Citrus Sinensis ID: 043298

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------
ILSIKHCRSLTYIAAVQLPSSLKNLQIRDCYNIRTLTVEEGIQCSSGRRYTSSLLEELFVFNCDSLTCIFSKYELPATLESLEVGNLPSSVKVLDVYGCPKLESIAERLDNNTSLETISIYNCENLKILPSGLHKLHQLREIWIRECGNLVSFPEGGLPCAKLRRLGIYDCERLEALPKGLHNLSSLQELTIGGELPSLEEDGLPTNLHSLDIWGNMEIWKSMIERGRGFHRFSSLGHLKIGGCDDDMVSFPLEDKRLGTALPLPASLTSLWIEDFPNLEHLSSSIVDLQNLTSLGLYNCPKLKYFPEKGLPSSLLLLWIEGCPLIEEKCRKDGGQYWDLLTHIPYVVIDWKWVFDN
cEEEcccccccccccccccccccEEEEEcccccEEcccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccEEccccccccccccEEEEEEccccccccccccccccccEEEEEccccccccccccccccEEEEcccccccHHHHHccccccccccccEEEEccccccccccccccccccccccccccccEEEcccccccccHHHcccccccccEEEccccccccccccccccccccEEEccccHHHHHHHcccccccccccccccEEEEccEEEccc
cccccccccccccccccccccccEEEEcccccccEccHHHccccccccccccHHHcEEEcccccHHHHccHHHccccccccccccccccHccEEEccccccHHHccHHccccccccEEEEcccccHccccccccccccccEEEEcccccHccccccccccccccEEEEcccccHHcccccccccccccEEEccccccccccccccccHHHEEEccHHcHHHHHHHccccccccccccEEEccccccHcccccHHcccccHHccccccccEEEEcccccHHHccHHHcccccccEEEEcccccccccccccccccHcEEEEcccHHHHHcccccccccccccccccEEEEccEEEEcc
ilsikhcrsLTYIAAVQlpsslknlqirdcyniRTLTVeegiqcssgrrytSSLLEELFVfncdsltcifskyelpatleslevgnlpssvkvldvygcpklESIAErldnntsletisiyncenlkilpsgLHKLHQLREIWIREcgnlvsfpegglpcaklrrlgiydcerlealpkglhnlsslqeltiggelpsleedglptnlhsldiWGNMEIWKSMIERgrgfhrfsslghlkiggcdddmvsfpledkrlgtalplpasltslwiedfpnlehlsSSIVDlqnltslglyncpklkyfpekglpssLLLLWIEgcplieekcrkdggqywdllthipyvvidwkwvfdn
ilsikhcrslTYIAavqlpsslknlqiRDCYNIRTLTveegiqcssGRRYTSSLLEELFVFNCDSLTCIFSKYELPATLESLEVGNLPSSVKVLDVYGCPKLESIAERLDNNTSLETISIYNCENLKILPSGLHKLHQLREIWIRECGNLVSFPEGGLPCAKLRRLGIYDCERLEALPKGLHNLSSLQELTIGGELPSLEEDGLPTNLHSLDIWGNMEIWKSMIERGRGFHRFSSLGHLKIGGCDDDMVSFPLEDKRLGTALPLPASLTSLWIEDFPNLEHLSSSIVDLQNLTSLGLYNCPKLKYFPEKGLPSSLLLLWIEGCPLIEEKCRKDGGQYWDLLTHIPYVVIDWKWVFDN
ILSIKHCRSLTYIAAVQLPSSLKNLQIRDCYNIRTLTVEEGIQCSSGRRYTSSLLEELFVFNCDSLTCIFSKYELPATLESLEVGNLPSSVKVLDVYGCPKLESIAERLDNNTSLETISIYNCENLKILPSGLHKLHQLREIWIRECGNLVSFPEGGLPCAKLRRLGIYDCERLEALPKGLHNLSSLQELTIGGELPSLEEDGLPTNLHSLDIWGNMEIWKSMIERGRGFHRFSSLGHLKIGGCDDDMVSFPLEDKRLGTALPLPASLTSLWIEDFPNLEHLSSSIVDLQNLTSLGLYNCPKLKYFPEKGLPSSLLLLWIEGCPLIEEKCRKDGGQYWDLLTHIPYVVIDWKWVFDN
***IKHCRSLTYIAAVQLPSSLKNLQIRDCYNIRTLTVEEGIQCSSGRRYTSSLLEELFVFNCDSLTCIFSKYELPATLESLEVGNLPSSVKVLDVYGCPKLESIAERLDNNTSLETISIYNCENLKILPSGLHKLHQLREIWIRECGNLVSFPEGGLPCAKLRRLGIYDCERLEALPKGLHNLSSLQELTIGGELPSLEEDGLPTNLHSLDIWGNMEIWKSMIERGRGFHRFSSLGHLKIGGCDDDMVSFPLEDKRLGTALPLPASLTSLWIEDFPNLEHLSSSIVDLQNLTSLGLYNCPKLKYFPEKGLPSSLLLLWIEGCPLIEEKCRKDGGQYWDLLTHIPYVVIDWKWVF**
ILSIKHCRSLTYIAAVQLPSSLKNLQIRDCYNIRTLTVEEG********YTSSLLEELFVFNCDSLTCIFSKYELPATLESLEVGNLPSSVKVLDVYGCPKLESIAERLDNNTSLETISIYNCENLKILPSGLHKLHQLREIWIRECGNLVSFPEGGLPCAKLRRLGIYDCERLEALPKGLHNLSSLQELTIGGELPSLEEDGLPTNLHSLDIWGNMEIWKSMIERGRGFHRFSSLGHLKIGGCDDDMVSFPLEDKRLGTALPLPASLTSLWIEDFPNLEHLSSSIVDLQNLTSLGLYNCPKLKYFPEKGLPSSLLLLWIEGCPLIEEKCRKDGGQYWDLLTHIPYVVIDWKWVFD*
ILSIKHCRSLTYIAAVQLPSSLKNLQIRDCYNIRTLTVEEGIQCSSGRRYTSSLLEELFVFNCDSLTCIFSKYELPATLESLEVGNLPSSVKVLDVYGCPKLESIAERLDNNTSLETISIYNCENLKILPSGLHKLHQLREIWIRECGNLVSFPEGGLPCAKLRRLGIYDCERLEALPKGLHNLSSLQELTIGGELPSLEEDGLPTNLHSLDIWGNMEIWKSMIERGRGFHRFSSLGHLKIGGCDDDMVSFPLEDKRLGTALPLPASLTSLWIEDFPNLEHLSSSIVDLQNLTSLGLYNCPKLKYFPEKGLPSSLLLLWIEGCPLIEEKCRKDGGQYWDLLTHIPYVVIDWKWVFDN
ILSIKHCRSLTYIAAVQLPSSLKNLQIRDCYNIRTLTVEEGIQCSSGRRYTSSLLEELFVFNCDSLTCIFSKYELPATLESLEVGNLPSSVKVLDVYGCPKLESIAERLDNNTSLETISIYNCENLKILPSGLHKLHQLREIWIRECGNLVSFPEGGLPCAKLRRLGIYDCERLEALPKGLHNLSSLQELTIGGELPSLEEDGLPTNLHSLDIWGNMEIWKSMIERGRGFHRFSSLGHLKIGGCDDDMVSFPLEDKRLGTALPLPASLTSLWIEDFPNLEHLSSSIVDLQNLTSLGLYNCPKLKYFPEKGLPSSLLLLWIEGCPLIEEKCRKDGGQYWDLLTHIPYVVIDWKWVFDN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ILSIKHCRSLTYIAAVQLPSSLKNLQIRDCYNIRTLTVEEGIQCSSGRRYTSSLLEELFVFNCDSLTCIFSKYELPATLESLEVGNLPSSVKVLDVYGCPKLESIAERLDNNTSLETISIYNCENLKILPSGLHKLHQLREIWIRECGNLVSFPEGGLPCAKLRRLGIYDCERLEALPKGLHNLSSLQELTIGGELPSLEEDGLPTNLHSLDIWGNMEIWKSMIERGRGFHRFSSLGHLKIGGCDDDMVSFPLEDKRLGTALPLPASLTSLWIEDFPNLEHLSSSIVDLQNLTSLGLYNCPKLKYFPEKGLPSSLLLLWIEGCPLIEEKCRKDGGQYWDLLTHIPYVVIDWKWVFDN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query357 2.2.26 [Sep-21-2011]
Q9LRR51424 Putative disease resistan no no 0.815 0.204 0.310 1e-20
Q7XA39988 Putative disease resistan N/A no 0.484 0.175 0.312 1e-08
Q7XBQ9970 Disease resistance protei N/A no 0.509 0.187 0.288 5e-08
O23530 1301 Protein SUPPRESSOR OF npr no no 0.745 0.204 0.269 4e-07
Q9FKZ0815 Probable disease resistan no no 0.330 0.144 0.303 7e-07
Q7XA40992 Putative disease resistan N/A no 0.380 0.137 0.326 1e-06
Q9FKZ1809 Probable disease resistan no no 0.411 0.181 0.276 2e-06
Q9RBS2 1024 Protein PopC OS=Ralstonia yes no 0.745 0.259 0.284 3e-06
P26337630 Putative adenylate cyclas N/A no 0.633 0.358 0.266 5e-06
Q9FW44787 Disease resistance protei no no 0.313 0.142 0.300 3e-05
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function desciption
 Score =  100 bits (250), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 111/357 (31%), Positives = 167/357 (46%), Gaps = 66/357 (18%)

Query: 2    LSIKHCRSLTYIAAVQLPSSLKNLQIRDCYNIRTLTVEEGIQCSSGRRYTSSLLEELFV- 60
            L I  C SL        P++LK L IRDC   + L   E +Q +  R Y  S LE LF+ 
Sbjct: 1121 LLIIACHSLESFPGSHPPTTLKTLYIRDC---KKLNFTESLQPT--RSY--SQLEYLFIG 1173

Query: 61   FNCDSLTCIFSKYELPATLESLEVGNLPSSVKVLDVYGCPKLESIAERLDNNTSLETISI 120
             +C +L                   N P S+        PKL S+             SI
Sbjct: 1174 SSCSNLV------------------NFPLSL-------FPKLRSL-------------SI 1195

Query: 121  YNCENLKILP--SGLHKLH-QLREIWIRECGNLVSFPEGGLPCAKLRRLGIYDCERLEAL 177
             +CE+ K     +GL      L  + IR+C NL +FP+GGLP  KL  + + +C++L+AL
Sbjct: 1196 RDCESFKTFSIHAGLGDDRIALESLEIRDCPNLETFPQGGLPTPKLSSMLLSNCKKLQAL 1255

Query: 178  PKGLHNLSSLQELTIGG--ELPSLEEDGLPTNLHSLDIWGNMEIWKSMIERGR-GFHRFS 234
            P+ L  L+SL  L I    E+ ++   G P+NL +L I     +   +  R   G     
Sbjct: 1256 PEKLFGLTSLLSLFIIKCPEIETIPGGGFPSNLRTLCI----SLCDKLTPRIEWGLRDLE 1311

Query: 235  SLGHLKIGGCDDDMVSFPLEDKRLGTALPLPASLTSLWIEDFPNLEHLS-SSIVDLQNLT 293
            +L +L+I G ++D+ SFP E         LP S+ SL I  F NL+ L+     D + + 
Sbjct: 1312 NLRNLEIDGGNEDIESFPEEGL-------LPKSVFSLRISRFENLKTLNRKGFHDTKAIE 1364

Query: 294  SLGLYNCPKLKYFPEKGLPSSLLLLWIEGCPLIEEKCRKDGGQYWDLLTHIPYVVID 350
            ++ +  C KL+   ++ LP  L  L I  C L+ E   +   +++ +L +IPYV ID
Sbjct: 1365 TMEISGCDKLQISIDEDLP-PLSCLRISSCSLLTETFAEVETEFFKVL-NIPYVEID 1419
Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9FKZ0|DRL43_ARATH Probable disease resistance protein At5g66910 OS=Arabidopsis thaliana GN=At5g66910 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q9FKZ1|DRL42_ARATH Probable disease resistance protein At5g66900 OS=Arabidopsis thaliana GN=At5g66900 PE=3 SV=1 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|P26337|ESA8C_TRYEQ Putative adenylate cyclase regulatory protein OS=Trypanosoma equiperdum GN=ESAG8C PE=2 SV=1 Back     alignment and function description
>sp|Q9FW44|ADR1_ARATH Disease resistance protein ADR1 OS=Arabidopsis thaliana GN=ADR1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query357
356554923 1399 PREDICTED: putative disease resistance R 0.966 0.246 0.448 3e-67
284026888 1424 CC-NBS-LRR protein [Quercus suber] 0.977 0.245 0.4 1e-54
224132254 552 predicted protein [Populus trichocarpa] 0.949 0.614 0.413 7e-53
45826061 739 resistance protein [Quercus suber] 0.938 0.453 0.396 4e-51
400131587 1388 FB_MR5 [Malus x robusta] 0.859 0.221 0.402 2e-50
359487255 1336 PREDICTED: putative disease resistance p 0.915 0.244 0.369 4e-43
147777746 1199 hypothetical protein VITISV_010202 [Viti 0.915 0.272 0.366 4e-43
359495052 1324 PREDICTED: putative disease resistance p 0.913 0.246 0.386 1e-42
225449872 1322 PREDICTED: putative disease resistance p 0.907 0.245 0.380 1e-42
359495054 1347 PREDICTED: putative disease resistance R 0.910 0.241 0.376 1e-42
>gi|356554923|ref|XP_003545790.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Glycine max] Back     alignment and taxonomy information
 Score =  261 bits (668), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 171/381 (44%), Positives = 231/381 (60%), Gaps = 36/381 (9%)

Query: 2    LSIKHCRSLTYIAAVQLPSSLKNLQIRDCYNIR------TLTVEEGIQCSSGRRYTSSL- 54
            L I HC S+ ++   QLP SLK+L+I +C N+R      T T    I      ++ S++ 
Sbjct: 1026 LYICHCDSIVFVTMDQLPHSLKSLEISNCKNLRCLLDNGTCTSSSIIMHDDNVQHGSTII 1085

Query: 55   --LEELFVFNCDSLTCIFSKYELPATLESLEV------------GNLPSSVKVLDVYGCP 100
              LE +++  C SLTCI    ELP +++ L +            G LP S++ L++  CP
Sbjct: 1086 SHLEYVYIGWCPSLTCISRSGELPESVKHLFIWNCSELSCLSMKGQLPKSIERLEIQSCP 1145

Query: 101  KLESIAERLDNNTSLETISIYNCENLKILPSGLHKLHQLREIWIRECGNLVSFPEGGLPC 160
            KLESIA RL  NTSLE+I I+NCENLK LP GLH L  L+EI I  C NLVSFPE GLP 
Sbjct: 1146 KLESIANRLHRNTSLESIQIWNCENLKSLPEGLHFLVNLKEIKIIGCPNLVSFPEEGLPA 1205

Query: 161  AKLRRLGIYDCERLEALPKGLHNLSSLQELTIGGELPSLE---EDGLPTNLHSLDIWGNM 217
            + L  L I  CE+L ALP  ++NL SL+EL I G  PS++   E   P NL SL I  + 
Sbjct: 1206 SSLSELSIMSCEKLVALPNSMYNLDSLKELEI-GYCPSIQYFPEINFPDNLTSLWI-NDH 1263

Query: 218  EIWKSMIERGRGFHRFSSLGHLKIGGCDDDMVSFPLEDKRLGTALPLPASLTSLWIEDFP 277
               ++M     G ++ S L  L I G +  M   PLE  +LGT   LP++LTSL ++ FP
Sbjct: 1264 NACEAMF--NWGLYKLSFLRDLTIIGGNLFM---PLE--KLGTM--LPSTLTSLTVQGFP 1314

Query: 278  NLEHLSSS-IVDLQNLTSLGLYNCPKLKYFPEKGLPSSLLLLWIEGCPLIEEKCRKDGGQ 336
            +LE+LSS     L +L+ L +YNCPKL   PEKGLPSSLL L+I+ CP ++E+CRKD G+
Sbjct: 1315 HLENLSSEGFHKLTSLSKLSIYNCPKLLCLPEKGLPSSLLELYIQDCPFLKEQCRKDKGR 1374

Query: 337  YWDLLTHIPYVVIDWKWVFDN 357
             W  +  +PYV ID K+++D+
Sbjct: 1375 DWLKIADVPYVEIDGKFIYDS 1395

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|284026888|gb|ADB66335.1| CC-NBS-LRR protein [Quercus suber] Back     alignment and taxonomy information
>gi|224132254|ref|XP_002328223.1| predicted protein [Populus trichocarpa] gi|222837738|gb|EEE76103.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|45826061|gb|AAS77675.1| resistance protein [Quercus suber] Back     alignment and taxonomy information
>gi|400131587|emb|CCH50986.1| FB_MR5 [Malus x robusta] Back     alignment and taxonomy information
>gi|359487255|ref|XP_002269744.2| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147777746|emb|CAN60302.1| hypothetical protein VITISV_010202 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495052|ref|XP_002267579.2| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225449872|ref|XP_002265429.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495054|ref|XP_002267622.2| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query357
TAIR|locus:20916621424 AT3G14460 [Arabidopsis thalian 0.876 0.219 0.301 5.7e-22
TAIR|locus:2098110 1219 AT3G44670 [Arabidopsis thalian 0.560 0.164 0.308 8.3e-14
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.677 0.122 0.285 3.5e-12
TAIR|locus:2163426 1187 TAO1 "target of AVRB operation 0.747 0.224 0.255 1.9e-11
TAIR|locus:2053405 1215 AT2G14080 [Arabidopsis thalian 0.683 0.200 0.283 2e-10
TAIR|locus:2170488 1205 AT5G46260 [Arabidopsis thalian 0.607 0.180 0.296 2.6e-10
TAIR|locus:2028681 1161 AT1G31540 [Arabidopsis thalian 0.672 0.206 0.281 5.4e-09
TAIR|locus:2147992 1189 AT5G11250 [Arabidopsis thalian 0.669 0.201 0.260 1.2e-08
TAIR|locus:21001821007 AT3G44400 [Arabidopsis thalian 0.535 0.189 0.290 1.6e-08
TAIR|locus:2151476 1168 VICTR "VARIATION IN COMPOUND T 0.633 0.193 0.286 2.5e-08
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 270 (100.1 bits), Expect = 5.7e-22, P = 5.7e-22
 Identities = 107/355 (30%), Positives = 173/355 (48%)

Query:    16 VQLPSSLKNLQIRDCYNIRTLTVEEGIQCSSGRRYTSSLLEELFVFNCDSLTCIFSKYEL 75
             ++LP +L++L I  C  + +L   E +  S    Y +  L EL +  C SL   F     
Sbjct:  1087 MELPQNLQSLHIDSCDGLTSLP--ENLTES----YPN--LHELLIIACHSLES-FPGSHP 1137

Query:    76 PATLESLEVG-----NLPSSVKVLDVYGCPKLESIAERLDNNTS--------LETISIYN 122
             P TL++L +      N   S++    Y   +   I     N  +        L ++SI +
Sbjct:  1138 PTTLKTLYIRDCKKLNFTESLQPTRSYSQLEYLFIGSSCSNLVNFPLSLFPKLRSLSIRD 1197

Query:   123 CENLKI--LPSGLHKLH-QLREIWIRECGNLVSFPEGGLPCAKLRRLGIYDCERLEALPK 179
             CE+ K   + +GL      L  + IR+C NL +FP+GGLP  KL  + + +C++L+ALP+
Sbjct:  1198 CESFKTFSIHAGLGDDRIALESLEIRDCPNLETFPQGGLPTPKLSSMLLSNCKKLQALPE 1257

Query:   180 GLHNLSSLQELTI--GGELPSLEEDGLPTNLHSLDIWGNMEIWKSMIERGR-GFHRFSSL 236
              L  L+SL  L I    E+ ++   G P+NL +L I     +   +  R   G     +L
Sbjct:  1258 KLFGLTSLLSLFIIKCPEIETIPGGGFPSNLRTLCI----SLCDKLTPRIEWGLRDLENL 1313

Query:   237 GHLKIGGCDDDMVSFPLEDKRLGTALPLPASLTSLWIEDFPNLEHLS-SSIVDLQNLTSL 295
              +L+I G ++D+ SFP E    G    LP S+ SL I  F NL+ L+     D + + ++
Sbjct:  1314 RNLEIDGGNEDIESFPEE----GL---LPKSVFSLRISRFENLKTLNRKGFHDTKAIETM 1366

Query:   296 GLYNCPKLKYFPEKGLPSSLLLLWIEGCPLIEEKCRKDGGQYWDLLTHIPYVVID 350
              +  C KL+   ++ LP  L  L I  C L+ E   +   +++ +L +IPYV ID
Sbjct:  1367 EISGCDKLQISIDEDLPP-LSCLRISSCSLLTETFAEVETEFFKVL-NIPYVEID 1419
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2098110 AT3G44670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170488 AT5G46260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028681 AT1G31540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2100182 AT3G44400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151476 VICTR "VARIATION IN COMPOUND TRIGGERED ROOT growth response" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00660113
hypothetical protein (552 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query357
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-12
PLN03210 1153 PLN03210, PLN03210, Resistant to P 5e-05
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 69.1 bits (169), Expect = 1e-12
 Identities = 73/228 (32%), Positives = 105/228 (46%), Gaps = 19/228 (8%)

Query: 101 KLESIAERLDNNTSLETISIYNCENLKILPSGLHKLHQLREIWIRECGNLVSFPEGGLPC 160
           KLE + + + + T L  I +   +NLK +P  L     L  + + +C +LV  P      
Sbjct: 622 KLEKLWDGVHSLTGLRNIDLRGSKNLKEIPD-LSMATNLETLKLSDCSSLVELPSSIQYL 680

Query: 161 AKLRRLGIYDCERLEALPKGLHNLSSLQELTIGG--ELPSLEEDGLPTNLHSLDIWGNME 218
            KL  L +  CE LE LP G+ NL SL  L + G   L S  +  + TN+  LD+     
Sbjct: 681 NKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPD--ISTNISWLDLDE--- 734

Query: 219 IWKSMIERGRGFHRFSSLGHLKIGGCDDDMVSFPLEDK-RLGTAL--PLPASLTSLWIED 275
              + IE      R  +L  L +  C+  M S  L ++ +  T L   L  SLT L++ D
Sbjct: 735 ---TAIEEFPSNLRLENLDELIL--CE--MKSEKLWERVQPLTPLMTMLSPSLTRLFLSD 787

Query: 276 FPNLEHLSSSIVDLQNLTSLGLYNCPKLKYFPEKGLPSSLLLLWIEGC 323
            P+L  L SSI +L  L  L + NC  L+  P      SL  L + GC
Sbjct: 788 IPSLVELPSSIQNLHKLEHLEIENCINLETLPTGINLESLESLDLSGC 835

syringae 6; Provisional. Length = 1153
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 357
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.87
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.86
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.84
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.83
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.73
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.68
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.66
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.66
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.65
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.58
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.58
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.51
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.5
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.47
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.36
KOG0617264 consensus Ras suppressor protein (contains leucine 99.29
KOG0617264 consensus Ras suppressor protein (contains leucine 99.25
KOG4341483 consensus F-box protein containing LRR [General fu 99.16
KOG4237498 consensus Extracellular matrix protein slit, conta 99.06
KOG4341483 consensus F-box protein containing LRR [General fu 99.03
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.95
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.93
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.91
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.83
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.8
PRK15386 426 type III secretion protein GogB; Provisional 98.58
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.54
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.54
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.53
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.53
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.51
PRK15386 426 type III secretion protein GogB; Provisional 98.47
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.46
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.42
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.4
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.22
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.16
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.04
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.94
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.85
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.84
PLN03150623 hypothetical protein; Provisional 97.74
PLN03150623 hypothetical protein; Provisional 97.73
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.59
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.58
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.51
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.48
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.44
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.42
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.99
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.89
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.74
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.44
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.43
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.4
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.39
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.33
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.93
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 95.65
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.47
KOG2982418 consensus Uncharacterized conserved protein [Funct 95.02
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 94.32
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.21
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.13
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.94
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 93.86
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.42
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 92.82
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.3
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 91.86
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 89.89
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 89.82
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 85.99
smart0037026 LRR Leucine-rich repeats, outliers. 83.14
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 83.14
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=99.89  E-value=5.1e-22  Score=206.37  Aligned_cols=274  Identities=21%  Similarity=0.319  Sum_probs=172.5

Q ss_pred             cccceeecccccccccccccccccccCCCCCCcCCccEEEEecCCCccccccCC-CCCCcccceecc------------c
Q 043298           20 SSLKNLQIRDCYNIRTLTVEEGIQCSSGRRYTSSLLEELFVFNCDSLTCIFSKY-ELPATLESLEVG------------N   86 (357)
Q Consensus        20 ~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~-~~~~~L~~L~l~------------~   86 (357)
                      ++|+.|++.+++ ++.+|..       + ...  +|++|++.+ +.+..+ +.. ..+.+|+.|+++            .
T Consensus       589 ~~Lr~L~~~~~~-l~~lP~~-------f-~~~--~L~~L~L~~-s~l~~L-~~~~~~l~~Lk~L~Ls~~~~l~~ip~ls~  655 (1153)
T PLN03210        589 PKLRLLRWDKYP-LRCMPSN-------F-RPE--NLVKLQMQG-SKLEKL-WDGVHSLTGLRNIDLRGSKNLKEIPDLSM  655 (1153)
T ss_pred             cccEEEEecCCC-CCCCCCc-------C-Ccc--CCcEEECcC-cccccc-ccccccCCCCCEEECCCCCCcCcCCcccc
Confidence            456666666554 5555554       1 223  555666655 234444 433 445555555554            3


Q ss_pred             CCCcceEEEecCCCCchhchhccCCCCcccEEEcccccCccccCccccCccccceeecccCCCccccCCCCcCcccccEE
Q 043298           87 LPSSVKVLDVYGCPKLESIAERLDNNTSLETISIYNCENLKILPSGLHKLHQLREIWIRECGNLVSFPEGGLPCAKLRRL  166 (357)
Q Consensus        87 l~~~L~~L~l~~c~~~~~~~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~l~~L~~L  166 (357)
                      +++ |++|++++|..+..+|..++.+.+|+.|++++|+.++.+|..+ ++++|+.|++++|..+..+|..   .++|+.|
T Consensus       656 l~~-Le~L~L~~c~~L~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~i-~l~sL~~L~Lsgc~~L~~~p~~---~~nL~~L  730 (1153)
T PLN03210        656 ATN-LETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDI---STNISWL  730 (1153)
T ss_pred             CCc-ccEEEecCCCCccccchhhhccCCCCEEeCCCCCCcCccCCcC-CCCCCCEEeCCCCCCccccccc---cCCcCee
Confidence            455 7777777777777777666556667777777777777776544 5667777777777666555532   2355566


Q ss_pred             EeecCCCcccccccc------------------------------cCCCCCceEEecC--ccCCccC-CCCCCccceEEe
Q 043298          167 GIYDCERLEALPKGL------------------------------HNLSSLQELTIGG--ELPSLEE-DGLPTNLHSLDI  213 (357)
Q Consensus       167 ~l~~~~~~~~~~~~~------------------------------~~l~~L~~L~l~~--~~~~~~~-~~~~~~L~~L~l  213 (357)
                      +++++. +..+|..+                              ...++|+.|++++  ....+|. .+.+++|+.|++
T Consensus       731 ~L~~n~-i~~lP~~~~l~~L~~L~l~~~~~~~l~~~~~~l~~~~~~~~~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~L  809 (1153)
T PLN03210        731 DLDETA-IEEFPSNLRLENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEI  809 (1153)
T ss_pred             ecCCCc-cccccccccccccccccccccchhhccccccccchhhhhccccchheeCCCCCCccccChhhhCCCCCCEEEC
Confidence            655533 33333211                              1124566677665  3444554 455678888888


Q ss_pred             cCCcchhhhhhhcccccCCCCCcceEEeecCCCCCCcCccccccccCCCCCCCCccEEEcCccccCcccccccccccccC
Q 043298          214 WGNMEIWKSMIERGRGFHRFSSLGHLKIGGCDDDMVSFPLEDKRLGTALPLPASLTSLWIEDFPNLEHLSSSIVDLQNLT  293 (357)
Q Consensus       214 ~~~~~l~~~~~~~~~~l~~~~~L~~L~l~~~c~~l~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~i~~~~~~~~~L~  293 (357)
                      ++|..+..+|..     ..+++|+.|++++ |..+..++.          .+.+|+.|++++ +.++.+|.++..+++|+
T Consensus       810 s~C~~L~~LP~~-----~~L~sL~~L~Ls~-c~~L~~~p~----------~~~nL~~L~Ls~-n~i~~iP~si~~l~~L~  872 (1153)
T PLN03210        810 ENCINLETLPTG-----INLESLESLDLSG-CSRLRTFPD----------ISTNISDLNLSR-TGIEEVPWWIEKFSNLS  872 (1153)
T ss_pred             CCCCCcCeeCCC-----CCccccCEEECCC-CCccccccc----------cccccCEeECCC-CCCccChHHHhcCCCCC
Confidence            888777776632     2577888888888 777776664          336777888877 56777777777788888


Q ss_pred             eeccccCCCCcccCCC-CCccCCceEEecCChhhHHH
Q 043298          294 SLGLYNCPKLKYFPEK-GLPSSLLLLWIEGCPLIEEK  329 (357)
Q Consensus       294 ~L~l~~c~~l~~l~~~-~~~~~L~~L~i~~c~~l~~~  329 (357)
                      .|++.+|++++.++.. ..+++|+.+++++|++|+++
T Consensus       873 ~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~~L~~~  909 (1153)
T PLN03210        873 FLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEA  909 (1153)
T ss_pred             EEECCCCCCcCccCcccccccCCCeeecCCCcccccc
Confidence            8888888888777663 23567777788888777643

syringae 6; Provisional
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query357
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 1e-04
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 3e-04
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure 
Iteration: 1

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 73/162 (45%), Gaps = 19/162 (11%)
Query: 55  LEELFVFNCDSLTCIFSKYELPATLESLEVGNLPSSVKVLDVYGC--PKLESIAERLDNN 112
           L EL +  C  LT      ELP  L S +       +  L         + S+   + N 
Sbjct: 152 LRELSIRACPELT------ELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANL 205
Query: 113 TSLETISIYNCENLKILPSGLHKLHQLREIWIRECGNLVSFPE--GGLPCAKLRRLGIYD 170
            +L+++ I N   L  L   +H L +L E+ +R C  L ++P   GG   A L+RL + D
Sbjct: 206 QNLKSLKIRNSP-LSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGR--APLKRLILKD 262
Query: 171 CERLEALPKGLHNLSSLQELTIGG-----ELPSLEEDGLPTN 207
           C  L  LP  +H L+ L++L + G      LPSL    LP N
Sbjct: 263 CSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQ-LPAN 303
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query357
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-09
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-05
4fdw_A401 Leucine rich hypothetical protein; putative cell s 1e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 88.5 bits (220), Expect = 4e-20
 Identities = 62/330 (18%), Positives = 100/330 (30%), Gaps = 52/330 (15%)

Query: 20  SSLKNLQIRDCYNIRT----------LTVEEGIQCSSGRRYTSSLLEELFVFNCDSLTCI 69
           S  +NL  +    +R               +  +  S  R  +S   ++      +L   
Sbjct: 12  SGRENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQANSNNPQIETRTGRALK-- 69

Query: 70  FSKYELPATLESLEVGNLPSSVKVLDVYGCPKLESIAERLDNNTSLETISIYNCENLKIL 129
                    LE             L++     L    ++    + L+ ++I     L  L
Sbjct: 70  ----ATADLLEDATQPGR----VALELRSV-PLPQFPDQAFRLSHLQHMTIDAA-GLMEL 119

Query: 130 PSGLHKLHQLREIWIRECGNLVSFPEGGLPCAKLRRLGIYDCERLEALPKGL-------- 181
           P  + +   L  + +     L + P       +LR L I  C  L  LP+ L        
Sbjct: 120 PDTMQQFAGLETLTLARN-PLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGE 178

Query: 182 -HNLSSLQELTIGG----ELPSLEEDGLPTNLHSLDIWGNMEIWKSMIERGRGFHRFSSL 236
              L +LQ L +       LP         NL SL I  +      +   G   H    L
Sbjct: 179 HQGLVNLQSLRLEWTGIRSLP--ASIANLQNLKSLKIRNS-----PLSALGPAIHHLPKL 231

Query: 237 GHLKIGGCDDDMVSFPLEDKRLGTALPLPASLTSLWIEDFPNLEHLSSSIVDLQNLTSLG 296
             L + GC   + ++P             A L  L ++D  NL  L   I  L  L  L 
Sbjct: 232 EELDLRGC-TALRNYPPIFGGR-------APLKRLILKDCSNLLTLPLDIHRLTQLEKLD 283

Query: 297 LYNCPKLKYFPEK-GLPSSLLLLWIEGCPL 325
           L  C  L   P       +  ++ +     
Sbjct: 284 LRGCVNLSRLPSLIAQLPANCIILVPPHLQ 313
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Length = 401 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query357
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.91
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.91
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.9
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.9
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.9
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.9
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.89
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.89
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.89
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.89
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.89
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.89
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.89
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.89
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.88
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.88
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.88
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.88
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.88
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.88
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.87
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.87
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.87
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.87
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.87
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.86
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.86
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.86
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.86
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.86
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.86
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.85
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.84
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.84
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.84
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.84
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.83
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.82
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.82
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.81
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.81
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.8
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.8
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.8
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.8
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.8
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.8
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.77
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.77
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.77
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.77
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.76
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.74
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.73
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.73
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.71
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.7
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.7
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.7
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.69
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.69
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.67
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.67
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.66
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.66
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.66
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.65
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.65
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.62
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.62
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.61
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.6
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.58
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.58
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.57
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.57
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.57
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.56
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.56
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.56
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.55
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.53
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.48
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.47
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.47
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.46
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.43
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.42
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.42
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.41
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.41
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.41
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.4
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.39
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.36
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.34
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.34
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.32
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.31
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.31
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.31
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.3
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.3
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.3
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.28
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.28
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.28
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.25
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.23
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.2
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.16
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.15
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.14
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.1
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.1
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.1
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.07
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.03
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.02
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.02
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.97
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.97
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.89
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.89
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.84
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.75
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.73
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.7
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.69
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.63
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.61
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.55
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.5
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.45
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.35
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.25
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.22
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.22
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.2
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.17
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.1
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.0
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.98
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.91
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.48
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.34
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.31
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.32
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 92.56
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 81.55
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
Probab=99.93  E-value=2.4e-24  Score=196.02  Aligned_cols=288  Identities=20%  Similarity=0.174  Sum_probs=163.9

Q ss_pred             ccccceeecccccccccccccccccccCCCCCCcCCccEEEEecCCCccccccCCCCCCcccceecc-----------cC
Q 043298           19 PSSLKNLQIRDCYNIRTLTVEEGIQCSSGRRYTSSLLEELFVFNCDSLTCIFSKYELPATLESLEVG-----------NL   87 (357)
Q Consensus        19 ~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~L~~L~l~-----------~l   87 (357)
                      +++|++|+++++. +..++.        +..++  +|++|++++| .++.+ +....+++|+.|+++           .+
T Consensus        43 l~~L~~L~l~~~~-i~~~~~--------~~~~~--~L~~L~l~~n-~i~~~-~~~~~l~~L~~L~L~~n~i~~~~~~~~l  109 (347)
T 4fmz_A           43 LESITKLVVAGEK-VASIQG--------IEYLT--NLEYLNLNGN-QITDI-SPLSNLVKLTNLYIGTNKITDISALQNL  109 (347)
T ss_dssp             HTTCSEEECCSSC-CCCCTT--------GGGCT--TCCEEECCSS-CCCCC-GGGTTCTTCCEEECCSSCCCCCGGGTTC
T ss_pred             cccccEEEEeCCc-cccchh--------hhhcC--CccEEEccCC-ccccc-hhhhcCCcCCEEEccCCcccCchHHcCC
Confidence            4555555555554 444442        13344  5555555553 34444 334445555555554           55


Q ss_pred             CCcceEEEecCCCCchhchhccCCCCcccEEEcccccCccccCccccCccccceeecccCCCccccCCCCcCcccccEEE
Q 043298           88 PSSVKVLDVYGCPKLESIAERLDNNTSLETISIYNCENLKILPSGLHKLHQLREIWIRECGNLVSFPEGGLPCAKLRRLG  167 (357)
Q Consensus        88 ~~~L~~L~l~~c~~~~~~~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~l~~L~~L~  167 (357)
                      ++ |++|++++ +.++.++... .+.+|+.|++++|..+..++ .+..+++|+.|++++|. +..++. +..+++|+.|+
T Consensus       110 ~~-L~~L~l~~-n~i~~~~~~~-~l~~L~~L~l~~n~~~~~~~-~~~~l~~L~~L~l~~~~-~~~~~~-~~~l~~L~~L~  183 (347)
T 4fmz_A          110 TN-LRELYLNE-DNISDISPLA-NLTKMYSLNLGANHNLSDLS-PLSNMTGLNYLTVTESK-VKDVTP-IANLTDLYSLS  183 (347)
T ss_dssp             TT-CSEEECTT-SCCCCCGGGT-TCTTCCEEECTTCTTCCCCG-GGTTCTTCCEEECCSSC-CCCCGG-GGGCTTCSEEE
T ss_pred             Cc-CCEEECcC-CcccCchhhc-cCCceeEEECCCCCCccccc-chhhCCCCcEEEecCCC-cCCchh-hccCCCCCEEE
Confidence            66 77777777 4566665533 45557777777765555443 36677777777777753 333333 55567777777


Q ss_pred             eecCCCcccccccccCCCCCceEEecC-ccCCccCCCCCCccceEEecCCcchhhhhhhcccccCCCCCcceEEeecCCC
Q 043298          168 IYDCERLEALPKGLHNLSSLQELTIGG-ELPSLEEDGLPTNLHSLDIWGNMEIWKSMIERGRGFHRFSSLGHLKIGGCDD  246 (357)
Q Consensus       168 l~~~~~~~~~~~~~~~l~~L~~L~l~~-~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~l~~~~~L~~L~l~~~c~  246 (357)
                      +++|. +..++. +..+++|+.+++.+ .+..++....+++|++|++++| .++..++     +..+++|++|++++ | 
T Consensus       184 l~~n~-l~~~~~-~~~l~~L~~L~l~~n~l~~~~~~~~~~~L~~L~l~~n-~l~~~~~-----~~~l~~L~~L~l~~-n-  253 (347)
T 4fmz_A          184 LNYNQ-IEDISP-LASLTSLHYFTAYVNQITDITPVANMTRLNSLKIGNN-KITDLSP-----LANLSQLTWLEIGT-N-  253 (347)
T ss_dssp             CTTSC-CCCCGG-GGGCTTCCEEECCSSCCCCCGGGGGCTTCCEEECCSS-CCCCCGG-----GTTCTTCCEEECCS-S-
T ss_pred             ccCCc-cccccc-ccCCCccceeecccCCCCCCchhhcCCcCCEEEccCC-ccCCCcc-----hhcCCCCCEEECCC-C-
Confidence            77654 333432 66677777777777 5555544555667777777774 3444441     46667777777777 3 


Q ss_pred             CCCcCccccccccCCCCCCCCccEEEcCccccCcccccccccccccCeeccccCCCCcccCCC--CCccCCceEEecCCh
Q 043298          247 DMVSFPLEDKRLGTALPLPASLTSLWIEDFPNLEHLSSSIVDLQNLTSLGLYNCPKLKYFPEK--GLPSSLLLLWIEGCP  324 (357)
Q Consensus       247 ~l~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~i~~~~~~~~~L~~L~l~~c~~l~~l~~~--~~~~~L~~L~i~~c~  324 (357)
                      .+..++. .       ..+++|++|++++| .+..++ .+..+++|++|++.+| .++..+..  +.+++|++|++++|+
T Consensus       254 ~l~~~~~-~-------~~l~~L~~L~l~~n-~l~~~~-~~~~l~~L~~L~L~~n-~l~~~~~~~l~~l~~L~~L~L~~n~  322 (347)
T 4fmz_A          254 QISDINA-V-------KDLTKLKMLNVGSN-QISDIS-VLNNLSQLNSLFLNNN-QLGNEDMEVIGGLTNLTTLFLSQNH  322 (347)
T ss_dssp             CCCCCGG-G-------TTCTTCCEEECCSS-CCCCCG-GGGGCTTCSEEECCSS-CCCGGGHHHHHTCTTCSEEECCSSS
T ss_pred             ccCCChh-H-------hcCCCcCEEEccCC-ccCCCh-hhcCCCCCCEEECcCC-cCCCcChhHhhccccCCEEEccCCc
Confidence            4444432 2       35667777777774 455553 3566777777777775 34433321  124677777777764


Q ss_pred             hhHHHhhcCCCccccccCCcceEEEeeEE
Q 043298          325 LIEEKCRKDGGQYWDLLTHIPYVVIDWKW  353 (357)
Q Consensus       325 ~l~~~~~~~~~~~~~~~~~~~~~~~~~~~  353 (357)
                       ++....      +...+.+..+++.++.
T Consensus       323 -l~~~~~------~~~l~~L~~L~l~~N~  344 (347)
T 4fmz_A          323 -ITDIRP------LASLSKMDSADFANQV  344 (347)
T ss_dssp             -CCCCGG------GGGCTTCSEESSSCC-
T ss_pred             -cccccC------hhhhhccceeehhhhc
Confidence             222111      3345556666555544
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 357
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-04
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 38.9 bits (89), Expect = 7e-04
 Identities = 30/156 (19%), Positives = 49/156 (31%), Gaps = 25/156 (16%)

Query: 86  NLPSSVKVLDVYGCPKLESIAERLDNNTSLETISIYNCENLKILPSGLHKLHQLREIWIR 145
           +LP    +LD+      E       N  +L T+ + N +  KI P     L +L  +++ 
Sbjct: 28  DLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLS 87

Query: 146 ECGNLVSFPEG------------------------GLPCAKLRRLGIYDCERLEALPKGL 181
           +   L   PE                         GL    +  LG    +         
Sbjct: 88  KN-QLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAF 146

Query: 182 HNLSSLQELTIGGELPSLEEDGLPTNLHSLDIWGNM 217
             +  L  + I     +    GLP +L  L + GN 
Sbjct: 147 QGMKKLSYIRIADTNITTIPQGLPPSLTELHLDGNK 182

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query357
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.82
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.8
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.74
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.73
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.72
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.7
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.68
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.65
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.63
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.62
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.61
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.58
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.53
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.52
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.47
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.46
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.44
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.43
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.42
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.42
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.42
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.42
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.07
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.04
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.04
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.02
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.02
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.99
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.6
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.59
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.58
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.58
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.44
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.07
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.01
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.98
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.34
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.09
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.46
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.23
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 93.47
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 91.6
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.82  E-value=5e-19  Score=160.50  Aligned_cols=192  Identities=18%  Similarity=0.158  Sum_probs=126.0

Q ss_pred             ccccCccccceeecccCCCccccCCCCcCcccccEEEeecCCCcccccccccCCCCCceEEecC-ccCCccCCCCCCccc
Q 043298          131 SGLHKLHQLREIWIRECGNLVSFPEGGLPCAKLRRLGIYDCERLEALPKGLHNLSSLQELTIGG-ELPSLEEDGLPTNLH  209 (357)
Q Consensus       131 ~~~~~l~~L~~L~l~~~~~l~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~-~~~~~~~~~~~~~L~  209 (357)
                      .....+++++.++++++ .+..++. ...+++|+.+++++|. ++.++ .+..+++|+.+++.+ .++.++....+++|+
T Consensus       191 ~~~~~l~~~~~l~l~~n-~i~~~~~-~~~~~~L~~L~l~~n~-l~~~~-~l~~l~~L~~L~l~~n~l~~~~~~~~~~~L~  266 (384)
T d2omza2         191 SVLAKLTNLESLIATNN-QISDITP-LGILTNLDELSLNGNQ-LKDIG-TLASLTNLTDLDLANNQISNLAPLSGLTKLT  266 (384)
T ss_dssp             GGGGGCTTCSEEECCSS-CCCCCGG-GGGCTTCCEEECCSSC-CCCCG-GGGGCTTCSEEECCSSCCCCCGGGTTCTTCS
T ss_pred             cccccccccceeeccCC-ccCCCCc-ccccCCCCEEECCCCC-CCCcc-hhhcccccchhccccCccCCCCcccccccCC
Confidence            34556778888888774 3444432 3345688888888754 44443 567778888888887 777666667778888


Q ss_pred             eEEecCCcchhhhhhhcccccCCCCCcceEEeecCCCCCCcCccccccccCCCCCCCCccEEEcCccccCcccccccccc
Q 043298          210 SLDIWGNMEIWKSMIERGRGFHRFSSLGHLKIGGCDDDMVSFPLEDKRLGTALPLPASLTSLWIEDFPNLEHLSSSIVDL  289 (357)
Q Consensus       210 ~L~l~~~~~l~~~~~~~~~~l~~~~~L~~L~l~~~c~~l~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~i~~~~~~~  289 (357)
                      .|+++++ .+..+++     +..++.++.+.+..  ..+..++..        ..+++++.|+++++ .+..++ .+..+
T Consensus       267 ~L~l~~~-~l~~~~~-----~~~~~~l~~l~~~~--n~l~~~~~~--------~~~~~l~~L~ls~n-~l~~l~-~l~~l  328 (384)
T d2omza2         267 ELKLGAN-QISNISP-----LAGLTALTNLELNE--NQLEDISPI--------SNLKNLTYLTLYFN-NISDIS-PVSSL  328 (384)
T ss_dssp             EEECCSS-CCCCCGG-----GTTCTTCSEEECCS--SCCSCCGGG--------GGCTTCSEEECCSS-CCSCCG-GGGGC
T ss_pred             EeeccCc-ccCCCCc-----cccccccccccccc--ccccccccc--------chhcccCeEECCCC-CCCCCc-ccccC
Confidence            8888774 4444442     36677778888777  344444432        25677888888874 566665 35778


Q ss_pred             cccCeeccccCCCCcccCCCCCccCCceEEecCChhhHHHhhcCCCccccccCCcceEEEeeE
Q 043298          290 QNLTSLGLYNCPKLKYFPEKGLPSSLLLLWIEGCPLIEEKCRKDGGQYWDLLTHIPYVVIDWK  352 (357)
Q Consensus       290 ~~L~~L~l~~c~~l~~l~~~~~~~~L~~L~i~~c~~l~~~~~~~~~~~~~~~~~~~~~~~~~~  352 (357)
                      ++|++|++++| +++.++.-+.+++|++|++++| .++.+.      .+..++++..+++.++
T Consensus       329 ~~L~~L~L~~n-~l~~l~~l~~l~~L~~L~l~~N-~l~~l~------~l~~l~~L~~L~L~~N  383 (384)
T d2omza2         329 TKLQRLFFANN-KVSDVSSLANLTNINWLSAGHN-QISDLT------PLANLTRITQLGLNDQ  383 (384)
T ss_dssp             TTCCEEECCSS-CCCCCGGGGGCTTCCEEECCSS-CCCBCG------GGTTCTTCSEEECCCE
T ss_pred             CCCCEEECCCC-CCCCChhHcCCCCCCEEECCCC-cCCCCh------hhccCCCCCEeeCCCC
Confidence            88888888875 6766654334678888888776 343321      1445667777777665
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure