Citrus Sinensis ID: 043317


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700
YSGSLTNLYIFLTGLANLTILQVLDLSGSSSNCLKYLSHLKVLDISHNQLSGSLSSTITSLTSLEYLDLSYNNFEGPCPLSSLANHSKLEVLLLSSTNNMLLVKTENFLPTFQLKVLELANCSLNVVPTFLLHQYDLKYLDLSLNNLVGDFPSWMLQNNTKLEVLFLTNNSFTGNLRLPNTKHDFLHHLDASSNNFIGTLPQDMGTILKKLLVLDISNNHFEGNIPSSVGEMKELIILHLSKNNFSEDFSTPFLTGCISLWFLDLSDNNFYGQFFSKDLNLTQMEFLYLENNKFSGKIEEGLLNSTKLYQLDISHNFLSGHIPHWMGNFSNLEILLMSNNCLEGNIPVQLLNHRTLKLLSVSENYLSGSMTSSFNLSSLKHLYVQKNALSGPIPDMLFRSSKLMTLDLRGNNLEGQIPDQICQLRRLGMMDLSHNRFNGSIPSCFTNMLQWTIENVDLFGGELSIFPPLGFCYIGTYYNSTLDLEVCKRDMFTSPQQVKVEFVTKNRYELYNGSNLNYMVGLDLSCNELTGNVPSEIGDLQKIRGLNLSHNCLSGSIPRSFSNLQMIESLDLSNNRLSGQIPAQLIELNFLSNFNVSYNNLSGLIPDKGQYSTFDESSYRGNLYLCGPTINKSCNSAEETPAIKSKGREDEDDFVIDMVSLYWSFGASYVTVILGLFAILWINSFWRKRWFYFIDALIML
cEEccccccccccccccccccccccccccccHHccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEccccccccccccccccccccccEEEccccccccccHHHHccccccEEEcccccccccccHHHHcccccccEEEccccccEEEccccccccccccEEEccccccccccccHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccccHHcccccccEEEccccEEEEEccccccccccccEEEccccEEEEcccccccccccccEEEccccccccccccccccccccccEEccccEEEEEccHHHHccccccEEEccccccEEEcccccccccccEEEccccccccccHHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccccccccccccEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEccccccccccccHHHHcccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccEEcEEEEEEEEEEEEEHHHHHHHHHHHccccHHHHHHHHHHHHccc
ccccccHHHccHHHHHHHHHHHcccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHHcccccccEEEcccccccccccHHHHcccHHHHHHHHcccccccccHHHcccccccEEEEccccccccccHHHHHccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHHHHHHcccEEEcccccccccccHHHccccccEEEEEccccccccccHHHHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEccccccccccccccccccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccEEEEEEcccccccccccHHHccHHHHHHHccccccccccccccccEEEcccccccccccHHHccccccEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHHccHHHcccccEEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
YSGSLTNLYIFLTGLANLTILQVLdlsgsssnclkYLSHLKVLdishnqlsgslsstitslTSLEYLDlsynnfegpcplsslanhSKLEVLLLSSTNNMLLVKTENFLPTFQLKVLELANcslnvvptfllhqydlkyLDLSLnnlvgdfpswmlqnntkLEVLFLTnnsftgnlrlpntkhdflhhldassnnfigtlpQDMGTILKKLLVLDIsnnhfegnipssvGEMKELIILHLsknnfsedfstpfltgCISLWfldlsdnnfygqffskdlnlTQMEFLYLENNKFSGKIEEGLLNSTKLYQldishnflsghiphwmgnFSNLEILLMSNnclegnipvqllnhRTLKLLSVSenylsgsmtssfnlsslKHLYVQKnalsgpipdmlfrssklmtldlrgnnlegqipDQICQLRRLGmmdlshnrfngsipscFTNMLQWTIENVdlfggelsifpplgfcyigtyynstldlevckrdmftspqqvKVEFVTKNRyelyngsnlnymVGLDLScneltgnvpseigdlqkirglnlshnclsgsiprsfsnlQMIESLdlsnnrlsgqipAQLIELNFLSNFNVSynnlsglipdkgqystfdessyrgnlylcgptinkscnsaeetpaikskgrededdFVIDMVSLYWSFGASYVTVILGLFAILWINSFWRKRWFYFIDALIML
YSGSLTNLYIFLTGLANLTILQVLDLSGSSSNCLKYLSHLKVLDISHNQLSGSLSSTITSLTSLEYLDLSYNNFEGPCPLSSLANHSKLEVLLLSSTNNMLLVKTENFLPTFQLKVLELANCSLNVVPTFLLHQYDLKYLDLSLNNLVGDFPSWMLQNNTKLEVLFLTNNSFTGNLRLPNTKHDFLHHLDASSNNFIGTLPQDMGTILKKLLVLDISNNHFEGNIPSSVGEMKELIILHLSKNNFSEDFSTPFLTGCISLWFLDLSDNNFYGQFFSKDLNLTQMEFLYLENNKFSGKIEEGLLNSTKLYQLDISHNFLSGHIPHWMGNFSNLEILLMSNNCLEGNIPVQLLNHRTLKLLSVSENYLSGSMTSSFNLSSLKHLYVQKNALSGPIPDMLFRSSKLMTLDLRGNNLEGQIPDQICQLRRLGMMDLSHNRFNGSIPSCFTNMLQWTIENVDLFGGELSIFPPLGFCYIGTYYNSTLDLEVCKRDMFTSPQQVKVEFVTKNRYELYNGSNLNYMVGLDLSCNELTGNVPSEIGDLQKIRGLNLSHNCLSGSIPRSFSNLQMIESLDLSNNRLSGQIPAQLIELNFLSNFNVSYNNLSGLIPDKGQYSTFDESSYRGNLYLCGPTINKSCNSAEEtpaikskgrededdFVIDMVSLYWSFGASYVTVILGLFAILWINSFWRKRWFYFIDALIML
YSGSLTNLYIFLTGLANLTILQVLDLSGSSSNCLKYLSHLKVLDISHNQlsgslsstitsltslEYLDLSYNNFEGPCPLSSLANHSKLEVLLLSSTNNMLLVKTENFLPTFQLKVLELANCSLNVVPTFLLHQYDLKYLDLSLNNLVGDFPSWMLQNNTKLEVLFLTNNSFTGNLRLPNTKHDFLHHLDASSNNFIGTLPQDMGTILKKLLVLDISNNHFEGNIPSSVGEMKELIILHLSKNNFSEDFSTPFLTGCISLWFLDLSDNNFYGQFFSKDLNLTQMEFLYLENNKFSGKIEEGLLNSTKLYQLDISHNFLSGHIPHWMGNFSNLEILLMSNNCLEGNIPVQLLNHRTLKLLSVSENYLSGSMTSSFNLSSLKHLYVQKNALSGPIPDMLFRSSKLMTLDLRGNNLEGQIPDQICQLRRLGMMDLSHNRFNGSIPSCFTNMLQWTIENVDLFGGELSIFPPLGFCYIGTYYNSTLDLEVCKRDMFTSPQQVKVEFVTKNRYELYNGSNLNYMVGLDLSCNELTGNVPSEIGDLQKIRGLNLSHNCLSGSIPRSFSNLQMIESLDLSNNRLSGQIPAQLIELNFLSNFNVSYNNLSGLIPDKGQYSTFDESSYRGNLYLCGPTINKSCNSAEETPAIKSKGREDEDDFVIDMVSLYWSFGASYVTVILGLFAILWINSFWRKRWFYFIDALIML
****LTNLYIFLTGLANLTILQVLDLSGSSSNCLKYLSHLKVLDISHNQLSGSLSSTITSLTSLEYLDLSYNNFEGPCPLSSLANHSKLEVLLLSSTNNMLLVKTENFLPTFQLKVLELANCSLNVVPTFLLHQYDLKYLDLSLNNLVGDFPSWMLQNNTKLEVLFLTNNSFTGNLRLPNTKHDFLHHLDASSNNFIGTLPQDMGTILKKLLVLDISNNHFEGNIPSSVGEMKELIILHLSKNNFSEDFSTPFLTGCISLWFLDLSDNNFYGQFFSKDLNLTQMEFLYLENNKFSGKIEEGLLNSTKLYQLDISHNFLSGHIPHWMGNFSNLEILLMSNNCLEGNIPVQLLNHRTLKLLSVSENYLSGSMTSSFNLSSLKHLYVQKNALSGPIPDMLFRSSKLMTLDLRGNNLEGQIPDQICQLRRLGMMDLSHNRFNGSIPSCFTNMLQWTIENVDLFGGELSIFPPLGFCYIGTYYNSTLDLEVCKRDMFTSPQQVKVEFVTKNRYELYNGSNLNYMVGLDLSCNELTGNVPSEIGDLQKIRGLNLSHNCLSGSIPRSFSNLQMIESLDLSNNRLSGQIPAQLIELNFLSNFNVSYNNLSGLIPDKGQYSTFDESSYRGNLYLCGPTINK********************DFVIDMVSLYWSFGASYVTVILGLFAILWINSFWRKRWFYFIDALI**
YSGSLTNLYIFLTGLANLTILQVLDLSGSSSNCLKYLSHLKVLDISHNQLSGSLSSTITSLTSLEYLDLSYNNFEGPCPLSSLANHSKLEVLLLSSTNNMLLVKTENFLPTFQLKVLELANCSLNVVPTFLLHQYDLKYLDLSLNNLVGDFPSWMLQNNTKLEVLFLTNNSFTGNLRLPNTKHDFLHHLDASSNNFIGTLPQDMGTILKKLLVLDISNNHFEGNIPSSVGEMKELIILHLSKNNFSEDFSTPFLTGCISLWFLDLSDNNFYGQFFSKDLNLTQMEFLYLENNKFSGKIEEGLLNSTKLYQLDISHNFLSGHIPHWMGNFSNLEILLMSNNCLEGNIPVQLLNHRTLKLLSVSENYLSGSMTSSFNLSSLKHLYVQKNALSGPIPDMLFRSSKLMTLDLRGNNLEGQIPDQICQLRRLGMMDLSHNRFNGSIPSCFTNMLQWTIENVDLFGGELSIFPPLGFCYIGTYYNSTLDLEVCKRDMFTSPQQVKVEFVTKNRYELYNGSNLNYMVGLDLSCNELTGNVPSEIGDLQKIRGLNLSHNCLSGSIPRSFSNLQMIESLDLSNNRLSGQIPAQLIELNFLSNFNVSYNNLSGLIPDKGQYSTFDESSYRGNLYLCGP*****************************MVSLYWSFGASYVTVILGLFAILWINSFWRKRWFYFIDALIML
YSGSLTNLYIFLTGLANLTILQVLDLSGSSSNCLKYLSHLKVLDISHNQLSGSLSSTITSLTSLEYLDLSYNNFEGPCPLSSLANHSKLEVLLLSSTNNMLLVKTENFLPTFQLKVLELANCSLNVVPTFLLHQYDLKYLDLSLNNLVGDFPSWMLQNNTKLEVLFLTNNSFTGNLRLPNTKHDFLHHLDASSNNFIGTLPQDMGTILKKLLVLDISNNHFEGNIPSSVGEMKELIILHLSKNNFSEDFSTPFLTGCISLWFLDLSDNNFYGQFFSKDLNLTQMEFLYLENNKFSGKIEEGLLNSTKLYQLDISHNFLSGHIPHWMGNFSNLEILLMSNNCLEGNIPVQLLNHRTLKLLSVSENYLSGSMTSSFNLSSLKHLYVQKNALSGPIPDMLFRSSKLMTLDLRGNNLEGQIPDQICQLRRLGMMDLSHNRFNGSIPSCFTNMLQWTIENVDLFGGELSIFPPLGFCYIGTYYNSTLDLEVCKRDMFTSPQQVKVEFVTKNRYELYNGSNLNYMVGLDLSCNELTGNVPSEIGDLQKIRGLNLSHNCLSGSIPRSFSNLQMIESLDLSNNRLSGQIPAQLIELNFLSNFNVSYNNLSGLIPDKGQYSTFDESSYRGNLYLCGPTINKSCNSAEETPAIKSKGREDEDDFVIDMVSLYWSFGASYVTVILGLFAILWINSFWRKRWFYFIDALIML
*SGSLTNLYIFLTGLANLTILQVLDLSGSSSNCLKYLSHLKVLDISHNQLSGSLSSTITSLTSLEYLDLSYNNFEGPCPLSSLANHSKLEVLLLSSTNNMLLVKTENFLPTFQLKVLELANCSLNVVPTFLLHQYDLKYLDLSLNNLVGDFPSWMLQNNTKLEVLFLTNNSFTGNLRLPNTKHDFLHHLDASSNNFIGTLPQDMGTILKKLLVLDISNNHFEGNIPSSVGEMKELIILHLSKNNFSEDFSTPFLTGCISLWFLDLSDNNFYGQFFSKDLNLTQMEFLYLENNKFSGKIEEGLLNSTKLYQLDISHNFLSGHIPHWMGNFSNLEILLMSNNCLEGNIPVQLLNHRTLKLLSVSENYLSGSMTSSFNLSSLKHLYVQKNALSGPIPDMLFRSSKLMTLDLRGNNLEGQIPDQICQLRRLGMMDLSHNRFNGSIPSCFTNMLQWTIENVDLFGGELSIFPPLGFCYIGTYYNSTLDLEVCKRDMFTSPQQVKVEFVTKNRYELYNGSNLNYMVGLDLSCNELTGNVPSEIGDLQKIRGLNLSHNCLSGSIPRSFSNLQMIESLDLSNNRLSGQIPAQLIELNFLSNFNVSYNNLSGLIPDKGQYSTFDESSYRGNLYLCGPTINKSCN*****************DFVIDMVSLYWSFGASYVTVILGLFAILWINSFWRKRWFYFIDALIML
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YSGSLTNLYIFLTGLANLTILQVLDLSGSSSNCLKYLSHLKVLDISHNQLSGSLSSTITSLTSLEYLDLSYNNFEGPCPLSSLANHSKLEVLLLSSTNNMLLVKTENFLPTFQLKVLELANCSLNVVPTFLLHQYDLKYLDLSLNNLVGDFPSWMLQNNTKLEVLFLTNNSFTGNLRLPNTKHDFLHHLDASSNNFIGTLPQDMGTILKKLLVLDISNNHFEGNIPSSVGEMKELIILHLSKNNFSEDFSTPFLTGCISLWFLDLSDNNFYGQFFSKDLNLTQMEFLYLENNKFSGKIEEGLLNSTKLYQLDISHNFLSGHIPHWMGNFSNLEILLMSNNCLEGNIPVQLLNHRTLKLLSVSENYLSGSMTSSFNLSSLKHLYVQKNALSGPIPDMLFRSSKLMTLDLRGNNLEGQIPDQICQLRRLGMMDLSHNRFNGSIPSCFTNMLQWTIENVDLFGGELSIFPPLGFCYIGTYYNSTLDLEVCKRDMFTSPQQVKVEFVTKNRYELYNGSNLNYMVGLDLSCNELTGNVPSEIGDLQKIRGLNLSHNCLSGSIPRSFSNLQMIESLDLSNNRLSGQIPAQLIELNFLSNFNVSYNNLSGLIPDKGQYSTFDESSYRGNLYLCGPTINKSCNSAEETPAIKSKGREDEDDFVIDMVSLYWSFGASYVTVILGLFAILWINSFWRKRWFYFIDALIML
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query700 2.2.26 [Sep-21-2011]
O22476 1196 Protein BRASSINOSTEROID I no no 0.797 0.466 0.324 5e-60
C0LGQ5 1249 LRR receptor-like serine/ no no 0.902 0.506 0.294 1e-58
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.895 0.519 0.310 3e-58
Q8L899 1207 Systemin receptor SR160 O N/A no 0.897 0.520 0.306 8e-58
Q8LPB4 1021 Phytosulfokine receptor 1 N/A no 0.787 0.539 0.323 2e-55
Q9LHP4 1141 Receptor-like protein kin no no 0.802 0.492 0.314 7e-54
Q9ZPS9 1143 Serine/threonine-protein no no 0.831 0.509 0.304 1e-53
Q9LRT1 1016 Probably inactive leucine no no 0.788 0.543 0.315 3e-53
O82318 960 Probably inactive leucine no no 0.848 0.618 0.298 7e-53
O80809720 Leucine-rich repeat recep no no 0.837 0.813 0.313 4e-52
>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 Back     alignment and function desciption
 Score =  233 bits (593), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 212/653 (32%), Positives = 306/653 (46%), Gaps = 95/653 (14%)

