase, sucrose m	5e-13
3okp_A		394	GDP-mannose-dependent alpha-(1-6)-phosphatidylino	3e-12
3c48_A		438	Predicted glycosyltransferases; retaining glycosyl	1e-11
2iw1_A		374	Lipopolysaccharide core biosynthesis protein RFAG;	7e-11
2gek_A		406	Phosphatidylinositol mannosyltransferase (PIMA); G	3e-08
3qhp_A		166	Type 1 capsular polysaccharide biosynthesis prote	4e-08
3oy2_A		413	Glycosyltransferase B736L; rossmann fold, GDP-mann	2e-07
2x0d_A		413	WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge	2e-05

>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Length = 416	Back alignment and structure

 Score = 72.4 bits (178), Expect = 3e-16
 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 1/67 (1%)

Query: 49  MAAYKPVIACDSGGPVETIKNEVVGFLCNPTPQEFSLSMAKLIQEPQMAKKMGENARHHV 108
           M   KPVI    GG    I +   GFL      E    +  L++ P+++K+MG  A+  V
Sbjct: 336 MWKGKPVIGRAVGGIKFQIVDGETGFLVRD-ANEAVEVVLYLLKHPEVSKEMGAKAKERV 394

Query: 109 MESFSTK 115
            ++F   
Sbjct: 395 RKNFIIT 401

PyMOL of 2x6q

>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Length = 394	Back alignment and structure

>2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 Length = 177	Back alignment and structure

>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Length = 499	Back alignment and structure

>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* Length = 816	Back alignment and structure

>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Length = 394	Back alignment and structure

>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Length = 438	Back alignment and structure

>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Length = 374	Back alignment and structure

>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Length = 406	Back alignment and structure

>3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} Length = 166	Back alignment and structure

>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* Length = 413	Back alignment and structure

>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* Length = 413	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		134
2jjm_A		394	Glycosyl transferase, group 1 family protein; anth	99.83
3c48_A		438	Predicted glycosyltransferases; retaining glycosyl	99.81
2r60_A		499	Glycosyl transferase, group 1; rossmann-fold; 1.80	99.81
2x6q_A		416	Trehalose-synthase TRET; biosynthetic protein; 2.2	99.81
3oy2_A		413	Glycosyltransferase B736L; rossmann fold, GDP-mann	99.81
3s28_A		816	Sucrose synthase 1; glycosyltransferase, sucrose m	99.81
3fro_A		439	GLGA glycogen synthase; glycosyltransferase family	99.79
3okp_A		394	GDP-mannose-dependent alpha-(1-6)-phosphatidylino	99.78
1rzu_A		485	Glycogen synthase 1; glycosyl-transferase, GT-B fo	99.76
2qzs_A		485	Glycogen synthase; glycosyl-transferase, GT-B fold	99.74
2gek_A		406	Phosphatidylinositol mannosyltransferase (PIMA); G	99.73
2iw1_A		374	Lipopolysaccharide core biosynthesis protein RFAG;	99.73
3vue_A		536	GBSS-I, granule-bound starch synthase 1, chloropla	99.72
2iuy_A		342	Avigt4, glycosyltransferase; antibiotics, family G	99.7
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	99.68
3qhp_A		166	Type 1 capsular polysaccharide biosynthesis prote	99.64
3nb0_A		725	Glycogen [starch] synthase isoform 2; glycogen syn	99.6
2bfw_A		200	GLGA glycogen synthase; glycosyltransferase family	99.59
2x0d_A		413	WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge	99.58
1f0k_A		364	MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe	99.56
1vgv_A		384	UDP-N-acetylglucosamine 2-epimerase; structural ge	99.51
1uqt_A		482	Alpha, alpha-trehalose-phosphate synthase; glycosy	99.51
2f9f_A		177	First mannosyl transferase (WBAZ-1); alpha-beta pr	99.46
3beo_A		375	UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a	99.44
2xci_A		374	KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci	99.33
2hy7_A		406	Glucuronosyltransferase GUMK; glycosyltransferases	99.2
3t5t_A		496	Putative glycosyltransferase; GTB fold, pseudoglyc	99.13
3rhz_A		339	GTF3, nucleotide sugar synthetase-like protein; gl	99.05
1v4v_A		376	UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t	99.01
3otg_A		412	CALG1; calicheamicin, TDP, structural genomics, PS	98.89
2iyf_A		430	OLED, oleandomycin glycosyltransferase; antibiotic	98.65
3dzc_A		396	UDP-N-acetylglucosamine 2-epimerase; structural ge	98.58
3ot5_A		403	UDP-N-acetylglucosamine 2-epimerase; structural ge	98.54
4fzr_A		398	SSFS6; structural genomics, PSI-biology, protein s	98.46
3tsa_A		391	SPNG, NDP-rhamnosyltransferase; glycosyltransferas	98.46
3q3e_A		631	HMW1C-like glycosyltransferase; N-glycosylation; 2	98.41
3s2u_A		365	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape	98.37
3ia7_A		402	CALG4; glycosysltransferase, calicheamicin, enediy	98.3
2p6p_A		384	Glycosyl transferase; X-RAY-diffraction,urdamycina	98.23
3rsc_A		415	CALG2; TDP, enediyne, structural genomics, PSI-2,	98.21
3oti_A		398	CALG3; calicheamicin, TDP, structural genomics, PS	98.14
2yjn_A		441	ERYCIII, glycosyltransferase; transferase, cytochr	98.12
2o6l_A		170	UDP-glucuronosyltransferase 2B7; drug metabolism,	97.92
2iya_A		424	OLEI, oleandomycin glycosyltransferase; carbohydra	97.72
4hwg_A		385	UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc	97.59
1iir_A		415	Glycosyltransferase GTFB; rossmann fold; 1.80A {Am	97.58
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	97.38
4amg_A		400	Snogd; transferase, polyketide biosynthesis, GT1 f	97.25
1rrv_A		416	Glycosyltransferase GTFD; GT-B, glycosyltransferas	97.03
3h4t_A		404	Glycosyltransferase GTFA, glycosyltransferase; van	96.82
2c1x_A		456	UDP-glucose flavonoid 3-O glycosyltransferase; WIN	96.44
2pq6_A		482	UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl	95.5
3hbf_A		454	Flavonoid 3-O-glucosyltransferase; glycosyltransfe	94.31
2vch_A		480	Hydroquinone glucosyltransferase; glycosyltransfer	91.76
1l5w_A		796	Maltodextrin phosphorylase; enzymatic catalysis, s	89.2
2acv_A		463	Triterpene UDP-glucosyl transferase UGT71G1; glyco	88.74
2gj4_A		824	Glycogen phosphorylase, muscle form; transferase;	87.8
2c4m_A		796	Glycogen phosphorylase; allosteric control, phosph	81.02

>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A*	Back alignment and structure

Probab=99.83  E-value=3.9e-20  Score=130.57  Aligned_cols=126  Identities=22%  Similarity=0.329  Sum_probs=105.3

Q ss_pred             ceEeecCccchhhHHHHHHHHHHcCCCCeEEecccc---------ccccC----------CchhhhhcCCCEEeccCCCc
Q 043097            3 DVILVNSKFTATTFANTFKKLHARGIHPVVLYPAVN---------VYQFD----------KPHSSMAAYKPVIACDSGGP   63 (134)
Q Consensus         3 ~~v~~~s~~~~~~~~~~~~~~~~~~~~~~v~~~g~~---------~~~~~----------~~~eAma~G~pvi~s~~~~~   63 (134)
                      .+++++.+.   ...++.+.+.++++.+.|.|.|..         .+.+.          .+.|||+||+|||+|+.++.
T Consensus       243 ~l~i~G~g~---~~~~l~~~~~~~~l~~~v~~~g~~~~~~~~~~~adv~v~ps~~e~~~~~~~EAma~G~PvI~~~~~~~  319 (394)
T 2jjm_A          243 KLLLVGDGP---EFCTILQLVKNLHIEDRVLFLGKQDNVAELLAMSDLMLLLSEKESFGLVLLEAMACGVPCIGTRVGGI  319 (394)
T ss_dssp             EEEEECCCT---THHHHHHHHHTTTCGGGBCCCBSCSCTHHHHHTCSEEEECCSCCSCCHHHHHHHHTTCCEEEECCTTS
T ss_pred             EEEEECCch---HHHHHHHHHHHcCCCCeEEEeCchhhHHHHHHhCCEEEeccccCCCchHHHHHHhcCCCEEEecCCCh
Confidence            467777543   235577778877887788888752         12222          46689999999999999999


Q ss_pred             ccceeeCceEEEecC-CHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHhcC
Q 043097           64 VETIKNEVVGFLCNP-TPQEFSLSMAKLIQEPQMAKKMGENARHHVMESFSTKIFGQHLNRLLAYVARG  131 (134)
Q Consensus        64 ~e~i~~~~~g~~~~~-~~~~l~~~i~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~  131 (134)
                      .|++.++.+|+++++ |+++++++|.+++.+++.+.+|++++++.+.++|+|+.+++++.++|++++.+
T Consensus       320 ~e~v~~~~~g~~~~~~d~~~la~~i~~l~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~  388 (394)
T 2jjm_A          320 PEVIQHGDTGYLCEVGDTTGVADQAIQLLKDEELHRNMGERARESVYEQFRSEKIVSQYETIYYDVLRD  388 (394)
T ss_dssp             TTTCCBTTTEEEECTTCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHTC--
T ss_pred             HHHhhcCCceEEeCCCCHHHHHHHHHHHHcCHHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHhh
Confidence            999999889999998 99999999999999999999999999999988999999999999999998764

PyMOL of 2jjm

>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A*	Back alignment and structure

>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A*	Back alignment and structure

>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A*	Back alignment and structure

>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A*	Back alignment and structure

>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A*	Back alignment and structure

>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A*	Back alignment and structure

>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A*	Back alignment and structure

>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A	Back alignment and structure

>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A	Back alignment and structure

>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A*	Back alignment and structure

>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A*	Back alignment and structure

>3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A*	Back alignment and structure

>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A*	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori}	Back alignment and structure

>3nb0_A Glycogen [starch] synthase isoform 2; glycogen synthase, glucose-6-phosphate, yeast, allosteric AC transferase; HET: G6P; 2.41A {Saccharomyces cerevisiae} PDB: 3rt1_A* 3nch_A 3naz_A 3o3c_A* 3rsz_A*	Back alignment and structure

>2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8	Back alignment and structure

>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A*	Back alignment and structure

>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A*	Back alignment and structure

>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A*	Back alignment and structure

>1uqt_A Alpha, alpha-trehalose-phosphate synthase; glycosyltransferase, transferase; HET: U2F; 2.0A {Escherichia coli} SCOP: c.87.1.6 PDB: 1uqu_A* 2wtx_A* 1gz5_A*	Back alignment and structure

>2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8	Back alignment and structure

>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A	Back alignment and structure

>2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A*	Back alignment and structure

>2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A*	Back alignment and structure

>3t5t_A Putative glycosyltransferase; GTB fold, pseudoglycosyltransferase; 1.70A {Streptomyces hygroscopicus} PDB: 4f97_A* 4f96_B* 4f9f_A* 3t7d_A*	Back alignment and structure

>3rhz_A GTF3, nucleotide sugar synthetase-like protein; glycosyltransferase, transferase; HET: UDP; 1.90A {Streptococcus parasanguinis} PDB: 3qkw_A*	Back alignment and structure

>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3	Back alignment and structure

>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A*	Back alignment and structure

>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus}	Back alignment and structure

>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae}	Back alignment and structure

>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes}	Back alignment and structure

>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A*	Back alignment and structure

>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A*	Back alignment and structure

>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A	Back alignment and structure

>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa}	Back alignment and structure

>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora}	Back alignment and structure

>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae}	Back alignment and structure

>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A*	Back alignment and structure

>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A*	Back alignment and structure

>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea}	Back alignment and structure

>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens}	Back alignment and structure

>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus}	Back alignment and structure

>4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii}	Back alignment and structure

>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A*	Back alignment and structure

>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5	Back alignment and structure

>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} SCOP: c.87.1.5 PDB: 3h4i_A* 1pn3_A* 1pnv_A*	Back alignment and structure

>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A*	Back alignment and structure

>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10	Back alignment and structure

>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A*	Back alignment and structure

>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A*	Back alignment and structure

>1l5w_A Maltodextrin phosphorylase; enzymatic catalysis, substrate complex, trans; HET: GLC PLP; 1.80A {Escherichia coli} SCOP: c.87.1.4 PDB: 1l5v_A* 1l6i_A* 2asv_A* 2av6_A* 2aw3_A* 2azd_A* 1qm5_A* 1e4o_A* 2ecp_A* 1ahp_A*	Back alignment and structure

>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A*	Back alignment and structure

>2gj4_A Glycogen phosphorylase, muscle form; transferase; HET: PLR 2TH; 1.60A {Oryctolagus cuniculus} SCOP: c.87.1.4 PDB: 2gm9_A* 1abb_A* 3nc4_A* 3l79_A* 2pyd_A* 2pyi_A* 3l7a_A* 3l7b_A* 3l7c_A* 3l7d_A* 2qnb_A* 1c8l_A* 1axr_A* 1gpy_A* 1e1y_A* 1lwo_A* 1pyg_A* 1uzu_A* 1lwn_A* 1xkx_A* ...	Back alignment and structure

>2c4m_A Glycogen phosphorylase; allosteric control, phosphate dependence, starch degrading, transferase, glycosyltransferase; HET: PLP; 1.9A {Corynebacterium callunae}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		134
d2iw1a1		370	c.87.1.8 (A:2-371) Lipopolysaccharide core biosynt	3e-10
d2bisa1		437	c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyro	3e-08
d1rzua_		477	c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacte	5e-06
d2bfwa1		196	c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Py	4e-04

>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Length = 370	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: Glycosyl transferases group 1
domain: Lipopolysaccharide core biosynthesis protein RfaG
species: Escherichia coli [TaxId: 562]

 Score = 54.2 bits (128), Expect = 3e-10
 Identities = 12/89 (13%), Positives = 31/89 (34%), Gaps = 3/89 (3%)

Query: 40  YQFDKPHSSMAAYKPVIACDSGGPVETIKNEVVGFLCNP--TPQEFSLSMAKLIQEPQMA 97
                   ++ A  PV+     G    I +   G +     + ++ +  + K + +  + 
Sbjct: 281 AAGIVLLEAITAGLPVLTTAVCGYAHYIADANCGTVIAEPFSQEQLNEVLRKALTQSPLR 340

Query: 98  KKMGENARHHVMESFSTKIFGQHLNRLLA 126
               ENARH+  ++       +    ++ 
Sbjct: 341 MAWAENARHYA-DTQDLYSLPEKAADIIT 368

PyMOL of d2iw1a1

>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Length = 437	Back information, alignment and structure

>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Length = 477	Back information, alignment and structure

>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Length = 196	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		134
d1rzua_		477	Glycogen synthase 1, GlgA {Agrobacterium tumefacie	99.8
d2bisa1		437	Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI	99.78
d2iw1a1		370	Lipopolysaccharide core biosynthesis protein RfaG	99.76
d2bfwa1		196	Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI	99.57
d2f9fa1		166	First mannosyl transferase WbaZ {Archaeoglobus ful	99.46
d1uqta_		456	Trehalose-6-phosphate synthase, OtsA {Escherichia	99.41
d1pn3a_		391	TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi	97.07
d1iira_		401	UDP-glucosyltransferase GtfB {Amycolatopsis orient	96.82
d1f0ka_		351	Peptidoglycan biosynthesis glycosyltransferase Mur	96.55
d2pq6a1		473	(Iso)flavonoid glycosyltransferase {Medicago trunc	96.39
d1rrva_		401	TDP-vancosaminyltransferase GftD {Amycolatopsis or	96.33
d2c1xa1		450	UDP glucose:flavonoid 3-o-glucosyltransferase {Gra	95.45
d1v4va_		373	UDP-N-acetylglucosamine 2-epimerase {Thermus therm	94.27
d2acva1		461	Triterpene UDP-glucosyl transferase UGT71G1 {Medic	93.1
d1o6ca_		377	UDP-N-acetylglucosamine 2-epimerase {Bacillus subt	92.69
d2vcha1		471	Hydroquinone glucosyltransferase {Thale cress (Ara	92.41
d1f6da_		376	UDP-N-acetylglucosamine 2-epimerase {Escherichia c	85.02
d2nzwa1		349	Alpha1,3-fucosyltransferase FucT {Helicobacter pyl	84.37

>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: Glycosyl transferases group 1
domain: Glycogen synthase 1, GlgA
species: Agrobacterium tumefaciens [TaxId: 358]

Probab=99.80  E-value=6.1e-20  Score=131.11  Aligned_cols=98  Identities=11%  Similarity=0.106  Sum_probs=82.3

Q ss_pred             CeEEeccccccccCCchhhhhcCCCEEeccCCCcccceeeCc---------eEEEecC-CHHHHHHHHHHHhc---CHHH
Q 043097           30 PVVLYPAVNVYQFDKPHSSMAAYKPVIACDSGGPVETIKNEV---------VGFLCNP-TPQEFSLSMAKLIQ---EPQM   96 (134)
Q Consensus        30 ~~v~~~g~~~~~~~~~~eAma~G~pvi~s~~~~~~e~i~~~~---------~g~~~~~-~~~~l~~~i~~~~~---~~~~   96 (134)
                      |.+++|+..+....+++|||+||+|||+|+.||++|++.++.         +|+++++ |+++|+++|.++++   |++.
T Consensus       367 D~~v~PS~~E~fglv~lEAma~G~PvVas~~GG~~E~v~d~~~~~~~~~~~~G~l~~~~d~~~la~ai~~~l~~~~~~~~  446 (477)
T d1rzua_         367 DAIIIPSRFEPCGLTQLYALRYGCIPVVARTGGLADTVIDANHAALASKAATGVQFSPVTLDGLKQAIRRTVRYYHDPKL  446 (477)
T ss_dssp             SEEEECCSCCSSCSHHHHHHHHTCEEEEESSHHHHHHCCBCCHHHHHTTCCCBEEESSCSHHHHHHHHHHHHHHHTCHHH
T ss_pred             ccccCCccccCCCHHHHHHHHcCCCEEEcCCCCCcceeecCCccccccCCCceEEeCCCCHHHHHHHHHHHHhhhCCHHH
Confidence            555555555444447789999999999999999999998764         8999999 99999999998775   8888


Q ss_pred             HHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHhc
Q 043097           97 AKKMGENARHHVMESFSTKIFGQHLNRLLAYVAR  130 (134)
Q Consensus        97 ~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~  130 (134)
                      +.+|++++.   .++|||+++++++.++|+++++
T Consensus       447 ~~~~~~~a~---~~~fsw~~~a~~~~~lY~~ll~  477 (477)
T d1rzua_         447 WTQMQKLGM---KSDVSWEKSAGLYAALYSQLIS  477 (477)
T ss_dssp             HHHHHHHHH---TCCCBHHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHH---HhhCCHHHHHHHHHHHHHHHhC
Confidence            999888774   4679999999999999999874

PyMOL of d1rzua_

>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]}	Back information, alignment and structure

>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]}	Back information, alignment and structure

>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]}	Back information, alignment and structure

>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]}	Back information, alignment and structure

>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]}	Back information, alignment and structure

>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]}	Back information, alignment and structure

>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2nzwa1 c.87.1.11 (A:1-349) Alpha1,3-fucosyltransferase FucT {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure