Citrus Sinensis ID: 043158
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1962 | 2.2.26 [Sep-21-2011] | |||||||
| O88480 | 2182 | Calcineurin-binding prote | yes | no | 0.099 | 0.089 | 0.305 | 2e-14 | |
| Q9Y6J0 | 2220 | Calcineurin-binding prote | yes | no | 0.099 | 0.088 | 0.300 | 2e-14 |
| >sp|O88480|CABIN_RAT Calcineurin-binding protein cabin-1 OS=Rattus norvegicus GN=Cabin1 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 83.2 bits (204), Expect = 2e-14, Method: Compositional matrix adjust.
Identities = 65/213 (30%), Positives = 109/213 (51%), Gaps = 17/213 (7%)
Query: 1 MFSIAAIN-----DTDSTGQWEPLA-PTKEAQARPESHLTQTYHEGLLKLQSKEYDKA-- 52
M IAA+N + D G ++ TKEAQ E+ YH+ L + ++++
Sbjct: 1 MIRIAALNASSTIEDDHEGSFKSHKIQTKEAQ---EAEAFALYHKALDLQKHDRFEESAK 57
Query: 53 --QELLESVLKDPLIANAQAADGKSSDGHLLQLRFLALKNLATVFLQQGSSHYESALRCY 110
ELLE+ L +++ +G G L L++ KNLA + Q+ E+A+ Y
Sbjct: 58 AYHELLEARLLREAVSSGDEKEGLKHPG--LILKYSTYKNLAQLAAQR--EDLETAMEFY 113
Query: 111 LQAVEIDTKDSVVWNQLGTLACSMGLLSISRWAFEQGLLCSPNNWNCMEKLLEVLIAIGD 170
L+AV +D+ D +W ++G +A + L ++R AFE+GL C+P++W C++ L+ VL + D
Sbjct: 114 LEAVMLDSTDVNLWYKIGHVALRLIRLPLARHAFEEGLRCNPDHWPCLDNLITVLYTLSD 173
Query: 171 EVACLSVAELILRHWPSHSRALHVKNTIEETEP 203
CL L +S+ L +K I E +P
Sbjct: 174 YTTCLYFICKALEKDCRYSKGLVLKEKIFEEQP 206
|
May be required for replication-independent chromatin assembly (By similarity). May serve as a negative regulator of T-cell receptor (TCR) signaling via inhibition of calcineurin. Rattus norvegicus (taxid: 10116) |
| >sp|Q9Y6J0|CABIN_HUMAN Calcineurin-binding protein cabin-1 OS=Homo sapiens GN=CABIN1 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1962 | ||||||
| 296081595 | 1970 | unnamed protein product [Vitis vinifera] | 0.970 | 0.966 | 0.673 | 0.0 | |
| 224142846 | 1974 | predicted protein [Populus trichocarpa] | 0.952 | 0.946 | 0.682 | 0.0 | |
| 255550888 | 1906 | conserved hypothetical protein [Ricinus | 0.948 | 0.975 | 0.654 | 0.0 | |
| 356518376 | 1938 | PREDICTED: uncharacterized protein LOC10 | 0.962 | 0.974 | 0.632 | 0.0 | |
| 356510057 | 1941 | PREDICTED: uncharacterized protein LOC10 | 0.965 | 0.975 | 0.629 | 0.0 | |
| 449437260 | 1923 | PREDICTED: LOW QUALITY PROTEIN: uncharac | 0.958 | 0.977 | 0.605 | 0.0 | |
| 334187101 | 1863 | tetratricopeptide repeat domain-containi | 0.920 | 0.969 | 0.583 | 0.0 | |
| 334187103 | 1872 | tetratricopeptide repeat domain-containi | 0.920 | 0.964 | 0.581 | 0.0 | |
| 147799030 | 1610 | hypothetical protein VITISV_023323 [Viti | 0.785 | 0.957 | 0.655 | 0.0 | |
| 297798686 | 1844 | binding protein [Arabidopsis lyrata subs | 0.898 | 0.956 | 0.567 | 0.0 |
| >gi|296081595|emb|CBI20600.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 2622 bits (6796), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 1333/1978 (67%), Positives = 1567/1978 (79%), Gaps = 74/1978 (3%)
Query: 1 MFSIAAINDTDSTGQWEPLAPTKEAQARPESHLTQTYHEGLLKLQSKEYDKAQELLESVL 60
MFSIAAINDTDS GQWEPLAPTKEAQ E HL+QTYHEGL KLQ+KEY+KA+ELLE+VL
Sbjct: 26 MFSIAAINDTDSKGQWEPLAPTKEAQ---EFHLSQTYHEGLRKLQAKEYEKARELLEAVL 82
Query: 61 KDPLIANAQAADGKSSDGHLLQLRFLALKNLATVFLQQGSSHYESALRCYLQAVEIDTKD 120
KDPLI+ AQ D ++DGHLLQLRFL LKNLATVFLQQGS HYE AL CYLQAVEIDTKD
Sbjct: 83 KDPLISKAQV-DSNATDGHLLQLRFLVLKNLATVFLQQGSDHYERALSCYLQAVEIDTKD 141
Query: 121 SVVWNQLGTLACSMGLLSISRWAFEQGLLCSPNNWNCMEKLLEVLIAIGDEVACLSVAEL 180
SVVWNQLGTL+CSMGLLSISRWAFEQGL CSPNNWNCMEKLLE+LIAIGDEVACLSVAEL
Sbjct: 142 SVVWNQLGTLSCSMGLLSISRWAFEQGLFCSPNNWNCMEKLLEILIAIGDEVACLSVAEL 201
Query: 181 ILRHWPSHSRALHVKNTIEETEPVPYAPRGIDKLEPKHVRLKFIDKRKAAAEILDEGVVC 240
ILRHWPSH+RALHVKNTIEE++PVP+APRGIDKLEPKHVRLKF +KRKA E + EG+
Sbjct: 202 ILRHWPSHARALHVKNTIEESDPVPFAPRGIDKLEPKHVRLKFPEKRKAEDENIGEGISL 261
Query: 241 KKLNQNIELCLAESSWAALADTLLDILCPLNGCGSEMRVEKAPKSGDVRLAIRLPTSSEM 300
KK NQNI+L LAE+SWAAL D LL IL PLNGCGSE+ EK S ++RL+I LP+S+E
Sbjct: 262 KKQNQNIDLHLAEASWAALTDALLAILHPLNGCGSELGAEKMCTSPNIRLSIHLPSSAEN 321
Query: 301 VMGFGEKKGTNSSGNGEIMHVGESDSDRC-IIKEKETNIFEEQPLERRSTRLERLRSRKP 359
++ GE+KG + GE M +G+ S+R +KEKE N FEEQP ERRSTRLERLRSRKP
Sbjct: 322 IVPPGERKGLKFNPVGENMCLGDCKSERASTLKEKEANAFEEQPQERRSTRLERLRSRKP 381
Query: 360 GKEEEDFANDKDVPKNVLQFLESFITGLSEKKDCNHAAISL-----------DTECCDVT 408
KEE DFA+ KD+PK V+QFLE FI G ++ +H+A S + EC DV
Sbjct: 382 EKEEVDFASGKDLPKAVIQFLEPFIVGGPGLRNSDHSASSSASCPESQANLSENECSDVA 441
Query: 409 TFVRETSKNYGAYHMGHLLLEHAARRSLTCHDAFLKFMELEKLTRYSGLDRTPECSLFLS 468
FV+ETSKNYGA+HMGHLLLE A R L D F+KF+ELEKLTR+ GLDRTPECSLFL+
Sbjct: 442 KFVKETSKNYGAHHMGHLLLEEVANRDLLYQDYFIKFLELEKLTRHGGLDRTPECSLFLA 501
Query: 469 ELYYDLGSSPSNVSKQSEFMSEASYHLCKIIESVSLDYPFDFTCAPGNVNCSSKESFQGT 528
ELYYDLGSS S S S++M + +YHLCKIIESV+L+YPF + GN NCS +S QG
Sbjct: 502 ELYYDLGSS-SEASSLSDYMEDVTYHLCKIIESVALEYPFHSSGVAGNANCSLTDSGQGA 560
Query: 529 NGASANNTICNDSLLDSSLLTNKSSFWVRYFWLSGRLSILDGKKSKAHEQFCIALSLFEK 588
S +N++ +SLLDSS L+NK FWVR+FWLSGRLSIL+G ++KA +F I+LSL K
Sbjct: 561 GRISLDNSVSQNSLLDSSFLSNKQFFWVRFFWLSGRLSILEGNRAKAQNEFLISLSLLSK 620
Query: 589 KENMNDSISSICLPHCKIVREITIGRILHEINLLEIDFLLEKTLDELIEKEMYSECVTLL 648
KE+ D++ S+ LP+CK +E+TI R+LHEINLL+IDFLL++T+ E+IEKEMY ECV L+
Sbjct: 621 KEDTKDTLGSVHLPYCKFTKELTIDRVLHEINLLKIDFLLKQTVGEMIEKEMYLECVNLI 680
Query: 649 APLLFSTKDVHLDLLPLPGADKSEGIKSVELLALDILILACEKTEPMNSEMYLSCHRRKL 708
APLLFSTKD HLD+LP A ++EG+ SVEL A+D+LI ACEK + +++E+YL CHRRKL
Sbjct: 681 APLLFSTKDAHLDMLP---AKEAEGVTSVELSAIDVLIKACEKAKLVDTELYLLCHRRKL 737
Query: 709 QILMAVSGMDTSLASCKTFFQNSGLKMHSASDMVSTENSSKQWYHLVADEIKAILHCISQ 768
QIL A +GM+ L S K F + SG K SAS++ S E+SSK W LVA+E+KAI C SQ
Sbjct: 738 QILTAAAGMEEYLTSHKPFHERSGSKTLSASEIESQESSSKHWNSLVAEEVKAISQCASQ 797
Query: 769 VKNFIDQSRDYNGFNVLVSSICDIQCLLLAVMYNVASNFLSKKFSGPLNVDQTDQKLQCC 828
VK+F DQ + N V +S I DIQ LLLAVM N A+ FL KK SG + VDQ++QK +CC
Sbjct: 798 VKSFNDQCGESNAIIVPMSIIGDIQTLLLAVMCNFANTFLKKKSSGLVTVDQSEQKQRCC 857
Query: 829 FVNAAIAFCKLQHLNPTVPVKTQVTLIAAIHDLLSEYGLCCAGEGDGGEEGTFLKFAIKH 888
FV+ AIAFCKLQHLNP+ PVK + L+ AIHDLL+EYGLCCAG+ GEEGTFLK AIKH
Sbjct: 858 FVDIAIAFCKLQHLNPSTPVKAHIELVVAIHDLLAEYGLCCAGDSGEGEEGTFLKLAIKH 917
Query: 889 LLALNTKLKSNFSSSNKENAEYDKQLSHDDHVKISEDEIRSDAMDLEMVGAETRETVAGK 948
LLAL+ KLKSN SSN+E + D+Q+SH+++VK S +E++SDA+++E E E A +
Sbjct: 918 LLALDMKLKSNCQSSNRETTQCDEQISHNNNVKTSLNELKSDALNMESGRMELDEDHAVE 977
Query: 949 KDDSEGTTSNEMPSHLDLEKENLRVGSDGHCDNEDNDDKGEKNSNPCTQCENELSEDERE 1008
KD +K EK S+ +C EL+EDERE
Sbjct: 978 KDF----------------------------------NKVEKISDEFVECGKELTEDERE 1003
Query: 1009 ELELIIDNALDQCFYCLYGLNLRSDSSYEDDLVTHRNTSRGDYQTKEQSADVFQYVLPYA 1068
ELEL IDNALDQCF+CLYGLNLRSDSSY+DDL H+NTSRGDYQTKEQ +DVFQY+LPYA
Sbjct: 1004 ELELGIDNALDQCFFCLYGLNLRSDSSYDDDLALHKNTSRGDYQTKEQCSDVFQYILPYA 1063
Query: 1069 KASSKTGLVKLRRVLRAIRKHFPQPPEDVLAGNAIDKFLDDLDLCEDIISEEAGSDGYLG 1128
KASS+TGL+KLRRVLRAIRKHFPQPPEDVL GN IDKFLDD DLCED +SEEAGSDG++
Sbjct: 1064 KASSRTGLIKLRRVLRAIRKHFPQPPEDVLVGNPIDKFLDDPDLCEDKLSEEAGSDGFVE 1123
Query: 1129 NIMKIIFRDIVWVKQFKAPSSGSSEPYLEVYRNLYYYLAQAEEMSTTDKWPGFVLTKEGE 1188
+IMK F D +KQ+KAPS GSS+PYLEVY NLYY LAQ+EE + TDKWPGFVLTKEGE
Sbjct: 1124 SIMKT-FPDAGGIKQYKAPSVGSSQPYLEVYCNLYYLLAQSEETNATDKWPGFVLTKEGE 1182
Query: 1189 EFVQQNANLFKFDLLYNPLRFESWQRLANIYDEEVDLLLNDGSKHINVTGWRKNVTLPQR 1248
EFVQQN NLFK+DL+YNPLRFESWQRLANIYDEEVDLLLNDGSKHINV GWRKN +LPQR
Sbjct: 1183 EFVQQNTNLFKYDLMYNPLRFESWQRLANIYDEEVDLLLNDGSKHINVAGWRKNASLPQR 1242
Query: 1249 VETSRRRSRRCLLMSLALAKTSEQQCEILELLALVYYDSLQNVVPFYDQRSVVPSKDAAW 1308
VETSRRRSRRCLLMSLALAKTS QQ EI ELLALVYYDSLQNVVPFYDQRSVVPSKDAAW
Sbjct: 1243 VETSRRRSRRCLLMSLALAKTSVQQSEIHELLALVYYDSLQNVVPFYDQRSVVPSKDAAW 1302
Query: 1309 KMFCENSLKHFKKALSHKEDWSYAFYMGKLCEKLGYSHETSLSYYDKAIGLNQSAVDALY 1368
MFC+NS+KHFKKA +HK DWS+AFYMGKL EKLGY HE S SYYDKAI LN SAVD Y
Sbjct: 1303 TMFCQNSMKHFKKAFAHKPDWSHAFYMGKLSEKLGYPHELSFSYYDKAINLNPSAVDPFY 1362
Query: 1369 RMHASRLKLLWTCGKQNVEVLKVLSAYSYNQSTKDAVMNIFSKMDSEISHSP-EAKDGSP 1427
RMHASRLKLL+T GKQN E LKV++ +S+N+ST++ VMNI S+M EI + P + DG+
Sbjct: 1363 RMHASRLKLLYTSGKQNFEALKVVARHSFNKSTEENVMNILSRMSPEILNLPADDMDGNA 1422
Query: 1428 QLQAEERKDKESVRVEEVRHMLYNDCLSALEVCIEGDLKHFHKARYMLSQGLYKRGEVGD 1487
Q+ EERKD ES ++EEV HMLY+DCLS+L++C+EGDLKHFHKARY+L+QGLY+RGE G
Sbjct: 1423 QVNPEERKDAESHQLEEVWHMLYSDCLSSLQICVEGDLKHFHKARYVLAQGLYRRGERGG 1482
Query: 1488 LEKAKEELSFCFKSSRSSFTINMWEIDGLVKKGRRKTAGLAGNKKILEVNLPESSRKFIT 1547
E++K+ELSFCFKSSRSSFTINMWEIDG+VKKGRRKT GLAGNKK LEVNLPESSRKFIT
Sbjct: 1483 SERSKDELSFCFKSSRSSFTINMWEIDGMVKKGRRKTMGLAGNKKALEVNLPESSRKFIT 1542
Query: 1548 CIRKYLLFYLKLLEETGDVCTLERAYVSLRADKRFSLCIEDLVPVALGRYIRALLSSMHH 1607
CIRKY+LFYLKLLEETGD+ TL+RAY+SLRADKRFSLC+EDLVPVALGRYI+AL+SSM
Sbjct: 1543 CIRKYMLFYLKLLEETGDISTLDRAYISLRADKRFSLCLEDLVPVALGRYIKALISSMRQ 1602
Query: 1608 SGITYSSAGSSSELVLEKIFALFMEQGNLWPEICGAPEIMSPEISESSLYGYLHEHIVSL 1667
+ S+A S SE +LEK+F LFMEQG+LWP++C PE+ S E+SESSLYGYL+++I L
Sbjct: 1603 AETVGSTAASRSEHMLEKMFTLFMEQGSLWPDLCSLPEMRSTELSESSLYGYLYQYIQLL 1662
Query: 1668 ESKVKLETLEAINEKIRKRFKNPKLSNSNCAKVCRHASVAWCRSLIISLASITPLRSLPL 1727
E V+LETLEAINEKIRKRFKNPKL+NSNCAKVC+HASVAWCRSLIISLA ITPL +
Sbjct: 1663 ERNVRLETLEAINEKIRKRFKNPKLANSNCAKVCKHASVAWCRSLIISLALITPLHA--E 1720
Query: 1728 SGIQAPNSMDGGLENSQLLCVDLQINEIWNSSFEDKIHLKTLEKKWNPTLSKIKNIIMKK 1787
S +QA + DGG EN+QLLC+DLQ NE+WNSSFED H+K LE KW P LSKIKN+I++K
Sbjct: 1721 SVVQALHMSDGGFENTQLLCLDLQTNELWNSSFEDLTHVKNLETKWVPLLSKIKNLIIRK 1780
Query: 1788 AVDENLETAYAMLRSSYNFYRESSCVTLPSGVNLYLVPSRLASEAQFQPGIDGVENVDLS 1847
A DENLETA +LR YNFYRESS + LPSG+NLY VPSRLA++ Q G++GVE VDLS
Sbjct: 1781 ASDENLETANTLLRCCYNFYRESSSIMLPSGINLYSVPSRLATDTQIHLGMNGVEIVDLS 1840
Query: 1848 IPRKLLLWSYTLLQGRCASISAVVKHCEENVKSKMKKGTGTSPVPTNTSIQTA------- 1900
+PRKLLLW+YTLL GRC SIS VVKHCEEN KS+MKKG GTS NTSI +A
Sbjct: 1841 VPRKLLLWAYTLLHGRCTSISVVVKHCEENAKSRMKKGAGTSSTLPNTSITSATTTHTGT 1900
Query: 1901 --------TITHTVTPASVSPRENAEYVLALPSAAESQKTLSTAPPLQLCSDADAERS 1950
T A+VS E + + L + E+QK+L AP L C+ + AE+S
Sbjct: 1901 GKDGGGEAEAAALATAAAVSLPE-GDSIRGLNCSGETQKSLLAAPHLHQCTSSSAEKS 1957
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224142846|ref|XP_002324750.1| predicted protein [Populus trichocarpa] gi|222866184|gb|EEF03315.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255550888|ref|XP_002516492.1| conserved hypothetical protein [Ricinus communis] gi|223544312|gb|EEF45833.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356518376|ref|XP_003527855.1| PREDICTED: uncharacterized protein LOC100783547 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356510057|ref|XP_003523757.1| PREDICTED: uncharacterized protein LOC100783154 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449437260|ref|XP_004136410.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101222622 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|334187101|ref|NP_195008.6| tetratricopeptide repeat domain-containing protein [Arabidopsis thaliana] gi|332660722|gb|AEE86122.1| tetratricopeptide repeat domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|334187103|ref|NP_001154282.2| tetratricopeptide repeat domain-containing protein [Arabidopsis thaliana] gi|332660723|gb|AEE86123.1| tetratricopeptide repeat domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|147799030|emb|CAN74834.1| hypothetical protein VITISV_023323 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297798686|ref|XP_002867227.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297313063|gb|EFH43486.1| binding protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1962 | ||||||
| UNIPROTKB|E1BUF4 | 2168 | CABIN1 "Uncharacterized protei | 0.099 | 0.090 | 0.320 | 8.1e-21 | |
| UNIPROTKB|G5E9F3 | 2141 | CABIN1 "Calcineurin-binding pr | 0.099 | 0.091 | 0.322 | 1.3e-18 | |
| UNIPROTKB|Q9Y6J0 | 2220 | CABIN1 "Calcineurin-binding pr | 0.099 | 0.087 | 0.322 | 1.7e-18 | |
| RGD|620263 | 2182 | Cabin1 "calcineurin binding pr | 0.099 | 0.089 | 0.327 | 1.7e-17 | |
| UNIPROTKB|F1PJD2 | 2213 | CABIN1 "Uncharacterized protei | 0.097 | 0.086 | 0.322 | 2.3e-16 | |
| UNIPROTKB|G3X746 | 2164 | CABIN1 "Uncharacterized protei | 0.097 | 0.088 | 0.317 | 6.9e-15 |
| UNIPROTKB|E1BUF4 CABIN1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 226 (84.6 bits), Expect = 8.1e-21, Sum P(6) = 8.1e-21
Identities = 69/215 (32%), Positives = 110/215 (51%)
Query: 1 MFSIAAIN-----DTDSTGQWEP-LAPTKEAQARPESHLTQTYHEGLLKLQS----KEYD 50
M IAA+N + D G ++ TKEAQ E+ YH+ L LQ +E
Sbjct: 1 MIRIAALNASSTIEDDYEGTFKSHKTQTKEAQ---EAEAFALYHKAL-DLQKHDRFEESA 56
Query: 51 KA-QELLESVLKDPLIANAQAADGKSSDGHLLQLRFLALKNLATVFLQQGSSHYESALRC 109
KA ELLE L + + +G G L L++ KNLA + +Q+ E+A+
Sbjct: 57 KAYHELLEIRLLREAVLSGDEKEGLKHPG--LMLKYSTYKNLAQLAVQRDD--LETAMEF 112
Query: 110 YLQAVEIDTKDSVVWNQLGTLACSMGLLSISRWAFEQGLLCSPNNWNCMEKLLEVLIAIG 169
YL+AV +D+ D +W ++G +A + L ++R AFE+GL C+P++W C++ L+ +L +
Sbjct: 113 YLEAVMLDSTDVNLWYKIGRVAIKLIRLPLARHAFEEGLRCNPDHWPCLDNLITILYTLS 172
Query: 170 DEVACLSVAELILRHWPSHSRALHVKNTIEETEPV 204
D CL L +S+ L +K I E +P+
Sbjct: 173 DYPTCLYFICKALEKDCLYSKGLVLKEKIFEEQPL 207
|
|
| UNIPROTKB|G5E9F3 CABIN1 "Calcineurin-binding protein cabin-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y6J0 CABIN1 "Calcineurin-binding protein cabin-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|620263 Cabin1 "calcineurin binding protein 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PJD2 CABIN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3X746 CABIN1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1962 | |||
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 7e-06 | |
| pfam13414 | 69 | pfam13414, TPR_11, TPR repeat | 4e-05 | |
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 1e-04 | |
| TIGR02521 | 234 | TIGR02521, type_IV_pilW, type IV pilus biogenesis/ | 6e-04 | |
| pfam13424 | 78 | pfam13424, TPR_12, Tetratricopeptide repeat | 0.002 |
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
Score = 46.2 bits (110), Expect = 7e-06
Identities = 23/98 (23%), Positives = 39/98 (39%), Gaps = 2/98 (2%)
Query: 87 ALKNLATVFLQQGSSHYESALRCYLQAVEIDTKDSVVWNQLGTLACSMGLLSISRWAFEQ 146
AL NL ++ + G Y+ AL Y +A+E+D ++ + L +G + +E+
Sbjct: 2 ALLNLGNLYYKLG--DYDEALEYYEKALELDPDNADAYYNLAAAYYKLGKYEEALEDYEK 59
Query: 147 GLLCSPNNWNCMEKLLEVLIAIGDEVACLSVAELILRH 184
L P+N L +G L E L
Sbjct: 60 ALELDPDNAKAYYNLGLAYYKLGKYEEALEAYEKALEL 97
|
Length = 100 |
| >gnl|CDD|222112 pfam13414, TPR_11, TPR repeat | Back alignment and domain information |
|---|
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1962 | |||
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.7 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.65 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.52 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.48 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.37 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.37 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 99.32 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.32 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.31 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 99.29 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 99.28 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 99.26 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 99.25 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 99.24 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 99.23 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 99.23 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 99.23 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 99.21 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 99.21 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 99.2 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 99.17 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 99.16 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 99.13 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 99.12 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 99.11 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 99.09 | |
| PLN02789 | 320 | farnesyltranstransferase | 99.08 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 99.08 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 99.08 | |
| PLN02789 | 320 | farnesyltranstransferase | 99.07 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 99.06 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 99.04 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 99.03 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 99.02 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 99.02 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 99.02 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 99.02 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 99.02 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 99.01 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 99.01 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 99.0 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 98.97 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 98.95 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 98.95 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 98.95 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 98.94 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 98.93 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 98.92 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 98.9 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 98.89 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 98.87 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 98.84 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 98.84 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 98.8 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 98.8 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 98.79 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 98.79 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 98.78 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 98.78 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 98.76 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 98.75 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 98.71 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 98.69 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 98.67 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 98.66 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 98.66 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 98.65 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 98.63 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 98.62 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 98.62 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 98.59 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 98.58 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 98.55 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.54 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 98.54 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 98.52 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 98.52 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 98.5 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 98.49 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 98.49 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 98.48 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 98.44 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 98.43 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 98.42 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 98.38 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 98.36 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 98.36 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 98.36 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 98.32 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 98.32 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 98.31 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 98.31 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.3 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 98.29 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 98.29 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 98.28 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 98.28 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 98.24 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 98.24 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 98.24 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 98.23 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 98.23 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 98.22 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 98.19 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 98.19 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 98.18 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 98.18 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 98.16 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 98.16 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 98.14 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 98.13 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 98.13 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 98.09 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 98.08 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 98.08 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 98.08 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 98.08 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 98.05 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 98.05 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 98.05 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 98.04 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 98.03 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 98.03 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 97.99 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 97.99 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 97.99 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 97.98 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 97.95 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 97.89 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 97.89 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 97.88 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 97.83 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 97.81 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 97.79 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 97.79 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 97.79 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 97.77 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 97.75 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 97.73 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 97.73 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 97.73 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 97.71 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 97.7 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 97.69 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 97.66 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 97.64 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 97.62 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 97.57 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 97.56 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 97.54 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 97.49 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 97.46 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 97.44 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 97.43 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 97.4 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 97.39 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 97.39 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 97.39 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 97.39 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 97.34 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 97.31 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 97.27 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 97.25 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 97.25 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 97.19 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 97.16 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 97.13 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 97.12 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 97.1 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 97.02 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 96.99 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 96.98 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 96.98 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 96.97 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 96.94 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 96.92 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 96.9 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 96.88 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 96.87 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 96.87 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 96.79 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 96.76 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 96.75 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 96.73 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 96.71 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 96.69 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 96.57 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 96.53 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 96.53 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 96.51 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 96.46 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 96.45 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 96.43 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 96.42 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 96.41 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 96.28 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 96.25 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 96.12 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 96.0 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 95.99 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 95.97 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 95.68 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 95.68 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 95.62 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 95.53 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 95.37 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 95.35 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 95.34 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 95.23 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 95.22 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 95.16 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 95.14 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 95.08 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 95.06 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 95.05 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 94.97 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 94.82 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 94.79 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 94.59 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 94.52 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 94.21 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 94.15 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 94.12 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 94.04 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 93.84 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 93.67 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 93.64 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 93.58 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 93.49 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 93.47 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 93.46 | |
| KOG2396 | 568 | consensus HAT (Half-A-TPR) repeat-containing prote | 93.44 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 93.42 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 93.17 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 93.02 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 92.93 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 92.91 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 92.75 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 92.75 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 92.61 | |
| COG3898 | 531 | Uncharacterized membrane-bound protein [Function u | 92.52 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 92.47 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 92.31 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 92.3 | |
| COG4649 | 221 | Uncharacterized protein conserved in bacteria [Fun | 92.26 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 92.09 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 92.05 | |
| PF04781 | 111 | DUF627: Protein of unknown function (DUF627); Inte | 92.05 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 91.69 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 91.67 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 91.62 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 91.49 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 91.48 | |
| PF04910 | 360 | Tcf25: Transcriptional repressor TCF25; InterPro: | 91.33 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 91.33 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 91.29 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 91.27 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 91.27 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 91.14 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 91.04 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 90.57 | |
| PF10373 | 278 | EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP | 90.27 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 90.0 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 89.58 | |
| COG0790 | 292 | FOG: TPR repeat, SEL1 subfamily [General function | 88.53 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 88.48 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 88.31 | |
| COG3898 | 531 | Uncharacterized membrane-bound protein [Function u | 88.23 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 88.12 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 88.03 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 87.98 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 87.72 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 87.49 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 87.31 | |
| COG3914 | 620 | Spy Predicted O-linked N-acetylglucosamine transfe | 87.22 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 87.13 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 87.05 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 84.73 | |
| KOG0530 | 318 | consensus Protein farnesyltransferase, alpha subun | 84.67 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 84.61 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 84.14 | |
| KOG0546 | 372 | consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos | 83.94 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 83.74 | |
| COG3914 | 620 | Spy Predicted O-linked N-acetylglucosamine transfe | 83.71 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 83.63 | |
| TIGR02561 | 153 | HrpB1_HrpK type III secretion protein HrpB1/HrpK. | 82.88 | |
| COG0790 | 292 | FOG: TPR repeat, SEL1 subfamily [General function | 82.7 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 81.43 | |
| COG2912 | 269 | Uncharacterized conserved protein [Function unknow | 80.37 |
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=99.70 E-value=4.3e-17 Score=197.12 Aligned_cols=228 Identities=17% Similarity=0.218 Sum_probs=169.2
Q ss_pred cccHHHHHHHHHHHHHCCCHHHHHHHHHHHhcCCc-ccchhccCCCCC-------------chhhhHH---hHHHHHHHH
Q 043158 30 ESHLTQTYHEGLLKLQSKEYDKAQELLESVLKDPL-IANAQAADGKSS-------------DGHLLQL---RFLALKNLA 92 (1962)
Q Consensus 30 eeeAlalYqkAL~L~qqGRfeEA~eaY~raLa~p~-lk~a~~~d~~~s-------------~s~lLqL---~ylAykNLG 92 (1962)
+...-+.-+.|..+-.+||++||.++|.+++...| ++-++. +.+.+ +..++-+ ...||.|||
T Consensus 181 P~l~ca~s~lgnLlka~Grl~ea~~cYlkAi~~qp~fAiaws-nLg~~f~~~Gei~~aiq~y~eAvkldP~f~dAYiNLG 259 (966)
T KOG4626|consen 181 PDLYCARSDLGNLLKAEGRLEEAKACYLKAIETQPCFAIAWS-NLGCVFNAQGEIWLAIQHYEEAVKLDPNFLDAYINLG 259 (966)
T ss_pred cchhhhhcchhHHHHhhcccchhHHHHHHHHhhCCceeeeeh-hcchHHhhcchHHHHHHHHHHhhcCCCcchHHHhhHH
Confidence 44455555666666667777777777777776543 221111 11100 0111111 347999999
Q ss_pred HHHHHcCCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHcCCHH
Q 043158 93 TVFLQQGSSHYESALRCYLQAVEIDTKDSVVWNQLGTLACSMGLLSISRWAFEQGLLCSPNNWNCMEKLLEVLIAIGDEV 172 (1962)
Q Consensus 93 ~lLl~~g~Gr~eEALe~y~rALaLDP~DaeaW~nLG~al~~LGr~eeAr~alErALeLdPd~~~Al~nLg~aL~~LGdye 172 (1962)
++|-+. +.+++|+.||.+|+.+.|+++.++.|+|.+|..+|..+.|+.+|++||+++|++++|+.|||++|.+.|+..
T Consensus 260 nV~ke~--~~~d~Avs~Y~rAl~lrpn~A~a~gNla~iYyeqG~ldlAI~~Ykral~~~P~F~~Ay~NlanALkd~G~V~ 337 (966)
T KOG4626|consen 260 NVYKEA--RIFDRAVSCYLRALNLRPNHAVAHGNLACIYYEQGLLDLAIDTYKRALELQPNFPDAYNNLANALKDKGSVT 337 (966)
T ss_pred HHHHHH--hcchHHHHHHHHHHhcCCcchhhccceEEEEeccccHHHHHHHHHHHHhcCCCchHHHhHHHHHHHhccchH
Confidence 999999 899999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHhCCCCHHHHHHHHHhhhcCCCC------------CCCCCccccCccchhhHHHHhhhHHhhhhhhhhhh
Q 043158 173 ACLSVAELILRHWPSHSRALHVKNTIEETEPVP------------YAPRGIDKLEPKHVRLKFIDKRKAAAEILDEGVVC 240 (1962)
Q Consensus 173 eAL~~~~rALeLdPd~a~Al~lk~~I~~adP~~------------f~P~~~daL~p~~~~L~~i~krk~ed~~~dEAle~ 240 (1962)
+|..+|.+||.+.|+|+.++.+++.|+.+.-.. +-|....+.+.... +. + .+..+++|++.
T Consensus 338 ea~~cYnkaL~l~p~hadam~NLgni~~E~~~~e~A~~ly~~al~v~p~~aaa~nNLa~----i~--k-qqgnl~~Ai~~ 410 (966)
T KOG4626|consen 338 EAVDCYNKALRLCPNHADAMNNLGNIYREQGKIEEATRLYLKALEVFPEFAAAHNNLAS----IY--K-QQGNLDDAIMC 410 (966)
T ss_pred HHHHHHHHHHHhCCccHHHHHHHHHHHHHhccchHHHHHHHHHHhhChhhhhhhhhHHH----HH--H-hcccHHHHHHH
Confidence 999999999999999999999999886654222 23333222222111 11 1 11256777654
Q ss_pred hccccccccccC-hhhHHHHHHHHHHHhCC
Q 043158 241 KKLNQNIELCLA-ESSWAALADTLLDILCP 269 (1962)
Q Consensus 241 Rk~~~al~L~l~-~~SW~~LG~SLL~Ll~~ 269 (1962)
+..++.|.|. .-+..++|.++.+++.-
T Consensus 411 --YkealrI~P~fAda~~NmGnt~ke~g~v 438 (966)
T KOG4626|consen 411 --YKEALRIKPTFADALSNMGNTYKEMGDV 438 (966)
T ss_pred --HHHHHhcCchHHHHHHhcchHHHHhhhH
Confidence 5567778887 77888999999877643
|
|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG3898 Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >COG4649 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >COG3898 Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK | Back alignment and domain information |
|---|
| >COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2912 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 111 bits (277), Expect = 2e-24
Identities = 106/651 (16%), Positives = 209/651 (32%), Gaps = 177/651 (27%)
Query: 1095 EDVLAGNAIDKFLDDLDLCEDIISEEAGSDGYLGNIMKIIFRDIVWVKQFKAPSSGSSEP 1154
+D+L+ D F+D+ D C+D+ D + K I+ S +
Sbjct: 19 KDILSVF-EDAFVDNFD-CKDV------QDMPKSILSKEEIDHII----------MSKDA 60
Query: 1155 YLEVYRNLYYYLAQAEEMSTTDKWPGFVLTKEGEEFVQQNANLFKFDLLYNPLRFESWQR 1214
R + L++ EEM FV EE ++ N + L +P++ E Q
Sbjct: 61 VSGTLRLFWTLLSKQEEMVQK-----FV-----EEVLRIN-----YKFLMSPIKTEQRQP 105
Query: 1215 LAN--IYDEEVDLLLNDGSKHINVTGWRKNVTLPQRVETSR------RRSRRCLL--M-- 1262
+Y E+ D L ND + NV+ Q R R ++ L+ +
Sbjct: 106 SMMTRMYIEQRDRLYNDNQVFA-----KYNVSRLQPYLKLRQALLELRPAKNVLIDGVLG 160
Query: 1263 ----SLAL--AKTSEQQC------------------EILELLALVYYDSLQNVVPFYDQR 1298
+AL + + QC +LE+L + Y N D
Sbjct: 161 SGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHS 220
Query: 1299 SVVPSKDAAWKMFCENSLKH--FKKAL------SHKEDWSYAFYMGKLCEKLGYSHETSL 1350
S + + + + LK ++ L + + W+ AF + C+ L L
Sbjct: 221 SNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQNAKAWN-AFNLS--CKIL-------L 270
Query: 1351 SYYDKAIGLNQSAVDALYRMHASRLKLLWTCGKQNVEVLKVLSAYSYNQSTKDAVMNIFS 1410
+ K + D L + + L L T D V ++
Sbjct: 271 TTRFKQV------TDFLSAATTTHISL--------DHHSMTL--------TPDEVKSLLL 308
Query: 1411 K-MDSEISHSP-EAKDGSPQ---LQAEERKDKESVRVEEVRHMLYNDCLSALEVCIE--- 1462
K +D P E +P+ + AE +D + + +H+ + + +E +
Sbjct: 309 KYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLA-TWDNWKHVNCDKLTTIIESSLNVLE 367
Query: 1463 -GDLKHFHKARYMLSQG----------LYKRGEVGDLEKAKEELSFCFKSS-----RSSF 1506
+ + + ++ D+ ++ K S
Sbjct: 368 PAEYRKMFDRLSVFPPSAHIPTILLSLIWFDVIKSDVM---VVVNKLHKYSLVEKQPKES 424
Query: 1507 TINMWEIDGLVKKGRRKTAGLAGNKKILE-VNLP---ESSRKFITCIRKYLLFY----LK 1558
TI++ I +K L ++ I++ N+P +S + +Y + LK
Sbjct: 425 TISIPSIYLELKVKLENEYAL--HRSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLK 482
Query: 1559 LLEETGDVCTLERAYVSLRADKRFSLCIEDLVPVALGRYIRALLSSMHHSGITYSSAGSS 1618
+E + ++ RF L + IR H ++++GS
Sbjct: 483 NIEHPERMTLFRMVFLDF----RF-----------LEQKIR-------HDSTAWNASGSI 520
Query: 1619 SELV--LEKIFALFMEQGNLWPEICGAPEIMSPEISESSLYGYLHEHIVSL 1667
+ L+ + + + A P+I E +L + ++ +
Sbjct: 521 LNTLQQLKFYKPYICDNDPKYERLVNAILDFLPKI-EENLICSKYTDLLRI 570
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1962 | |||
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.73 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.72 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.69 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.68 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.65 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.65 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.64 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.63 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.61 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.61 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.6 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.6 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 99.58 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 99.57 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.57 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.56 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.56 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 99.55 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 99.55 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.55 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 99.53 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 99.52 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.51 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 99.5 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 99.49 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 99.49 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 99.49 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 99.49 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 99.49 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 99.48 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.48 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 99.48 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 99.48 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.48 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 99.47 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 99.47 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 99.47 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 99.47 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 99.46 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 99.46 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.46 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 99.46 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 99.46 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 99.46 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 99.46 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 99.45 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 99.45 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.44 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 99.43 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 99.42 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.42 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.42 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 99.42 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 99.41 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 99.41 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 99.41 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 99.4 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 99.4 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 99.4 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 99.39 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.39 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 99.39 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.39 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 99.39 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 99.39 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 99.38 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 99.38 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 99.38 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 99.38 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 99.38 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 99.36 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 99.36 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 99.36 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 99.34 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 99.34 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 99.34 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 99.34 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 99.33 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 99.33 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 99.33 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 99.33 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.32 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 99.32 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 99.32 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 99.32 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 99.32 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 99.32 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.32 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 99.31 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 99.31 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 99.31 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 99.31 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.31 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 99.3 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 99.3 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 99.3 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 99.29 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 99.29 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 99.29 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 99.28 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 99.27 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 99.27 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.26 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.26 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 99.25 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 99.25 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 99.24 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 99.24 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 99.24 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 99.24 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 99.24 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 99.24 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.23 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 99.23 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.22 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 99.22 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.21 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 99.2 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 99.2 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 99.2 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 99.2 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.19 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 99.19 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 99.18 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 99.18 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 99.18 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.17 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.16 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 99.15 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 99.14 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 99.13 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 99.1 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 99.1 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 99.1 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 99.1 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 99.1 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 99.09 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 99.09 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 99.08 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 99.07 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 99.07 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 99.07 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 99.07 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 99.06 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 99.06 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 99.05 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 99.04 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 99.02 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 99.02 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 99.02 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 99.01 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 99.01 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 99.0 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 99.0 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 99.0 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 99.0 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 98.99 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 98.99 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 98.98 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 98.97 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 98.97 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 98.97 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 98.95 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 98.95 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 98.94 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 98.94 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 98.93 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 98.93 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 98.91 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.9 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 98.89 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.89 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 98.87 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 98.86 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 98.85 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 98.82 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 98.82 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 98.8 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 98.79 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 98.74 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 98.72 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 98.7 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 98.69 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 98.69 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 98.65 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 98.61 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 98.52 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 98.49 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 98.49 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 98.48 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 98.44 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 98.44 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 98.38 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 98.37 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 98.31 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 98.29 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 98.22 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 98.08 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 98.05 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 98.04 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 98.02 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 98.02 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 98.01 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 97.99 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 97.97 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 97.97 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 97.97 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 97.9 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 97.89 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 97.76 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 97.75 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 97.71 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 97.51 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 97.48 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 97.39 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 97.11 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 97.06 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 96.87 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 96.74 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 96.09 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 95.88 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 95.66 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 95.47 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 95.35 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 94.34 | |
| 1ya0_A | 497 | SMG-7 transcript variant 2; alpha-helical repeat, | 94.24 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 93.81 | |
| 4h7y_A | 161 | Dual specificity protein kinase TTK; mitotic check | 93.38 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 93.14 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 93.07 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 92.72 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 92.19 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 91.1 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 90.98 | |
| 4h7y_A | 161 | Dual specificity protein kinase TTK; mitotic check | 90.32 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 89.3 | |
| 1ya0_A | 497 | SMG-7 transcript variant 2; alpha-helical repeat, | 88.8 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 86.98 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 85.78 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 85.32 | |
| 1zbp_A | 273 | Hypothetical protein VPA1032; alpha-beta protein, | 84.61 |
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
Probab=99.73 E-value=9.8e-17 Score=174.70 Aligned_cols=189 Identities=16% Similarity=0.035 Sum_probs=158.1
Q ss_pred cccHHHHHHHHHHHHHCCCHHHHHHHHHHHhcCCcccchhccCCCCCchhhhHHhHHHHHHHHHHHHHcCCCCHHHHHHH
Q 043158 30 ESHLTQTYHEGLLKLQSKEYDKAQELLESVLKDPLIANAQAADGKSSDGHLLQLRFLALKNLATVFLQQGSSHYESALRC 109 (1962)
Q Consensus 30 eeeAlalYqkAL~L~qqGRfeEA~eaY~raLa~p~lk~a~~~d~~~s~s~lLqL~ylAykNLG~lLl~~g~Gr~eEALe~ 109 (1962)
+..+..++..|..+.+.|++++|+..|+++++..| + ...+|.++|.++... |++++|+.+
T Consensus 2 p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p-------~-----------~~~a~~~lg~~~~~~--g~~~~A~~~ 61 (217)
T 2pl2_A 2 QTAEQNPLRLGVQLYALGRYDAALTLFERALKENP-------Q-----------DPEALYWLARTQLKL--GLVNPALEN 61 (217)
T ss_dssp --CCHHHHHHHHHHHHTTCHHHHHHHHHHHHTTSS-------S-----------CHHHHHHHHHHHHHT--TCHHHHHHH
T ss_pred CCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCC-------C-----------CHHHHHHHHHHHHHc--CCHHHHHHH
Confidence 45667889999999999999999999999998754 2 247899999999999 999999999
Q ss_pred HHHHHHhCCCCHHHHHHHHHHHHHc-----------CChHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHcCCHHHHHHHH
Q 043158 110 YLQAVEIDTKDSVVWNQLGTLACSM-----------GLLSISRWAFEQGLLCSPNNWNCMEKLLEVLIAIGDEVACLSVA 178 (1962)
Q Consensus 110 y~rALaLDP~DaeaW~nLG~al~~L-----------Gr~eeAr~alErALeLdPd~~~Al~nLg~aL~~LGdyeeAL~~~ 178 (1962)
|++|++++|+++.+|+++|.++..+ |++++|+.+|+++++++|+++.++.++|.++..+|++++|+.+|
T Consensus 62 ~~~al~~~P~~~~a~~~lg~~~~~~~~~~~~~~~~~g~~~~A~~~~~~al~~~P~~~~~~~~lg~~~~~~g~~~~A~~~~ 141 (217)
T 2pl2_A 62 GKTLVARTPRYLGGYMVLSEAYVALYRQAEDRERGKGYLEQALSVLKDAERVNPRYAPLHLQRGLVYALLGERDKAEASL 141 (217)
T ss_dssp HHHHHHHCTTCHHHHHHHHHHHHHHHHTCSSHHHHHHHHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHH
T ss_pred HHHHHHhCCCcHHHHHHHHHHHHHhhhhhhhhcccccCHHHHHHHHHHHHHhCcccHHHHHHHHHHHHHcCChHHHHHHH
Confidence 9999999999999999999999999 99999999999999999999999999999999999999999999
Q ss_pred HHHHHhCCCCHHHHHHHHHhhhcCCCCCCCCCccccCccchhhHHHHhhhHHhhhhhhhhhhhccccccccccC-hhhHH
Q 043158 179 ELILRHWPSHSRALHVKNTIEETEPVPYAPRGIDKLEPKHVRLKFIDKRKAAAEILDEGVVCKKLNQNIELCLA-ESSWA 257 (1962)
Q Consensus 179 ~rALeLdPd~a~Al~lk~~I~~adP~~f~P~~~daL~p~~~~L~~i~krk~ed~~~dEAle~Rk~~~al~L~l~-~~SW~ 257 (1962)
+++++++ +++.++..++.+... .+ ++++|... +.+++.+.|. ...|.
T Consensus 142 ~~al~~~-~~~~~~~~la~~~~~----------------------------~g-~~~~A~~~--~~~al~~~P~~~~~~~ 189 (217)
T 2pl2_A 142 KQALALE-DTPEIRSALAELYLS----------------------------MG-RLDEALAQ--YAKALEQAPKDLDLRV 189 (217)
T ss_dssp HHHHHHC-CCHHHHHHHHHHHHH----------------------------HT-CHHHHHHH--HHHHHHHSTTCHHHHH
T ss_pred HHHHhcc-cchHHHHHHHHHHHH----------------------------cC-CHHHHHHH--HHHHHHhCCCChHHHH
Confidence 9999999 999888887776321 01 23444433 4456666765 67788
Q ss_pred HHHHHHHHHhCCC
Q 043158 258 ALADTLLDILCPL 270 (1962)
Q Consensus 258 ~LG~SLL~Ll~~~ 270 (1962)
.+|..+.......
T Consensus 190 ~la~~~~~~g~~~ 202 (217)
T 2pl2_A 190 RYASALLLKGKAE 202 (217)
T ss_dssp HHHHHHTC-----
T ss_pred HHHHHHHHccCHH
Confidence 8998887655443
|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1962 | ||||
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 3e-05 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 4e-04 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 5e-04 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 0.003 | |
| d1zbpa1 | 264 | e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V | 5e-05 | |
| d2c2la1 | 201 | a.118.8.1 (A:24-224) STIP1 homology and U box-cont | 2e-04 |
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: O-GlcNAc transferase p110 subunit, OGT species: Human (Homo sapiens) [TaxId: 9606]
Score = 46.2 bits (108), Expect = 3e-05
Identities = 26/150 (17%), Positives = 57/150 (38%), Gaps = 18/150 (12%)
Query: 37 YHEGLLKLQSKEYDKAQELLESVLK-DPLIANA---------------QAADGKSSDGHL 80
+ + + D A + ++ P +A +A D ++ L
Sbjct: 241 GNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRL 300
Query: 81 LQLRFLALKNLATVFLQQGSSHYESALRCYLQAVEIDTKDSVVWNQLGTLACSMGLLSIS 140
+L NLA + +QG + E A+R Y +A+E+ + + + L ++ G L +
Sbjct: 301 CPTHADSLNNLANIKREQG--NIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEA 358
Query: 141 RWAFEQGLLCSPNNWNCMEKLLEVLIAIGD 170
+++ + SP + + L + D
Sbjct: 359 LMHYKEAIRISPTFADAYSNMGNTLKEMQD 388
|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1962 | |||
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.65 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.59 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.58 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.56 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.55 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.54 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.54 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.52 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.52 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.51 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 99.49 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.48 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.47 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.42 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 99.42 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 99.36 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 99.35 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.34 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 99.34 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 99.34 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 99.31 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.3 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.27 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 99.24 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.24 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 99.21 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 99.18 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.16 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 99.12 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.08 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 99.07 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 99.03 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.95 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 98.93 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 98.9 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 98.9 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 98.88 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 98.84 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 98.83 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 98.79 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 98.76 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 98.68 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 98.64 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 98.64 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 98.6 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 98.57 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 98.54 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 98.31 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 98.17 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 98.06 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 97.92 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 97.72 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 97.39 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 97.33 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 97.12 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 95.18 |
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: Protein prenylyltransferase family: Protein prenylyltransferase domain: Protein farnesyltransferase alpha-subunit species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.65 E-value=8.4e-16 Score=175.71 Aligned_cols=190 Identities=12% Similarity=0.052 Sum_probs=158.7
Q ss_pred cccHHHHHHHHHHHHHCCCHHHHHHHHHHHhcCCcccchhccCCCCCchhhhHHhHHHHHHHHHHHHHcCCCCHHHHHHH
Q 043158 30 ESHLTQTYHEGLLKLQSKEYDKAQELLESVLKDPLIANAQAADGKSSDGHLLQLRFLALKNLATVFLQQGSSHYESALRC 109 (1962)
Q Consensus 30 eeeAlalYqkAL~L~qqGRfeEA~eaY~raLa~p~lk~a~~~d~~~s~s~lLqL~ylAykNLG~lLl~~g~Gr~eEALe~ 109 (1962)
++-+.+....|..+.+.+++++|+++|+++++..| + ++.+|+++|.++...+ +++++|+.+
T Consensus 40 p~~~~a~~~~~~~~~~~e~~~~Al~~~~~ai~lnP-------~-----------~~~a~~~r~~~l~~l~-~~~~eal~~ 100 (315)
T d2h6fa1 40 DKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNA-------A-----------NYTVWHFRRVLLKSLQ-KDLHEEMNY 100 (315)
T ss_dssp HHHHHHHHHHHHHHHHTCCCHHHHHHHHHHHHHCT-------T-----------CHHHHHHHHHHHHHTT-CCHHHHHHH
T ss_pred HHHHHHHHHHHHHHHhCCchHHHHHHHHHHHHHCC-------C-----------ChHHHHHHHHHHHHhC-cCHHHHHHH
Confidence 55667777788899999999999999999998754 2 4689999999999983 469999999
Q ss_pred HHHHHHhCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCH
Q 043158 110 YLQAVEIDTKDSVVWNQLGTLACSMGLLSISRWAFEQGLLCSPNNWNCMEKLLEVLIAIGDEVACLSVAELILRHWPSHS 189 (1962)
Q Consensus 110 y~rALaLDP~DaeaW~nLG~al~~LGr~eeAr~alErALeLdPd~~~Al~nLg~aL~~LGdyeeAL~~~~rALeLdPd~a 189 (1962)
|.+|++++|+++.+|+++|.++..+|++++|+.+|++|++++|++..+|.++|.++..+|++++|+.+++++++++|.+.
T Consensus 101 ~~~al~~~p~~~~a~~~~~~~~~~l~~~~eAl~~~~kal~~dp~n~~a~~~~~~~~~~~~~~~~Al~~~~~al~~~p~n~ 180 (315)
T d2h6fa1 101 ITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNN 180 (315)
T ss_dssp HHHHHHHCTTCHHHHHHHHHHHHHHTCCTTHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCCTTHHHHHHHHHHHCTTCH
T ss_pred HHHHHHHHHhhhhHHHHHhHHHHhhccHHHHHHHHhhhhhhhhcchHHHHHHHHHHHHHHhhHHHHHHHHHHHHHCCccH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhhhcCCCCCCCCCccccCccchhhHHHHhhhHHhhhhhhhhhhhccccccccccC-hhhHHHHHHHH
Q 043158 190 RALHVKNTIEETEPVPYAPRGIDKLEPKHVRLKFIDKRKAAAEILDEGVVCKKLNQNIELCLA-ESSWAALADTL 263 (1962)
Q Consensus 190 ~Al~lk~~I~~adP~~f~P~~~daL~p~~~~L~~i~krk~ed~~~dEAle~Rk~~~al~L~l~-~~SW~~LG~SL 263 (1962)
.||+.++.+....... .. . ..+++|+.. ..+++.+.|. ...|..+|..+
T Consensus 181 ~a~~~r~~~l~~~~~~---~~----------~----------~~~~~ai~~--~~~al~~~P~~~~~~~~l~~ll 230 (315)
T d2h6fa1 181 SVWNQRYFVISNTTGY---ND----------R----------AVLEREVQY--TLEMIKLVPHNESAWNYLKGIL 230 (315)
T ss_dssp HHHHHHHHHHHHTTCS---CS----------H----------HHHHHHHHH--HHHHHHHSTTCHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHcccc---ch----------h----------hhhHHhHHH--HHHHHHhCCCchHHHHHHHHHH
Confidence 9999998764421110 00 0 022333322 3446667776 77899988765
|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|