Query: 23  VLDLSGSSSNCLKYLSHLKVLDISHNQLSGS-LSSTITS--LTSLEYLDLSYNNFEGPCP 79
            LD  G  S  LK L+ L+VLD+S N +SG+ +   + S     L++L +S N   G   
Sbjct: 159 TLDFPGKVSGGLK-LNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD 217

Query: 80  LSSLANHSKLEVLLLSSTNNMLLVKTENFLPTFQLKVLELANCSLNVVPTFLLHQYDLKY 139
           +S   N   LE L +SS N             F   +  L +CS             L++
Sbjct: 218 VSRCVN---LEFLDVSSNN-------------FSTGIPFLGDCSA------------LQH 249

Query: 140 LDLSLNNLVGDFPSWMLQNNTKLEVLFLTNNSFTGNLRLPNTKHDFLHHLDASSNNFIGT 199
           LD+S N L GDF S  +   T+L++L +++N F G   +P      L +L  + N F G 
Sbjct: 250 LDISGNKLSGDF-SRAISTCTELKLLNISSNQFVG--PIPPLPLKSLQYLSLAENKFTGE 306

Query: 200 LPQDMGTILKKLLVLDISNNHFEGNIPSSVG-------------------------EMKE 234
           +P  +      L  LD+S NHF G +P   G                         +M+ 
Sbjct: 307 IPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRG 366

Query: 235 LIILHLSKNNFSEDFSTPFLTGCISLWFLDLSDNNFYGQFFSKDLNLTQ-----MEFLYL 289
           L +L LS N FS +          SL  LDLS NNF G       NL Q     ++ LYL
Sbjct: 367 LKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILP---NLCQNPKNTLQELYL 423

Query: 290 ENNKFSGKIEEGLLNSTKLYQLDISHNFLSGHIPHWMGNFSNLEILLMSNNCLEGNIPVQ 349
           +NN F+GKI   L N ++L  L +S N+LSG IP  +G+ S L  L +  N LEG IP +
Sbjct: 424 QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE 483

Query: 350 LLNHRTLKLLSVSENYLSGSMTSSF-NLSSLKHLYVQKNALSGPIPDMLFRSSKLMTLDL 408
           L+  +TL+ L +  N L+G + S   N ++L  + +  N L+G IP  + R   L  L L
Sbjct: 484 LMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKL 543

Query: 409 RGNNLEGQIPDQICQLRRLGMMDLSHNRFNGSIPSCFTNMLQWTIENVDLFGGELSIFPP 468
             N+  G IP ++   R L  +DL+ N FNG+IP+           N     G+      
Sbjct: 544 SNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAAN--FIAGKR----- 596

Query: 469 LGFCYIGTYYNSTLDLEVCKRDMFTSPQQVKVE----FVTKN----RYELYNG------S 514
             + YI    N  +  E          Q ++ E      T+N       +Y G       
Sbjct: 597 --YVYI---KNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFD 651

Query: 515 NLNYMVGLDLSCNELTGNVPSEIGDLQKIRGLNLSHNCLSGSIPRSFSNLQMIESLDLSN 574
           N   M+ LD+S N L+G +P EIG +  +  LNL HN +SGSIP    +L+ +  LDLS+
Sbjct: 652 NNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSS 711

Query: 575 NRLSGQIPAQLIELNFLSNFNVSYNNLSGLIPDKGQYSTFDESSYRGNLYLCG 627
           N+L G+IP  +  L  L+  ++S NNLSG IP+ GQ+ TF  + +  N  LCG
Sbjct: 712 NKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCG 764




Receptor with a dual specificity kinase activity acting on both serine/threonine- and tyrosine-containing substrates. Regulates, in response to brassinosteroid binding, a signaling cascade involved in plant development, including expression of light- and stress-regulated genes, promotion of cell elongation, normal leaf and chloroplast senescence, and flowering. Binds brassinolide, and less effectively castasterone, but not 2,3,22,23-O-tetramethylbrassinolide or ecdysone. May be involved in a feedback regulation of brassinosteroid biosynthesis. Phosphorylates BRI1-associated receptor kinase 1 (BAK1), Transthyretin-Like protein (TTL) and SERK1 on 'Ser-299' and 'Thr-462' in vitro. May have a guanylyl cyclase activity.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description
>sp|Q8LPB4|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR PE=1 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LRT1|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|O80809|CLV2_ARATH Leucine-rich repeat receptor-like protein CLAVATA2 OS=Arabidopsis thaliana GN=CLV2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query700
255553269 2793 receptor-kinase, putative [Ricinus commu 0.92 0.230 0.465 1e-154
359482749 1067 PREDICTED: leucine-rich repeat receptor 0.97 0.636 0.442 1e-149
358345471 933 Receptor kinase [Medicago truncatula] gi 0.984 0.738 0.452 1e-148
238478394 1083 receptor like protein 1 [Arabidopsis tha 0.961 0.621 0.442 1e-147
240254032 1034 receptor like protein 1 [Arabidopsis tha 0.961 0.650 0.442 1e-147
238478392 913 receptor like protein 1 [Arabidopsis tha 0.961 0.737 0.442 1e-147
359483099 1231 PREDICTED: probable LRR receptor-like se 0.961 0.546 0.434 1e-145
359482735 1097 PREDICTED: receptor-like protein 12-like 0.967 0.617 0.434 1e-145
357468861 1016 Receptor-like protein kinase [Medicago t 0.942 0.649 0.441 1e-144
358345693 1011 Receptor-like protein kinase [Medicago t 0.942 0.652 0.441 1e-144
>gi|255553269|ref|XP_002517677.1| receptor-kinase, putative [Ricinus communis] gi|223543309|gb|EEF44841.1| receptor-kinase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  551 bits (1420), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 328/704 (46%), Positives = 446/704 (63%), Gaps = 60/704 (8%)

Query: 9    YIFLTGLANLTIL--QVLDLSGSSSNCLKYLSHLKVLDISHNQLSGSLSSTITSLTSLEY 66
            ++ L GL +L  L   V   SG    CL  L++L+VLD++ N+ SG++ S ++ LTSL+Y
Sbjct: 1204 FVGLCGLKSLLELGLSVNQFSGPLPQCLSNLTNLQVLDLTSNEFSGNIQSVVSKLTSLKY 1263

Query: 67   LDLSYNNFEGPCPLSSLANHSKLEVLLLSSTNNMLLVKTE--NFLPTFQLKVLELANCSL 124
            L LS N FEG    SSLANH KLE+  LSS + ML ++TE   + PTFQLKV++L NC+L
Sbjct: 1264 LFLSGNKFEGLFSFSSLANHKKLEIFELSSGSTMLELETEIPVWFPTFQLKVIDLPNCNL 1323

Query: 125  NV----VPTFLLHQYDLKYLDLSLNNLVGDFPSWMLQNNTKLEVLFLTNNSFTGNLRLPN 180
            N+    +P+FLL+Q+DL+++DLS NNL+G FPSW+LQNN++LEV+ + NNSFTG  +LP+
Sbjct: 1324 NLRTRRIPSFLLYQHDLQFIDLSHNNLIGAFPSWILQNNSRLEVMNMMNNSFTGTFQLPS 1383

Query: 181  TKHDFLHHLDASSNNFIGTLPQDMGTILKKLLVLDISNNHFEGNIPSSVGEMKELIILHL 240
             +H+ ++ L  SSN+  G +P+D+G +L  L  L++S N FEGNIPSS+ +M+ L IL L
Sbjct: 1384 YRHELIN-LKISSNSIAGQIPKDIGLLLSNLRYLNMSWNCFEGNIPSSISQMEGLSILDL 1442

Query: 241  SKNNFSEDFSTPFLTGCISLWFLDLSDNNFYGQFFSKDLNLTQMEFLYLENNKFSGKIEE 300
            S N FS +     L+    L  L LS+NNF G+ F + +NL ++  L + NN FSGKI+ 
Sbjct: 1443 SNNYFSGELPRSLLSNSTYLVALVLSNNNFQGRIFPETMNLEELTVLDMNNNNFSGKIDV 1502

Query: 301  GLLNSTKLYQLDISHNFLSGHIPHWMGNFSNLEILLMSNNCLEGNIPVQLLNHRTLKLLS 360
                  +L  LDIS N ++G IP                        +QL N  ++++L 
Sbjct: 1503 DFFYCPRLSVLDISKNKVAGVIP------------------------IQLCNLSSVEILD 1538

Query: 361  VSENYLSGSMTSSFNLSSLKHLYVQKNALSGPIPDMLFRSSKLMTLDLRGNNLEG----- 415
            +SEN   G+M S FN SSL++L++QKN L+G IP +L RSS L+ +DLR N   G     
Sbjct: 1539 LSENRFFGAMPSCFNASSLRYLFLQKNGLNGLIPHVLSRSSNLVVVDLRNNKFSGNIPSW 1598

Query: 416  -------------------QIPDQICQLRRLGMMDLSHNRFNGSIPSCFTNMLQWTIENV 456
                                IP+Q+CQLR L +MDLSHN   GSIPSCF N+   ++  V
Sbjct: 1599 ISQLSELHVLLLGGNALGGHIPNQLCQLRNLKIMDLSHNLLCGSIPSCFHNISFGSM--V 1656

Query: 457  DLFGGELSIFPPLGFCYIG-TYYNSTLDLEVCKRDMFTSPQQVKVEFVTKNRYELYNGSN 515
            +      SI   +   Y    YY +TL+L++     ++S  +V+VEF+ K RY  Y GS 
Sbjct: 1657 EESFSSSSIGVAMASHYDSYAYYKATLELDLPGLLSWSSSSEVQVEFIMKYRYNSYKGSV 1716

Query: 516  LNYMVGLDLSCNELTGNVPSEIGDLQKIRGLNLSHNCLSGSIPRSFSNLQMIESLDLSNN 575
            +N M G+DLS NEL G +PSEIGD+Q+IR LNLS+N LSGSIP SFSNL+ +ESLDL NN
Sbjct: 1717 INLMAGIDLSRNELRGEIPSEIGDIQEIRSLNLSYNHLSGSIPFSFSNLKNLESLDLRNN 1776

Query: 576  RLSGQIPAQLIELNFLSNFNVSYNNLSGLIPDKGQYSTFDESSYRGNLYLCGPTINKSCN 635
             LSG+IP QL+ELNFL  F+VSYNNLSG I +KGQ+ TFDESSY+GN  LCG  I++SCN
Sbjct: 1777 SLSGEIPTQLVELNFLGTFDVSYNNLSGRILEKGQFGTFDESSYKGNPELCGDLIHRSCN 1836

Query: 636  SAEETPAIKSKGREDEDDFVIDMVSLYWSFGASYVTVILGLFAI 679
            +   TP   S   ++ED+  IDM   YWSF ASYV      FA+
Sbjct: 1837 TEATTPPSPSPDVDEEDEGPIDMFWFYWSFCASYVIAFEMEFAM 1880




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359482749|ref|XP_002262614.2| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|358345471|ref|XP_003636801.1| Receptor kinase [Medicago truncatula] gi|355502736|gb|AES83939.1| Receptor kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|238478394|ref|NP_001154318.1| receptor like protein 1 [Arabidopsis thaliana] gi|332189998|gb|AEE28119.1| receptor like protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|240254032|ref|NP_172219.5| receptor like protein 1 [Arabidopsis thaliana] gi|332189996|gb|AEE28117.1| receptor like protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|238478392|ref|NP_001154317.1| receptor like protein 1 [Arabidopsis thaliana] gi|332189997|gb|AEE28118.1| receptor like protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|359483099|ref|XP_002262931.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482735|ref|XP_003632821.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357468861|ref|XP_003604715.1| Receptor-like protein kinase [Medicago truncatula] gi|355505770|gb|AES86912.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|358345693|ref|XP_003636910.1| Receptor-like protein kinase [Medicago truncatula] gi|355502845|gb|AES84048.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query700
TAIR|locus:2155909908 RLP56 "AT5G49290" [Arabidopsis 0.978 0.754 0.410 2.8e-130
TAIR|locus:20373131000 RLP13 "AT1G74170" [Arabidopsis 0.944 0.661 0.364 7.6e-96
TAIR|locus:2019662965 RLP15 "AT1G74190" [Arabidopsis 0.948 0.688 0.376 3.9e-92
TAIR|locus:2101943891 RLP45 "AT3G53240" [Arabidopsis 0.845 0.664 0.395 1.9e-90
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.934 0.699 0.366 3.1e-90
TAIR|locus:2037308976 RLP14 "AT1G74180" [Arabidopsis 0.957 0.686 0.348 1.1e-89
TAIR|locus:20250121083 RLP1 "AT1G07390" [Arabidopsis 0.965 0.624 0.364 1.4e-89
TAIR|locus:2091353 1016 AT3G28040 [Arabidopsis thalian 0.712 0.491 0.335 8.2e-62
TAIR|locus:2094613784 RLP38 "receptor like protein 3 0.927 0.827 0.300 2.7e-61
TAIR|locus:2206245720 CLV2 "clavata 2" [Arabidopsis 0.834 0.811 0.327 5.5e-61
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1278 (454.9 bits), Expect = 2.8e-130, P = 2.8e-130
 Identities = 290/706 (41%), Positives = 412/706 (58%)

Query:     1 YSGSLTNLYIFLTGLANLTILQVLDLSGSSSNCLKYLSHLKVLDISHNQXXXXXXXXXXX 60
             YS     ++  +  L  L  L+ ++  G    C   L+ L+ LD+S NQ           
Sbjct:   208 YSSMEWQVFCEMKNLQELD-LRGINFVGQLPLCFGNLNKLRFLDLSSNQLTGNIPPSFSS 266

Query:    61 XXXXEYLDLSYNNFEGPCPLSSLANHSKLEVLLLSSTNNMLLVKTEN-FLPTFQLKVLEL 119
                 EYL LS N+FEG   L+ L N +KL+V + SS ++M+ VK E+ + P FQL VL L
Sbjct:   267 LESLEYLSLSDNSFEGFFSLNPLTNLTKLKVFIFSSKDDMVQVKIESTWQPLFQLSVLVL 326

Query:   120 ANCSLNVVPTFLLHQYDLKYLDLSLNNLVGDFPSWMLQNNTKLEVLFLTNNSFTGNLRLP 179
               CSL  +P FL++Q +L  +DLS N + G  P+W+L+NN +LEVL L NNSFT   ++P
Sbjct:   327 RLCSLEKIPNFLMYQKNLHVVDLSGNRISGIIPTWLLENNPELEVLQLKNNSFT-IFQMP 385

Query:   180 NTKHDFLHHLDASSNNFIGTLPQDMGTILKKLLVLDISNNHFEGNIPSSVGEMKELIILH 239
              + H+ L  LD S NN  G  P + G +L  L+ ++ SNN F+GN PSS+GEM  +  L 
Sbjct:   386 TSVHN-LQVLDFSENNIGGLFPDNFGRVLPNLVHMNGSNNGFQGNFPSSMGEMYNISFLD 444

Query:   240 LSKNNFSEDFSTPFLTGCISLWFLDLSDNNFYGQFFSKDLNLTQMEFLYLENNKFSGKIE 299
             LS NN S +    F++ C SL  L LS N F G F  +  N T +  L + NN F+GKI 
Sbjct:   445 LSYNNLSGELPQSFVSSCFSLSILQLSHNKFSGHFLPRQTNFTSLIVLRINNNLFTGKIG 504

Query:   300 EGLLNSTKLYQLDISHNFLSGHIPHWMGNFSNLEILLMSNNCLEGNIPVQLLNHRTL-KL 358
              GLL    L  LD+S+NFL G +P  +  F  L  L +S N L G +P    +H +L  +
Sbjct:   505 VGLLTLVDLCILDMSNNFLEGELPPLLLVFEYLNFLDLSGNLLSGALP----SHVSLDNV 560

Query:   359 LSVSENYLSGSMTSSFNLSSLKHLYVQKNALSGPIPDMLFRSSKLMTLDLRGNNLEGQIP 418
             L +  N  +G +  +F L S++ L ++ N LSG IP  +  +  +  L LRGN+L G IP
Sbjct:   561 LFLHNNNFTGPIPDTF-LGSIQILDLRNNKLSGNIPQFV-DTQDISFLLLRGNSLTGYIP 618

Query:   419 DQICQLRRLGMMDLSHNRFNGSIPSCFTNMLQWTIENVDLFGGELSIFPPLGFCYIGTYY 478
               +C+  ++ ++DLS N+ NG IPSCF N+        ++    +++   L   Y+G +Y
Sbjct:   619 STLCEFSKMRLLDLSDNKLNGFIPSCFNNLSFGLARKEEITNYYVAV--ALESFYLG-FY 675

Query:   479 NSTLDLEVCKRDMFTSPQQVKVEFVTKNRYELYNGS------NLNYMVGLDLSCNELTGN 532
              ST  +E  + D +++  ++ V+F TK RY+ Y G+       LN M GLDLS NEL+G 
Sbjct:   676 KSTFVVENFRLD-YSNYFEIDVKFATKQRYDSYIGAFQFSEGTLNSMYGLDLSSNELSGV 734

Query:   533 VPSEIGDLQKIRGLNLSHNCLSGSIPRSFSNLQMIESLDLSNNRLSGQIPAQLIELNFLS 592
             +P+E+GDL K+R LNLSHN LS  IP SFS LQ IESLDLS N L G IP QL  L  L+
Sbjct:   735 IPAELGDLFKLRALNLSHNFLSSHIPDSFSKLQDIESLDLSYNMLQGSIPHQLTNLTSLA 794

Query:   593 NFNVSYNNLSGLIPDKGQYSTFDESSYRGNLYLCGPTINKSCNSAEETPAIKSKGREDED 652
              FNVSYNNLSG+IP   Q++TFDE+SY GN  LCGP  + SC + + +    + G ED+ 
Sbjct:   795 IFNVSYNNLSGIIPQGKQFNTFDENSYLGNPLLCGPPTDTSCETKKNSEENANGGEEDDK 854

Query:   653 DFVIDMVSLYWSFGASYVTVILGLFAILWINSFWRKRWFYFIDALI 698
             +  IDM+  YWS   +YVT ++G+  ++ ++  WR+ W   +DA I
Sbjct:   855 EVAIDMLVFYWSTAGTYVTALIGILVLMCVDCSWRRAWLRLVDAFI 900


GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091353 AT3G28040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094613 RLP38 "receptor like protein 38" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206245 CLV2 "clavata 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
AtRLP1
protein binding; Receptor Like Protein 1 (AtRLP1); FUNCTIONS IN- protein binding; INVOLVED IN- signal transduction; LOCATED IN- cellular_component unknown; EXPRESSED IN- 22 plant structures; EXPRESSED DURING- 13 growth stages; CONTAINS InterPro DOMAIN/s- Leucine-rich repeat, typical subtype (InterPro-IPR003591), Leucine-rich repeat (InterPro-IPR001611), Leucine-rich repeat, N-terminal (InterPro-IPR013210); BEST Arabidopsis thaliana protein match is- AtRLP13 (Receptor Like Protein 13); protein binding (TAIR-AT1G74170.1). (1083 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
AT5G43730
disease resistance protein (CC-NBS-LRR class), putative; disease resistance protein (CC-NBS-LRR [...] (848 aa)
       0.692
ZCF37
ZCF37; ZCF37 mRNA, complete cds (211 aa)
       0.679
AT1G59630
F-box family protein-related; F-box family protein-related; FUNCTIONS IN- molecular_function un [...] (239 aa)
       0.677
AT1G58602
ATP binding / protein binding; ATP binding / protein binding; FUNCTIONS IN- protein binding, AT [...] (1138 aa)
       0.593
ATBZIP4
ATBZIP4 (ARABIDOPSIS THALIANA BASIC LEUCINE-ZIPPER 4); DNA binding / transcription factor; ARAB [...] (148 aa)
       0.560
AT1G72950
disease resistance protein (TIR-NBS class), putative; disease resistance protein (TIR-NBS class [...] (379 aa)
       0.534
CW9
CW9; ATP binding; Encodes CW9. (842 aa)
       0.408

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query700
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-72
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-64
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-14
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  251 bits (642), Expect = 9e-72
 Identities = 197/605 (32%), Positives = 292/605 (48%), Gaps = 77/605 (12%)

Query: 25  DLSGSSSNCLKYLSHLKVLDISHNQLSGSLSSTI-TSLTSLEYLDLSYNNFEGPCPLSSL 83
           ++SG  S+ +  L +++ +++S+NQLSG +   I T+ +SL YL+LS NNF G  P  S+
Sbjct: 80  NISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSI 139

Query: 84  ANHSKLEVLLLSSTNNMLLVKTENFLPTFQLKVLELANCSLNVVPTFLLHQYDLKYLDLS 143
            N   LE L LS  NNML  +  N + +F                        LK LDL 
Sbjct: 140 PN---LETLDLS--NNMLSGEIPNDIGSF----------------------SSLKVLDLG 172

Query: 144 LNNLVGDFPSWMLQNNTKLEVLFLTNNSFTGNLRLPNTKHDFLHHLDASSNNFIGTLPQD 203
            N LVG  P+  L N T LE L L +N   G +     +   L  +    NN  G +P +
Sbjct: 173 GNVLVGKIPNS-LTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYE 231

Query: 204 MGTILKKLLVLDISNNHFEGNIPSSVGEMKELIILHLSKNNFSEDFSTPFLTGCISLWFL 263
           +G  L  L  LD+  N+  G IPSS+G +K L  L L +N  S     P +     L  L
Sbjct: 232 IGG-LTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIP-PSIFSLQKLISL 289

Query: 264 DLSDNNFYGQFFSKDLNLTQMEFLYLENNKFSGKIEEGLLNSTKLYQLDISHNFLSGHIP 323
           DLSDN+  G+     + L  +E L+L +N F+GKI   L +  +L  L +  N  SG IP
Sbjct: 290 DLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIP 349

Query: 324 HWMGNFSNLEILLMSNNCLEGNIPVQLLNHRTLKLLSVSENYLSGSMTSSFNL-SSLKHL 382
             +G  +NL +L +S N L G IP  L +   L  L +  N L G +  S     SL+ +
Sbjct: 350 KNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRV 409

Query: 383 YVQKNALSGPIPDMLFRSSKLMTLDLRGNNLEGQIPDQICQLRRLGMMDLSHNRFNGSIP 442
            +Q N+ SG +P    +   +  LD+  NNL+G+I  +   +  L M+ L+ N+F G +P
Sbjct: 410 RLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLP 469

Query: 443 SCFTNMLQWTIENVDLFGGELSIFPPLGFCYIGTYYNSTLDLEVCKRDMFTSPQQVKVEF 502
             F +     +EN+DL   + S   P                                  
Sbjct: 470 DSFGSK---RLENLDLSRNQFSGAVPRKL------------------------------- 495

Query: 503 VTKNRYELYNGSNLNYMVGLDLSCNELTGNVPSEIGDLQKIRGLNLSHNCLSGSIPRSFS 562
                       +L+ ++ L LS N+L+G +P E+   +K+  L+LSHN LSG IP SFS
Sbjct: 496 -----------GSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFS 544

Query: 563 NLQMIESLDLSNNRLSGQIPAQLIELNFLSNFNVSYNNLSGLIPDKGQYSTFDESSYRGN 622
            + ++  LDLS N+LSG+IP  L  +  L   N+S+N+L G +P  G +   + S+  GN
Sbjct: 545 EMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGN 604

Query: 623 LYLCG 627
           + LCG
Sbjct: 605 IDLCG 609


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 700
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG4237498 consensus Extracellular matrix protein slit, conta 99.92
PLN032101153 Resistant to P. syringae 6; Provisional 99.91
KOG4237498 consensus Extracellular matrix protein slit, conta 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.88
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.79
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.77
KOG0617264 consensus Ras suppressor protein (contains leucine 99.69
KOG0617264 consensus Ras suppressor protein (contains leucine 99.67
PLN03150623 hypothetical protein; Provisional 99.57
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.31
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.29
PLN03150623 hypothetical protein; Provisional 99.28
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.21
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.21
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.13
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.11
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.09
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.09
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.05
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.04
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.03
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.99
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.96
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.93
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.91
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.79
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.76
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.73
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.59
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.54
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.5
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.33
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.29
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.29
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.25
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.14
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.03
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.02
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.95
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.94
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.89
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.85
KOG4341483 consensus F-box protein containing LRR [General fu 97.81
PRK15386426 type III secretion protein GogB; Provisional 97.78
PRK15386426 type III secretion protein GogB; Provisional 97.73
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.62
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.57
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.52
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.45
KOG4341483 consensus F-box protein containing LRR [General fu 97.44
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.01
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.78
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.73
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.58
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.0
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.96
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.8
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.35
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.19
KOG0473 326 consensus Leucine-rich repeat protein [Function un 92.85
KOG4308478 consensus LRR-containing protein [Function unknown 92.2
KOG4308478 consensus LRR-containing protein [Function unknown 91.97
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.78
smart0037026 LRR Leucine-rich repeats, outliers. 91.78
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.56
smart0037026 LRR Leucine-rich repeats, outliers. 90.56
KOG0473326 consensus Leucine-rich repeat protein [Function un 87.47
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.12
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.56
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 83.62
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.9e-66  Score=609.92  Aligned_cols=542  Identities=34%  Similarity=0.503  Sum_probs=439.2

Q ss_pred             CCCCCEEECCCCcCCcccchhccCCCCCCEEeCCCCcCCCCCChhhccCCCCCcEEEcccCccccccccCCCCCCCcccE
Q 043317           37 LSHLKVLDISHNQLSGSLSSTITSLTSLEYLDLSYNNFEGPCPLSSLANHSKLEVLLLSSTNNMLLVKTENFLPTFQLKV  116 (700)
Q Consensus        37 l~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~  116 (700)
                      ..+++.|+|++|.+++.++..|..+++|++|+|++|++.+.+|...+..+++|++|++++|++.+.++.   ..+++|++
T Consensus        68 ~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~---~~l~~L~~  144 (968)
T PLN00113         68 SSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR---GSIPNLET  144 (968)
T ss_pred             CCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc---cccCCCCE
Confidence            357788888888888877778888888888888888887777766666788888888888777665554   34567888


Q ss_pred             EEeeCCCC-CCcChhhcCCCCCCEEEccCCCCCccCchHHhhcCCCCCEEEccCCcCcccCCCCCCCCCCccEEeCCCCc
Q 043317          117 LELANCSL-NVVPTFLLHQYDLKYLDLSLNNLVGDFPSWMLQNNTKLEVLFLTNNSFTGNLRLPNTKHDFLHHLDASSNN  195 (700)
Q Consensus       117 L~L~~n~l-~~~p~~l~~~~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~l~~n~  195 (700)
                      |++++|.+ +.+|..+..+++|++|++++|.+.+.+|..+. ++++|++|++++|.+.+.+|..+..+++|++|++++|.
T Consensus       145 L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~-~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~  223 (968)
T PLN00113        145 LDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLT-NLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNN  223 (968)
T ss_pred             EECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhh-hCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCc
Confidence            88888888 56777788888888888888888777777664 78888888888888887778888888888888888888


Q ss_pred             CccccChhHHhhccCCcEEEccCCcCCccCCccccCCCCCcEEEccCccCCCCCchHHHhcCCcCcEEEcCCcccccccc
Q 043317          196 FIGTLPQDMGTILKKLLVLDISNNHFEGNIPSSVGEMKELIILHLSKNNFSEDFSTPFLTGCISLWFLDLSDNNFYGQFF  275 (700)
Q Consensus       196 l~~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~  275 (700)
                      +.+.+|..+.. +++|++|++++|.+.+..|..++++++|++|++++|.+.+..|..+ ..+++|++|++++|.+.+..|
T Consensus       224 l~~~~p~~l~~-l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l-~~l~~L~~L~Ls~n~l~~~~p  301 (968)
T PLN00113        224 LSGEIPYEIGG-LTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSI-FSLQKLISLDLSDNSLSGEIP  301 (968)
T ss_pred             cCCcCChhHhc-CCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhH-hhccCcCEEECcCCeeccCCC
Confidence            87777777765 7788888888888887788888888888888888888877777665 457888888888888887777


Q ss_pred             cccCCCCCCcEEEcccCcccccccccccCCCCCcEEEcccCcCCCCcchhhcCCCCCcEEEcccCcCcccchhhccCCCC
Q 043317          276 SKDLNLTQMEFLYLENNKFSGKIEEGLLNSTKLYQLDISHNFLSGHIPHWMGNFSNLEILLMSNNCLEGNIPVQLLNHRT  355 (700)
Q Consensus       276 ~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~  355 (700)
                      ..+..+++|+.|++++|.+++..|..+..+++|+.|++++|.+++.+|..++.+++|+.|++++|++.+.+|..++.+.+
T Consensus       302 ~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~  381 (968)
T PLN00113        302 ELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGN  381 (968)
T ss_pred             hhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCC
Confidence            77778888888888888888777877888888888888888888778888888888888888888888778888888888


Q ss_pred             CCEEEccCccCcccCCCcc-CCCCCcEEEccCCcCccCcchhhhCCCCccEEECcCCcccccCChhhhccCCCCEEecCC
Q 043317          356 LKLLSVSENYLSGSMTSSF-NLSSLKHLYVQKNALSGPIPDMLFRSSKLMTLDLRGNNLEGQIPDQICQLRRLGMMDLSH  434 (700)
Q Consensus       356 L~~L~l~~n~l~~~~~~~~-~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~N~l~~~~~~~~~~l~~L~~L~Ls~  434 (700)
                      |+.|++++|.+.+..+..+ .+++|+.|++++|++++.+|..+..+++|+.|++++|.+++.+|..+..+++|+.|++++
T Consensus       382 L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~  461 (968)
T PLN00113        382 LFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLAR  461 (968)
T ss_pred             CCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcC
Confidence            8888888888887777766 778888888888888877888888888888888888888887777777888888888888


Q ss_pred             CccCCCCCchhhhhhhhhhhhccccCCCccCCCCCcccccccccccccccccccccCCCCcccceEEEeeccccccccCc
Q 043317          435 NRFNGSIPSCFTNMLQWTIENVDLFGGELSIFPPLGFCYIGTYYNSTLDLEVCKRDMFTSPQQVKVEFVTKNRYELYNGS  514 (700)
Q Consensus       435 N~l~~~~p~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~  514 (700)
                      |++.+.+|..+..   ..++.+++.++.+....+..                                          ..
T Consensus       462 n~~~~~~p~~~~~---~~L~~L~ls~n~l~~~~~~~------------------------------------------~~  496 (968)
T PLN00113        462 NKFFGGLPDSFGS---KRLENLDLSRNQFSGAVPRK------------------------------------------LG  496 (968)
T ss_pred             ceeeeecCccccc---ccceEEECcCCccCCccChh------------------------------------------hh
Confidence            8887777765432   12333444444333221100                                          12


Q ss_pred             cccccceEECCCCcCcccCCccccCcCCCcEEeCCCccCccccCcccccccCCCEEeCCCCcCcccCcccccCCCCCCeE
Q 043317          515 NLNYMVGLDLSCNELTGNVPSEIGDLQKIRGLNLSHNCLSGSIPRSFSNLQMIESLDLSNNRLSGQIPAQLIELNFLSNF  594 (700)
Q Consensus       515 ~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L  594 (700)
                      .++.|+.|+|++|.+.+.+|..++.+++|++|+|++|.+++.+|..|+++++|+.|||++|++++.+|..+..+++|+++
T Consensus       497 ~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l  576 (968)
T PLN00113        497 SLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQV  576 (968)
T ss_pred             hhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEE
Confidence            35788999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eccCCcCcccCCCCCCCCCcCCCccCCCcCCcCcC
Q 043317          595 NVSYNNLSGLIPDKGQYSTFDESSYRGNLYLCGPT  629 (700)
Q Consensus       595 ~ls~N~l~~~~p~~~~~~~~~~~~~~gn~~lcg~~  629 (700)
                      ++++|+++|.+|..+++.++...++.||+.+||.+
T Consensus       577 ~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        577 NISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             eccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            99999999999999999999999999999999864



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query700
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-58
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-31
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-26
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-58
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-31
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-26
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-18
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 224 bits (571), Expect = 1e-58, Method: Compositional matrix adjust. Identities = 208/653 (31%), Positives = 299/653 (45%), Gaps = 95/653 (14%) Query: 23 VLDLSGSSSNCLKYLSHLKVLDISHNQXXXXXXXX---XXXXXXXEYLDLSYNNFEGPCP 79 LD G S LK L+ L+VLD+S N ++L +S N G Sbjct: 137 TLDFPGKVSGGLK-LNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD 195 Query: 80 LSSLANHSKLEVLLLSSTNNMLLVKTENFLPTFQLKVLELANCSLNVVPTFLLHQYDLKY 139 +S N LE L +SS N F + L +CS L++ Sbjct: 196 VSRCVN---LEFLDVSSNN-------------FSTGIPFLGDCSA------------LQH 227 Query: 140 LDLSLNNLVGDFPSWMLQNNTKLEVLFLTNNSFTGNLRLPNTKHDFLHHLDASSNNFIGT 199 LD+S N L GDF S + T+L++L +++N F G +P L +L + N F G Sbjct: 228 LDISGNKLSGDF-SRAISTCTELKLLNISSNQFVG--PIPPLPLKSLQYLSLAENKFTGE 284 Query: 200 LPQDMGTILKKLLVLDISNNHFEGNIPSSVG-------------------------EMKE 234 +P + L LD+S NHF G +P G +M+ Sbjct: 285 IPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRG 344 Query: 235 LIILHLSKNNFSEDFSTPFLTGCISLWFLDLSDNNFYGQFFSKDLNLTQ-----MEFLYL 289 L +L LS N FS + SL LDLS NNF G NL Q ++ LYL Sbjct: 345 LKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILP---NLCQNPKNTLQELYL 401 Query: 290 ENNKFSGKIEEGLLNSTKLYQLDISHNFLSGHIPHWMGNFSNLEILLMSNNCLEGNIPVQ 349 +NN F+GKI L N ++L L +S N+LSG IP +G+ S L L + N LEG IP + Sbjct: 402 QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE 461 Query: 350 LLNHRTLKLLSVSENYLSGSMTSSF-NLSSLKHLYVQKNALSGPIPDMLFRSSKLMTLDL 408 L+ +TL+ L + N L+G + S N ++L + + N L+G IP + R L L L Sbjct: 462 LMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKL 521 Query: 409 RGNNLEGQIPDQICQLRRLGMMDLSHNRFNGSIPSCFTNMLQWTIENVDLFGGELSIFPP 468 N+ G IP ++ R L +DL+ N FNG+IP+ Q + G+ Sbjct: 522 SNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAM--FKQSGKIAANFIAGKR----- 574 Query: 469 LGFCYIGTYYNSTLDLEVCKRDMFTSPQQVKVE----FVTKN----RYELYNG------S 514 + YI N + E Q ++ E T+N +Y G Sbjct: 575 --YVYI---KNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFD 629 Query: 515 NLNYMVGLDLSCNELTGNVPSEIGDLQKIRGLNLSHNCLSGSIPRSFSNLQMIESLDLSN 574 N M+ LD+S N L+G +P EIG + + LNL HN +SGSIP +L+ + LDLS+ Sbjct: 630 NNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSS 689 Query: 575 NRLSGQIPAQLIELNFLSNFNVSYNNLSGLIPDKGQYSTFDESSYRGNLYLCG 627 N+L G+IP + L L+ ++S NNLSG IP+ GQ+ TF + + N LCG Sbjct: 690 NKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCG 742
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query700
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-152
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-103
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-100
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-73
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-70
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-57
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-50
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-47
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-64
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-47
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-45
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-42
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-19
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-59
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-56
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-55
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-52
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-43
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-40
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-40
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-35
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-33
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-57
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-52
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-50
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-50
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-42
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-21
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-56
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-45
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-45
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-39
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-24
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-19
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-16
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-52
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-48
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-42
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-35
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-30
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-20
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-49
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-47
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-46
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-45
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-45
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-38
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-34
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-26
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-25
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-27
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-21
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-37
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-36
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-18
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-35
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-29
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-26
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-28
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-28
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-20
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-31
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-26
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-24
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-17
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-26
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-22
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-22
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-16
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-14
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-22
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-20
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-20
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-17
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-15
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-15
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-05
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-16
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 8e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-05
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  460 bits (1185), Expect = e-152
 Identities = 205/671 (30%), Positives = 307/671 (45%), Gaps = 59/671 (8%)

Query: 2   SGSLTNLYIFLTGLANLTILQVLDLSG--------SSSNCLKYLSHLKVLDISHNQLSGS 53
           S +  +    ++G   L  L+VLDLS                    LK L IS N++SG 
Sbjct: 134 SSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGD 193

Query: 54  LSSTITSLTSLEYLDLSYNNFEGPCPLSSLANHSKLEVLLLSSTNNMLLVKTENFLPTFQ 113
           +   ++   +LE+LD+S NNF    P   L + S L+ L +S   N L            
Sbjct: 194 VD--VSRCVNLEFLDVSSNNFSTGIP--FLGDCSALQHLDIS--GNKL----SGDFSR-- 241

Query: 114 LKVLELANCSLNVVPTFLLHQYDLKYLDLSLNNLVGDFPSWMLQNNTKLEVLFLTNNSFT 173
                ++ C+            +LK L++S N  VG  P   L++   L+ L L  N FT
Sbjct: 242 ----AISTCT------------ELKLLNISSNQFVGPIPPLPLKS---LQYLSLAENKFT 282

Query: 174 GNL------RLPNTKHDFLHHLDASSNNFIGTLPQDMGTILKKLLVLDISNNHFEGNIP- 226
           G +               L  LD S N+F G +P   G+    L  L +S+N+F G +P 
Sbjct: 283 GEIPDFLSGACDT-----LTGLDLSGNHFYGAVPPFFGS-CSLLESLALSSNNFSGELPM 336

Query: 227 SSVGEMKELIILHLSKNNFSEDFSTPFLTGCISLWFLDLSDNNFYGQFFSKDLN--LTQM 284
            ++ +M+ L +L LS N FS +          SL  LDLS NNF G             +
Sbjct: 337 DTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTL 396

Query: 285 EFLYLENNKFSGKIEEGLLNSTKLYQLDISHNFLSGHIPHWMGNFSNLEILLMSNNCLEG 344
           + LYL+NN F+GKI   L N ++L  L +S N+LSG IP  +G+ S L  L +  N LEG
Sbjct: 397 QELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEG 456

Query: 345 NIPVQLLNHRTLKLLSVSENYLSGSMTSSF-NLSSLKHLYVQKNALSGPIPDMLFRSSKL 403
            IP +L+  +TL+ L +  N L+G + S   N ++L  + +  N L+G IP  + R   L
Sbjct: 457 EIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENL 516

Query: 404 MTLDLRGNNLEGQIPDQICQLRRLGMMDLSHNRFNGSIPSCFTNMLQWTIENVDLFGGEL 463
             L L  N+  G IP ++   R L  +DL+ N FNG+IP+           N  + G   
Sbjct: 517 AILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAAN-FIAGKRY 575

Query: 464 SIFPPLGFCYIGTYYNSTLDLEVCKRDMFTSPQQVKVEFVTKNRY---ELYNGSNLNYMV 520
                 G         + L+ +  + +            +T   Y         N   M+
Sbjct: 576 VYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMM 635

Query: 521 GLDLSCNELTGNVPSEIGDLQKIRGLNLSHNCLSGSIPRSFSNLQMIESLDLSNNRLSGQ 580
            LD+S N L+G +P EIG +  +  LNL HN +SGSIP    +L+ +  LDLS+N+L G+
Sbjct: 636 FLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGR 695

Query: 581 IPAQLIELNFLSNFNVSYNNLSGLIPDKGQYSTFDESSYRGNLYLCGPTINKSCNSAEET 640
           IP  +  L  L+  ++S NNLSG IP+ GQ+ TF  + +  N  LCG  + +   S  + 
Sbjct: 696 IPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADG 755

Query: 641 PAIKSKGREDE 651
            A   +     
Sbjct: 756 YAHHQRSHHHH 766


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query700
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.82
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.81
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.74
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.7
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.7
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.67
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.63
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.63
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.62
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.59
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.51
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.46
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.44
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.44
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.43
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.42
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.4
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.35
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.33
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.31
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.23
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.21
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.15
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.12
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.88
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.79
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.44
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.43
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.39
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.35
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.98
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.83
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.16
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.0
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.0
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.99
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=4.4e-76  Score=677.01  Aligned_cols=619  Identities=32%  Similarity=0.443  Sum_probs=374.0

Q ss_pred             hhccCCCCCCEEEeC-----ccCCc--cccCCCCCCEEECCCCcCCcccchhc-cCCCCCCEEeCCCCcCCCCCChhh--
Q 043317           13 TGLANLTILQVLDLS-----GSSSN--CLKYLSHLKVLDISHNQLSGSLSSTI-TSLTSLEYLDLSYNNFEGPCPLSS--   82 (700)
Q Consensus        13 ~~~~~l~~L~~L~Ls-----g~~~~--~~~~l~~L~~L~Ls~n~i~~~~~~~~-~~l~~L~~L~Ls~n~l~~~~~~~~--   82 (700)
                      ..|+++++|++|+|+     |.+|.  .++++++|++|+|++|.+++..|..+ .++++|++|++++|++++..+...  
T Consensus        94 ~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~  173 (768)
T 3rgz_A           94 SGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVL  173 (768)
T ss_dssp             CCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHH
T ss_pred             hhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhh
Confidence            445555555555555     22344  45555555555555555554444433 455555555555555543333111  


Q ss_pred             ccCCCCCcEEEcccCccccccccCCCCCCCcccEEEeeCCCCCC-cChhhcCCCCCCEEEccCCCCCccCchHHhhcCCC
Q 043317           83 LANHSKLEVLLLSSTNNMLLVKTENFLPTFQLKVLELANCSLNV-VPTFLLHQYDLKYLDLSLNNLVGDFPSWMLQNNTK  161 (700)
Q Consensus        83 ~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~L~~n~l~~-~p~~l~~~~~L~~L~Ls~n~l~~~~~~~~~~~l~~  161 (700)
                      +.++++|++|++++|...+..+   +..+++|++|++++|.+.. +|. +.++++|++|++++|.+++.+|..+ ..+++
T Consensus       174 ~~~l~~L~~L~Ls~n~l~~~~~---~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l-~~l~~  248 (768)
T 3rgz_A          174 SDGCGELKHLAISGNKISGDVD---VSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAI-STCTE  248 (768)
T ss_dssp             TTCCTTCCEEECCSSEEESCCB---CTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHT-TTCSS
T ss_pred             hccCCCCCEEECCCCcccccCC---cccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHH-hcCCC
Confidence            4455555555555554433222   3566778888888888844 444 7788888888888888887777665 47888


Q ss_pred             CCEEEccCCcCcccCCCCCCCCCCccEEeCCCCcCccccChhHHhhccCCcEEEccCCcCCccCCccccCCCCCcEEEcc
Q 043317          162 LEVLFLTNNSFTGNLRLPNTKHDFLHHLDASSNNFIGTLPQDMGTILKKLLVLDISNNHFEGNIPSSVGEMKELIILHLS  241 (700)
Q Consensus       162 L~~L~L~~n~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~l~~l~~L~~L~L~  241 (700)
                      |++|++++|.+++.+|..  .+++|++|++++|.+.+.+|..++..+++|++|++++|.+++.+|..++++++|++|+++
T Consensus       249 L~~L~Ls~n~l~~~~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~  326 (768)
T 3rgz_A          249 LKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALS  326 (768)
T ss_dssp             CCEEECCSSCCEESCCCC--CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECC
T ss_pred             CCEEECCCCcccCccCcc--ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECC
Confidence            888888888887766554  677777777777777777777766645777777777777777777777777777777777


Q ss_pred             CccCCCCCchHHHhcCCcCcEEEcCCcccccccccccCCCC-CCcEEEcccCcccc------------------------
Q 043317          242 KNNFSEDFSTPFLTGCISLWFLDLSDNNFYGQFFSKDLNLT-QMEFLYLENNKFSG------------------------  296 (700)
Q Consensus       242 ~n~l~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~-~L~~L~L~~n~l~~------------------------  296 (700)
                      +|++++.+|...+..+++|++|++++|.+.+..|..+..++ +|+.|++++|++++                        
T Consensus       327 ~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l  406 (768)
T 3rgz_A          327 SNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF  406 (768)
T ss_dssp             SSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEE
T ss_pred             CCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCcc
Confidence            77777666666556677777777777777666665555444 45555555555544                        


Q ss_pred             --cccccccCCCCCcEEEcccCcCCCCcchhhcCCCCCcEEEcccCcCcccchhhccCCCCCCEEEccCccCcccCCCcc
Q 043317          297 --KIEEGLLNSTKLYQLDISHNFLSGHIPHWMGNFSNLEILLMSNNCLEGNIPVQLLNHRTLKLLSVSENYLSGSMTSSF  374 (700)
Q Consensus       297 --~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~  374 (700)
                        .+|..+..+++|++|++++|++++.+|..++.+++|++|++++|.+.+.+|..+..+++|++|++++|.+++..+..+
T Consensus       407 ~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l  486 (768)
T 3rgz_A          407 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGL  486 (768)
T ss_dssp             EEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGG
T ss_pred             ccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHH
Confidence              444444444555555555555544444445555555555555555544445445455555555555555554444444


Q ss_pred             -CCCCCcEEEccCCcCccCcchhhhCCCCccEEECcCCcccccCChhhhccCCCCEEecCCCccCCCCCchhhhhhhhhh
Q 043317          375 -NLSSLKHLYVQKNALSGPIPDMLFRSSKLMTLDLRGNNLEGQIPDQICQLRRLGMMDLSHNRFNGSIPSCFTNMLQWTI  453 (700)
Q Consensus       375 -~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~l~~  453 (700)
                       .+++|++|++++|++++.+|.++..+++|++|++++|++++.+|..+..+++|++|++++|+++|.+|..+.....+..
T Consensus       487 ~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~  566 (768)
T 3rgz_A          487 SNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIA  566 (768)
T ss_dssp             GGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBC
T ss_pred             hcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhh
Confidence             4455555555555555445555555555555555555555455555555555555555555555555544433221110


Q ss_pred             hhccccC-CCccCCCCCcccccccccccccccccccccCCCCcccceEEEeecccc---ccccCccccccceEECCCCcC
Q 043317          454 ENVDLFG-GELSIFPPLGFCYIGTYYNSTLDLEVCKRDMFTSPQQVKVEFVTKNRY---ELYNGSNLNYMVGLDLSCNEL  529 (700)
Q Consensus       454 ~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~---~~~~~~~l~~L~~L~Ls~N~l  529 (700)
                        ..... .............................................+..   .......++.|+.|||++|++
T Consensus       567 --~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l  644 (768)
T 3rgz_A          567 --ANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNML  644 (768)
T ss_dssp             --CSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCC
T ss_pred             --hhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcc
Confidence              00000 000000000000000000000000000000000000000000000000   011124468899999999999


Q ss_pred             cccCCccccCcCCCcEEeCCCccCccccCcccccccCCCEEeCCCCcCcccCcccccCCCCCCeEeccCCcCcccCCCCC
Q 043317          530 TGNVPSEIGDLQKIRGLNLSHNCLSGSIPRSFSNLQMIESLDLSNNRLSGQIPAQLIELNFLSNFNVSYNNLSGLIPDKG  609 (700)
Q Consensus       530 ~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~ls~N~l~~~~p~~~  609 (700)
                      +|.+|..++.+++|+.|+|++|+++|.+|..|+++++|++|||++|+++|.+|..+..+++|++||+++|+++|.||..+
T Consensus       645 ~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~  724 (768)
T 3rgz_A          645 SGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMG  724 (768)
T ss_dssp             BSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSS
T ss_pred             cccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCch
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCcCCCccCCCcCCcCcCCCCCCCCCCCCC
Q 043317          610 QYSTFDESSYRGNLYLCGPTINKSCNSAEETP  641 (700)
Q Consensus       610 ~~~~~~~~~~~gn~~lcg~~~~~~c~~~~~~~  641 (700)
                      +|.+++..+|.||+++||.|+. .|.......
T Consensus       725 ~~~~~~~~~~~gN~~Lcg~~l~-~C~~~~~~~  755 (768)
T 3rgz_A          725 QFETFPPAKFLNNPGLCGYPLP-RCDPSNADG  755 (768)
T ss_dssp             SGGGSCGGGGCSCTEEESTTSC-CCCSCC---
T ss_pred             hhccCCHHHhcCCchhcCCCCc-CCCCCccCC
Confidence            9999999999999999999987 897655443



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 700
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-04
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-05
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-07
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 8e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 2e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.001
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 83.1 bits (204), Expect = 1e-17
 Identities = 67/385 (17%), Positives = 119/385 (30%), Gaps = 28/385 (7%)

Query: 13  TGLANLTILQVLDLSGSSSNCLKYLSHLKVLDISHNQLSGSLSSTITSLTSLEYLDLSYN 72
           T LA      +   + + +     L  +  L      +  S+   +  L +L  ++ S N
Sbjct: 19  TALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIK-SIDG-VEYLNNLTQINFSNN 76

Query: 73  NFEGPCPLSSLANHSKLEVLLLSSTNNMLLVKTENFLPTFQLKVLELANCSLNVVPTFLL 132
                 PL +L     + +      +   L    N                L  +     
Sbjct: 77  QLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNR 136

Query: 133 HQYDLKYLDLSLNNLVGDFPSWMLQNNTKLEVLFLTNNSFTGNLRLPNTKHDFLHH---- 188
            +     +              +   N   ++  L N +    L + + K   +      
Sbjct: 137 LELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKL 196

Query: 189 -----LDASSNNFIGTLPQDMGTILKKLLVLDISNNHFEGNIPSSVGEMKELIILHLSKN 243
                L A++N      P  + T L     L ++ N  +     ++  +  L  L L+ N
Sbjct: 197 TNLESLIATNNQISDITPLGILTNLD---ELSLNGNQLKD--IGTLASLTNLTDLDLANN 251

Query: 244 NFSEDFSTPFLTGCISLWFLDLSDNNFYGQFFSKDLNLTQMEFLYLENNKFSGKIEEGLL 303
             S   +   L+G   L  L L  N       S    LT +  L L  N+         L
Sbjct: 252 QIS---NLAPLSGLTKLTELKLGANQISN--ISPLAGLTALTNLELNENQLEDISPISNL 306

Query: 304 NSTKLYQLDISHNFLSGHIPHWMGNFSNLEILLMSNNCLEGNIPVQLLNHRTLKLLSVSE 363
               L  L +  N +S   P  + + + L+ L  +NN +       L N   +  LS   
Sbjct: 307 K--NLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGH 360

Query: 364 NYLSGSMTSSFNLSSLKHLYVQKNA 388
           N +S   T   NL+ +  L +   A
Sbjct: 361 NQISDL-TPLANLTRITQLGLNDQA 384


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query700
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.82
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.82
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.8
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.8
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.64
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.64
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.5
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.44
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.33
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.26
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.23
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.2
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.29
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.17
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.67
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.62
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.88
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.84
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=2.3e-32  Score=277.31  Aligned_cols=258  Identities=33%  Similarity=0.557  Sum_probs=228.1

Q ss_pred             CCCcEEEcccCcCCC--CcchhhcCCCCCcEEEccc-CcCcccchhhccCCCCCCEEEccCccCcccCCCcc-CCCCCcE
Q 043317          306 TKLYQLDISHNFLSG--HIPHWMGNFSNLEILLMSN-NCLEGNIPVQLLNHRTLKLLSVSENYLSGSMTSSF-NLSSLKH  381 (700)
Q Consensus       306 ~~L~~L~Ls~n~l~~--~~~~~~~~l~~L~~L~L~~-n~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~-~l~~L~~  381 (700)
                      .+++.|+|++|.+++  .+|..++++++|++|+|++ |+++|.+|..+.++++|++|++++|++.+..+..+ .+..|+.
T Consensus        50 ~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~  129 (313)
T d1ogqa_          50 YRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVT  129 (313)
T ss_dssp             CCEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCE
T ss_pred             EEEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcc
Confidence            367888888888876  3678888888899999886 78888888888889999999999999888887777 7889999


Q ss_pred             EEccCCcCccCcchhhhCCCCccEEECcCCcccccCChhhhccCCC-CEEecCCCccCCCCCchhhhhhhhhhhhccccC
Q 043317          382 LYVQKNALSGPIPDMLFRSSKLMTLDLRGNNLEGQIPDQICQLRRL-GMMDLSHNRFNGSIPSCFTNMLQWTIENVDLFG  460 (700)
Q Consensus       382 L~l~~n~l~~~~~~~~~~~~~L~~L~l~~N~l~~~~~~~~~~l~~L-~~L~Ls~N~l~~~~p~~~~~l~~l~~~~~~~~~  460 (700)
                      +++++|.+.+.+|..+..++.++++++++|.+.+.+|..+..+..+ +.+++++|++++..|..+..+            
T Consensus       130 l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l------------  197 (313)
T d1ogqa_         130 LDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANL------------  197 (313)
T ss_dssp             EECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGC------------
T ss_pred             cccccccccccCchhhccCcccceeecccccccccccccccccccccccccccccccccccccccccc------------
Confidence            9999999998999999999999999999999999999999888876 889999999998777665542            


Q ss_pred             CCccCCCCCcccccccccccccccccccccCCCCcccceEEEeeccccccccCccccccceEECCCCcCcccCCccccCc
Q 043317          461 GELSIFPPLGFCYIGTYYNSTLDLEVCKRDMFTSPQQVKVEFVTKNRYELYNGSNLNYMVGLDLSCNELTGNVPSEIGDL  540 (700)
Q Consensus       461 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l  540 (700)
                                                                               ....++++++...+.+|..++.+
T Consensus       198 ---------------------------------------------------------~~~~l~l~~~~~~~~~~~~~~~~  220 (313)
T d1ogqa_         198 ---------------------------------------------------------NLAFVDLSRNMLEGDASVLFGSD  220 (313)
T ss_dssp             ---------------------------------------------------------CCSEEECCSSEEEECCGGGCCTT
T ss_pred             ---------------------------------------------------------ccccccccccccccccccccccc
Confidence                                                                     23358999999999999999999


Q ss_pred             CCCcEEeCCCccCccccCcccccccCCCEEeCCCCcCcccCcccccCCCCCCeEeccCCcCcccCCCCCCCCCcCCCccC
Q 043317          541 QKIRGLNLSHNCLSGSIPRSFSNLQMIESLDLSNNRLSGQIPAQLIELNFLSNFNVSYNNLSGLIPDKGQYSTFDESSYR  620 (700)
Q Consensus       541 ~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~ls~N~l~~~~p~~~~~~~~~~~~~~  620 (700)
                      ++++.+++++|.+++.+| .++.+++|+.|||++|+++|.+|..+.++++|++|||++|+|+|.+|..+.+..++..++.
T Consensus       221 ~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~  299 (313)
T d1ogqa_         221 KNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYA  299 (313)
T ss_dssp             SCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTC
T ss_pred             cccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHHhC
Confidence            999999999999997665 6889999999999999999999999999999999999999999999998888899999999


Q ss_pred             CCcCCcCcCCCCCC
Q 043317          621 GNLYLCGPTINKSC  634 (700)
Q Consensus       621 gn~~lcg~~~~~~c  634 (700)
                      ||+.+||.|+. .|
T Consensus       300 ~N~~l~g~plp-~c  312 (313)
T d1ogqa_         300 NNKCLCGSPLP-AC  312 (313)
T ss_dssp             SSSEEESTTSS-CC
T ss_pred             CCccccCCCCC-CC
Confidence            99999998864 56



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure