Citrus Sinensis ID: 043540

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------
MFEDPSYIVPRDLPTSLKQESKQIQCVLKLSNNKRPLEEGEKLAVKRAAIEASKTEEPVKGLSNLSLAQTDQAEAHLQGGNLSDSNSLIPELGRDITINCLLRCSRSDYGAIASLNRAFRSLIQSGELYRLRREMGIIEHWVYFSCKLKEWEAFDPIHHRWMHLPPMNASDCFMCADKESLAVGTELLVFGKEVHGNAIYRYNLLTNTWSTGMTMNTPRCLFGSASLGEIAILAGGCDPRGKLLKSAELYNSITGTWMPISSMHKARKMCSGVFMDGKFYVIGGIGEGSSAMLTDVEMYDLETGKWTQITDMFPARIGSDGVSVISAAGEAPPLLAVVNNELYAADHEKEEVRKFDKGRKLWRTLGRLPEQASSMNGWGLAFRACGDQLIVIGGPRDSGGGIVELNGWVPDEGPPHWKLLARQPMCGFVFNCTVMGC
cccccEEEEcccccccHHHHHHHHHHHHHHcccccccccHHHHHHEEEEEEEcccccccccccccccccccHHHHHcccccccccccccccccHHHHHHHHHHcccccHHHHHcccHHHHcccccccEEEEcccccEEEEEEEEEEEccEEEEEEcccccEEEcccccccccccccccEEEEEccEEEEEccEEcccEEEEEEcccccEEcccccccccccEEEEEEccEEEEEcccccccccccEEEEEEcccccEEEcccccccccccEEEEEccEEEEEccccccccccccEEEEEEcccccEEEccccccccccccEEEEEccccccccEEEEEccEEEEccccccEEEEEEcccccEEEcccccccccccccccEEEEEEccEEEEEEcccccccccEEEEEEEccccccccEEcccccccccEEEEEEEcc
ccccccEEEccccccccHHHHHHHHHHHHHHcccccccHHHccccEEEEEcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHccccccEEEEEEcccEEEEEccccccEEEcccccccccccccccEEEEEccEEEEEcccccccEEEEEccccccEEEccccccccccEEEEEEccEEEEEEcccccccEEcEEEEEccccccEEEcccccccccccEEEEEccEEEEEEcccccccccccEEEEEccccccEEEEccccccccccEEEEEcccccccccEEEEEccEEEEccccccEEEEEccccccEEEEccccccccccccEEEEEEEEccEEEEEEcccccccccEEEEEEccccccccEEEEccccccccEEEEEEEcc
mfedpsyivprdlptslkqESKQIQCVLKLsnnkrpleegEKLAVKRAAIEaskteepvkglsnlslaQTDQAEAhlqggnlsdsnslipelgrditincllrcsrsdygAIASLNRAFRSLIQSGELYRLRREMGIIEHWVYFSCKlkeweafdpihhrwmhlppmnasdcfmcadkeSLAVGTELLVFGKEVHGNAIYRYNLLTNtwstgmtmntprclfgsasLGEIAILaggcdprgkllkSAELYNSitgtwmpissmhKARKMcsgvfmdgkfyviggigegssamlTDVEMydletgkwtqitdmfparigsdgvsvisaageappllaVVNNelyaadhekEEVRKFDKGRKLWRTlgrlpeqassmngwglafracgdqliviggprdsgggivelngwvpdegpphwkllarqpmcgfvfnctvmgc
mfedpsyivprdlptslkqesKQIQCVLklsnnkrpleegeKLAVKRAAIeaskteepvkglsNLSLAQTDQAEAHLQGGNLSDSNSLIPELGRDITINCLLRCSRSDYGAIASLNRAFRSLIQSGELYRLRREMGIIEHWVYFSCKLKEWEAFDPIHHRWMHLPPMNASDCFMCADKESLAVGTELLVFGKEVHGNAIYRYNLLTNTWSTGMTMNTPRCLFGSASLGEIAILAGGCDPRGKLLKSAELYNSITGTWMPISSMHKARKMCSGVFMDGKFYVIGGIGEGSSAMLTDVEMYDLETGKWTQITDMFPARIGSDGVSVISAAGEAPPLLAVVNNELyaadhekeevrkfdkgrkLWRTLGRLPEQASSMNGWGLAFRACGDQLIVIGGPRDSGGGIVELNGWVPDEGPPHWKLLARQPMCGFVFNCTVMGC
MFEDPSYIVPRDLPTSLKQESKQIQCVLKLSNNKRPLEEGEKLAVKRAAIEASKTEEPVKGLSNLSLAQTDQAEAHLQGGNLSDSNSLIPELGRDITINCLLRCSRSDYGAIASLNRAFRSLIQSGELYRLRREMGIIEHWVYFSCKLKEWEAFDPIHHRWMHLPPMNASDCFMCADKESLAVGTELLVFGKEVHGNAIYRYNLLTNTWSTGMTMNTPRCLFGSASLGEIAILAGGCDPRGKLLKSAELYNSITGTWMPISSMHKARKMCSGVFMDGKFYVIGGIGEGSSAMLTDVEMYDLETGKWTQITDMFPARIGSDGVSVISAAGEAPPLLAVVNNELYAADHEKEEVRKFDKGRKLWRTLGRLPEQASSMNGWGLAFRACGDQLIVIGGPRDSGGGIVELNGWVPDEGPPHWKLLARQPMCGFVFNCTVMGC
***************************************************************************************LIPELGRDITINCLLRCSRSDYGAIASLNRAFRSLIQSGELYRLRREMGIIEHWVYFSCKLKEWEAFDPIHHRWMHLPPMNASDCFMCADKESLAVGTELLVFGKEVHGNAIYRYNLLTNTWSTGMTMNTPRCLFGSASLGEIAILAGGCDPRGKLLKSAELYNSITGTWMPISSMHKARKMCSGVFMDGKFYVIGGIGEGSSAMLTDVEMYDLETGKWTQITDMFPARIGSDGVSVISAAGEAPPLLAVVNNELYAADHEKEEVRKFDKGRKLWRTLGRLPEQASSMNGWGLAFRACGDQLIVIGGPRDSGGGIVELNGWVPDEGPPHWKLLARQPMCGFVFNCTVM**
*****SYIV**************IQCV**************************************************************PELGRDITINCLLRCSRSDYGAIASLNRAFRSLIQSGELYRLRREMGIIEHWVYFSCKLKEWEAFDPIHHRWMHLPPMNASDCFMCADKESLAVGTELLVFGKEVHGNAIYRYNLLTNTWSTGMTMNTPRCLFGSASLGEIAILAGGCDPRGKLLKSAELYNSITGTWMPISSMHKARKMCSGVFMDGKFYVIGGIGEGSSAMLTDVEMYDLETGKWTQITDMFPARIGSDGVSVISAAGEAPPLLAVVNNELYAADHEKEEVRKFDKGRKLWRTLGRLPEQASSMNGWGLAFRACGDQLIVIGGPRDSGGGIVELNGWVPDEGPPHWKLLARQPMCGFVFNCTVMGC
MFEDPSYIVPRDLPTSLKQESKQIQCVLKLSNNKRPLEEGEKLAVKRAAIEASKTEEPVKGLSNLSLAQTDQAEAHLQGGNLSDSNSLIPELGRDITINCLLRCSRSDYGAIASLNRAFRSLIQSGELYRLRREMGIIEHWVYFSCKLKEWEAFDPIHHRWMHLPPMNASDCFMCADKESLAVGTELLVFGKEVHGNAIYRYNLLTNTWSTGMTMNTPRCLFGSASLGEIAILAGGCDPRGKLLKSAELYNSITGTWMPISSMHKARKMCSGVFMDGKFYVIGGIGEGSSAMLTDVEMYDLETGKWTQITDMFPARIGSDGVSVISAAGEAPPLLAVVNNELYAADHEKEEVRKFDKGRKLWRTLGRLPEQASSMNGWGLAFRACGDQLIVIGGPRDSGGGIVELNGWVPDEGPPHWKLLARQPMCGFVFNCTVMGC
****PSYIVPRDLPTSLKQESKQIQCVLKLSNNKRPLEEGEKLAVKRAAIEA*********************************NSLIPELGRDITINCLLRCSRSDYGAIASLNRAFRSLIQSGELYRLRREMGIIEHWVYFSCKLKEWEAFDPIHHRWMHLPPMNASDCFMCADKESLAVGTELLVFGKEVHGNAIYRYNLLTNTWSTGMTMNTPRCLFGSASLGEIAILAGGCDPRGKLLKSAELYNSITGTWMPISSMHKARKMCSGVFMDGKFYVIGGIGEGSSAMLTDVEMYDLETGKWTQITDMFPARIGSDGVSVISAAGEAPPLLAVVNNELYAADHEKEEVRKFDKGRKLWRTLGRLPEQASSMNGWGLAFRACGDQLIVIGGPRDSGGGIVELNGWVPDEGPPHWKLLARQPMCGFVFNCTVMGC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFEDPSYIVPRDLPTSLKQESKQIQCVLKLSNNKRPLEEGEKLAVKRAAIEASKTEEPVKGLSNLSLAQTDQAEAHLQGGNLSDSNSLIPELGRDITINCLLRCSRSDYGAIASLNRAFRSLIQSGELYRLRREMGIIEHWVYFSCKLKEWEAFDPIHHRWMHLPPMNASDCFMCADKESLAVGTELLVFGKEVHGNAIYRYNLLTNTWSTGMTMNTPRCLFGSASLGEIAILAGGCDPRGKLLKSAELYNSITGTWMPISSMHKARKMCSGVFMDGKFYVIGGIGEGSSAMLTDVEMYDLETGKWTQITDMFPARIGSDGVSVISAAGEAPPLLAVVNNELYAADHEKEEVRKFDKGRKLWRTLGRLPEQASSMNGWGLAFRACGDQLIVIGGPRDSGGGIVELNGWVPDEGPPHWKLLARQPMCGFVFNCTVMGC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query437 2.2.26 [Sep-21-2011]
Q8L736467 F-box/kelch-repeat protei yes no 0.842 0.788 0.660 1e-142
Q9CA63451 F-box/kelch-repeat protei no no 1.0 0.968 0.567 1e-139
Q84M94421 F-box/kelch-repeat protei no no 0.883 0.916 0.579 1e-130
Q9FKJ0393 F-box/kelch-repeat protei no no 0.826 0.918 0.445 2e-88
Q9LI89422 F-box/kelch-repeat protei no no 0.832 0.862 0.346 1e-55
Q9CAG8376 F-box/kelch-repeat protei no no 0.723 0.840 0.258 2e-21
Q93W93434 F-box/kelch-repeat protei no no 0.578 0.582 0.287 6e-19
Q0WW40383 F-box/kelch-repeat protei no no 0.675 0.770 0.235 2e-18
Q9M8L2354 F-box/kelch-repeat protei no no 0.718 0.887 0.264 9e-16
Q9LM55475 F-box/kelch-repeat protei no no 0.466 0.429 0.266 6e-15
>sp|Q8L736|SKI11_ARATH F-box/kelch-repeat protein SKIP11 OS=Arabidopsis thaliana GN=SKIP11 PE=1 SV=2 Back     alignment and function desciption
 Score =  506 bits (1302), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 245/371 (66%), Positives = 292/371 (78%), Gaps = 3/371 (0%)

Query: 69  QTDQAEAHLQGGNLSDSNSLIPELGRDITINCLLRCSRSDYGAIASLNRAFRSLIQSGEL 128
           Q  Q++ +  GG+ SDS+SLI E+GRD +I+CL+RCSRSDYG+IASLNR FRSL++SGE+
Sbjct: 98  QEQQSDFNDNGGDSSDSHSLINEIGRDNSIDCLIRCSRSDYGSIASLNRNFRSLVKSGEI 157

Query: 129 YRLRREMGIIEHWVYFSCKLKEWEAFDPIHHRWMHLPPMNASDCFMCADKESLAVGTELL 188
           YRLRR+ G +EHWVYFSC+L EW AFDP+  RWM LP M +S  FMCADKESLAVGT+LL
Sbjct: 158 YRLRRQNGFVEHWVYFSCQLLEWVAFDPVERRWMQLPTMPSSVTFMCADKESLAVGTDLL 217

Query: 189 VFGK-EVHGNAIYRYNLLTNTWSTGMTMNTPRCLFGSASLGEIAILAGGCDPRGKLLKSA 247
           V GK +   + IYRY+LLTN+WS+GM MN+PRCLFGSASLGEIAI AGGCD +GK+L  A
Sbjct: 218 VLGKDDFSSHVIYRYSLLTNSWSSGMKMNSPRCLFGSASLGEIAIFAGGCDSQGKILDFA 277

Query: 248 ELYNSITGTWMPISSMHKARKMCSGVFMDGKFYVIGGIGEGSSAMLTDVEMYDLETGKWT 307
           E+YNS   TW+ +  M+K RKMCSGVFMDGKFYVIGGIG   S  LT  E YDLET KWT
Sbjct: 278 EMYNSELQTWITLPRMNKPRKMCSGVFMDGKFYVIGGIGGADSKGLTCGEEYDLETKKWT 337

Query: 308 QITDMFPARIGSDGVSVISAAGEAPPLLAVVNNELYAADHEKEEVRKFDKGRKLWRTLGR 367
           QI D+ P R  +D    +S A EAPPL+AVVNN+LYAADH   EVRK+DK  K W T+GR
Sbjct: 338 QIPDLSPPRSRADQAD-MSPAAEAPPLVAVVNNQLYAADHADMEVRKYDKENKKWLTVGR 396

Query: 368 LPEQASSMNGWGLAFRACGDQLIVIGGPRDSGGGIVELNGWVP-DEGPPHWKLLARQPMC 426
           LPE+A S+NGWGLAFRACG++LIVIGGP+ SGGG +ELN W+P D GPP W LL R+   
Sbjct: 397 LPERAGSVNGWGLAFRACGERLIVIGGPKCSGGGFIELNSWIPSDGGPPQWTLLDRKHSP 456

Query: 427 GFVFNCTVMGC 437
            FV+NC VMGC
Sbjct: 457 TFVYNCAVMGC 467
Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9CA63|FBK29_ARATH F-box/kelch-repeat protein At1g74510 OS=Arabidopsis thaliana GN=At1g74510 PE=2 SV=1 Back     alignment and function description
>sp|Q84M94|FBK15_ARATH F-box/kelch-repeat protein At1g26930 OS=Arabidopsis thaliana GN=At1g26930 PE=2 SV=1 Back     alignment and function description
>sp|Q9FKJ0|FK132_ARATH F-box/kelch-repeat protein At5g60570 OS=Arabidopsis thaliana GN=At5g60570 PE=2 SV=1 Back     alignment and function description
>sp|Q9LI89|FBK70_ARATH F-box/kelch-repeat protein At3g27150 OS=Arabidopsis thaliana GN=At3g27150 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAG8|FBK28_ARATH F-box/kelch-repeat protein At1g67480 OS=Arabidopsis thaliana GN=At1g67480 PE=2 SV=1 Back     alignment and function description
>sp|Q93W93|FBK22_ARATH F-box/kelch-repeat protein At1g55270 OS=Arabidopsis thaliana GN=At1g55270 PE=2 SV=1 Back     alignment and function description
>sp|Q0WW40|FBK5_ARATH F-box/kelch-repeat protein At1g16250 OS=Arabidopsis thaliana GN=At1g16250 PE=2 SV=1 Back     alignment and function description
>sp|Q9M8L2|FBK30_ARATH F-box/kelch-repeat protein At1g80440 OS=Arabidopsis thaliana GN=At1g80440 PE=2 SV=1 Back     alignment and function description
>sp|Q9LM55|FBK8_ARATH F-box/kelch-repeat protein At1g22040 OS=Arabidopsis thaliana GN=At1g22040 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query437
225456725443 PREDICTED: F-box/kelch-repeat protein SK 1.0 0.986 0.661 1e-167
147810884 1318 hypothetical protein VITISV_022021 [Viti 0.988 0.327 0.659 1e-166
297734001482 unnamed protein product [Vitis vinifera] 0.947 0.858 0.652 1e-166
224124058443 f-box family protein [Populus trichocarp 0.995 0.981 0.633 1e-162
255540977 559 conserved hypothetical protein [Ricinus 0.869 0.679 0.676 1e-156
356516772441 PREDICTED: F-box/kelch-repeat protein At 0.997 0.988 0.617 1e-153
356508584441 PREDICTED: F-box/kelch-repeat protein At 0.997 0.988 0.613 1e-152
449439253438 PREDICTED: F-box/kelch-repeat protein At 0.990 0.988 0.590 1e-149
359473368 541 PREDICTED: F-box/kelch-repeat protein SK 0.967 0.781 0.6 1e-147
48210029513 kelch repeat-containing F-box family pro 0.965 0.822 0.573 1e-145
>gi|225456725|ref|XP_002274899.1| PREDICTED: F-box/kelch-repeat protein SKIP11-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  594 bits (1532), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 293/443 (66%), Positives = 357/443 (80%), Gaps = 6/443 (1%)

Query: 1   MFEDPSYIVPRDLPTSLKQESKQIQ---CVLKLSNNKRPLEEGEKLAVKRAA--IEASKT 55
           M E PSY++ RDLP + +QESK I     V++LSN+KRPLE+GE + +++ +   +  +T
Sbjct: 1   MLEGPSYLISRDLPNACEQESKWIYNTFLVIELSNSKRPLEDGEDVGLRKFSKPSDGHET 60

Query: 56  EEPVKGLSNLSLAQTDQAEAHLQGGNLSDSNSLIPELGRDITINCLLRCSRSDYGAIASL 115
           EE ++GL +LSL+Q +Q+  H   G+ SD +SLI ++GRD +INCLL+CSRSDYG+IASL
Sbjct: 61  EETMQGLHDLSLSQANQSNTHHDTGDQSDLSSLISQIGRDNSINCLLQCSRSDYGSIASL 120

Query: 116 NRAFRSLIQSGELYRLRREMGIIEHWVYFSCKLKEWEAFDPIHHRWMHLPPMNASDCFMC 175
           NR+FRSLI+ GELYRLRR++GI+EHWVYFSC L +WEAFDPI  RWMHLP M + +CFMC
Sbjct: 121 NRSFRSLIRGGELYRLRRKLGIVEHWVYFSCDLLQWEAFDPIRRRWMHLPRMPSYECFMC 180

Query: 176 ADKESLAVGTELLVFGKEVHGNAIYRYNLLTNTWSTGMTMNTPRCLFGSASLGEIAILAG 235
           +DKESLAVGTELLVFGKEV  + +Y+Y++LTN+WS+GM MN+PRCLFGSASLGEIAILAG
Sbjct: 181 SDKESLAVGTELLVFGKEVTSHVVYKYSILTNSWSSGMNMNSPRCLFGSASLGEIAILAG 240

Query: 236 GCDPRGKLLKSAELYNSITGTWMPISSMHKARKMCSGVFMDGKFYVIGGIGEGSSAMLTD 295
           GCDPRG +L SAELYNS TGTW+ + SM+K RKMCSG+FMD KFYVIGGIG G+S  LT 
Sbjct: 241 GCDPRGNILSSAELYNSDTGTWVTLPSMNKPRKMCSGIFMDRKFYVIGGIGVGNSNSLTC 300

Query: 296 VEMYDLETGKWTQITDMFPARIGSDGV-SVISAAGEAPPLLAVVNNELYAADHEKEEVRK 354
            E+YDLE   W +I +MFP R GS GV     AA EAPPL+AVVNNELYAAD+ ++EVRK
Sbjct: 301 GEVYDLEMRTWREIPNMFPGRNGSAGVAEATPAAAEAPPLVAVVNNELYAADYAEKEVRK 360

Query: 355 FDKGRKLWRTLGRLPEQASSMNGWGLAFRACGDQLIVIGGPRDSGGGIVELNGWVPDEGP 414
           +DK R LW T+GRLPEQA SMNGWGLAFRACGD+LIVIGGPR  GGGI+ELN W P EGP
Sbjct: 361 YDKARNLWVTVGRLPEQAVSMNGWGLAFRACGDRLIVIGGPRVLGGGIIELNSWSPGEGP 420

Query: 415 PHWKLLARQPMCGFVFNCTVMGC 437
           P W LLAR+    FV+NC VMGC
Sbjct: 421 PQWDLLARKQSGSFVYNCAVMGC 443

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147810884|emb|CAN67279.1| hypothetical protein VITISV_022021 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297734001|emb|CBI15248.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224124058|ref|XP_002330094.1| f-box family protein [Populus trichocarpa] gi|222871228|gb|EEF08359.1| f-box family protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255540977|ref|XP_002511553.1| conserved hypothetical protein [Ricinus communis] gi|223550668|gb|EEF52155.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356516772|ref|XP_003527067.1| PREDICTED: F-box/kelch-repeat protein At1g74510-like [Glycine max] Back     alignment and taxonomy information
>gi|356508584|ref|XP_003523035.1| PREDICTED: F-box/kelch-repeat protein At1g74510-like [Glycine max] Back     alignment and taxonomy information
>gi|449439253|ref|XP_004137401.1| PREDICTED: F-box/kelch-repeat protein At1g74510-like isoform 1 [Cucumis sativus] gi|449439255|ref|XP_004137402.1| PREDICTED: F-box/kelch-repeat protein At1g74510-like isoform 2 [Cucumis sativus] gi|449529547|ref|XP_004171761.1| PREDICTED: F-box/kelch-repeat protein At1g74510-like isoform 1 [Cucumis sativus] gi|449529549|ref|XP_004171762.1| PREDICTED: F-box/kelch-repeat protein At1g74510-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|359473368|ref|XP_003631294.1| PREDICTED: F-box/kelch-repeat protein SKIP11-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|48210029|gb|AAT40540.1| kelch repeat-containing F-box family protein, putative [Solanum demissum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query437
TAIR|locus:2019215451 AT1G74510 "AT1G74510" [Arabido 1.0 0.968 0.567 6.7e-136
TAIR|locus:2056705467 AT2G02870 "AT2G02870" [Arabido 0.842 0.788 0.660 2.1e-132
TAIR|locus:2012547441 AT1G14330 "AT1G14330" [Arabido 0.988 0.979 0.562 4.2e-127
TAIR|locus:2202765421 AT1G26930 "AT1G26930" [Arabido 0.883 0.916 0.579 1.3e-121
TAIR|locus:2175143393 AT5G60570 "AT5G60570" [Arabido 0.876 0.974 0.438 3.4e-84
TAIR|locus:2095138422 AT3G27150 "AT3G27150" [Arabido 0.768 0.796 0.369 3.4e-54
TAIR|locus:2168738415 AT5G40680 "AT5G40680" [Arabido 0.775 0.816 0.337 2.9e-48
TAIR|locus:2008773376 AT1G67480 "AT1G67480" [Arabido 0.640 0.744 0.275 1.1e-19
TAIR|locus:2035696434 AT1G55270 "AT1G55270" [Arabido 0.578 0.582 0.290 6.6e-19
TAIR|locus:2030601475 AT1G22040 "AT1G22040" [Arabido 0.496 0.456 0.298 1.8e-17
TAIR|locus:2019215 AT1G74510 "AT1G74510" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1331 (473.6 bits), Expect = 6.7e-136, P = 6.7e-136
 Identities = 256/451 (56%), Positives = 324/451 (71%)

Query:     1 MFEDPSYIVPRDLPTSLKQESKQI---QCVLKLSNNKRPLEEGE---KLAVKRAAIEASK 54
             M E PSY+V RDLP+S ++ESK I    CVL+LS  KR L++ +     A K   ++   
Sbjct:     1 MLEAPSYLVSRDLPSSCEEESKWIYNAHCVLQLSLRKRLLDDTDVEGSSAKKMLRVDHGS 60

Query:    55 TEEPVKGLSNLSLAQTDQAEAHLQ-GGNLSDSNSLIPELGRDITINCLLRCSRSDYGAIA 113
               E  K   +L LA+T Q+    Q GG     +S +  L ++  +NCL  CS SD+G+IA
Sbjct:    61 RGESDKITDSLQLAKTYQSSNQSQQGGGGDQQSSPVTRLDQNALLNCLAHCSLSDFGSIA 120

Query:   114 SLNRAFRSLIQSGELYRLRREMGIIEHWVYFSCKLKEWEAFDPIHHRWMHLPPMNASDCF 173
             S NR FRSLI+  ELYRLRR  GI+EHW+YFSC+L EWEA+DP   RW+ +P M  ++CF
Sbjct:   121 STNRTFRSLIKDSELYRLRRAKGIVEHWIYFSCRLLEWEAYDPNGDRWLRVPKMTFNECF 180

Query:   174 MCADKESLAVGTELLVFGKEVHGNAIYRYNLLTNTWSTGMTMNTPRCLFGSASLGEIAIL 233
             MC+DKESLAVGTELLVFGKE+  + IYRY++LTNTW++GM MN PRCLFGSASLGEIA++
Sbjct:   181 MCSDKESLAVGTELLVFGKEIMSHVIYRYSILTNTWTSGMQMNVPRCLFGSASLGEIAVI 240

Query:   234 AGGCDPRGKLLKSAELYNSITGTWMPISSMHKARKMCSGVFMDGKFYVIGGIGEGSSAML 293
             AGGCDPRG++L SAELYNS TG W  I SM+KARKMCS VFMDG FY IGGIGEG+S ML
Sbjct:   241 AGGCDPRGRILSSAELYNSETGEWTVIPSMNKARKMCSSVFMDGNFYCIGGIGEGNSKML 300

Query:   294 TDVEMYDLETGKWTQITDMFPARIGSDG------VSVISAAGEAPPLLAVVNNELYAADH 347
                E+YDL+   WT I +M P R    G      ++  +AA EAPPL+AVV +ELYAA++
Sbjct:   301 LCGEVYDLKKKTWTLIPNMLPERSSGGGGDQAKEIAAATAASEAPPLVAVVKDELYAANY 360

Query:   348 EKEEVRKFDKGRKLWRTLGRLPEQASSMNGWGLAFRACGDQLIVIGGPRDSGGGIVELNG 407
              ++EV+K+DK   +W  +G LPE+ASSMNGWG+AFRACGDQL+V+GGPR  GGG +E+N 
Sbjct:   361 AQQEVKKYDKRLNVWNKVGNLPERASSMNGWGMAFRACGDQLVVVGGPRAIGGGFIEINA 420

Query:   408 WVPDEGPP-HWKLLARQPMCGFVFNCTVMGC 437
              VP EG   HW++LA +P   FV+NC VMGC
Sbjct:   421 CVPSEGTQLHWRVLASKPSGNFVYNCAVMGC 451
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2056705 AT2G02870 "AT2G02870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012547 AT1G14330 "AT1G14330" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202765 AT1G26930 "AT1G26930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175143 AT5G60570 "AT5G60570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095138 AT3G27150 "AT3G27150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168738 AT5G40680 "AT5G40680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008773 AT1G67480 "AT1G67480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2035696 AT1G55270 "AT1G55270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030601 AT1G22040 "AT1G22040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8L736SKI11_ARATHNo assigned EC number0.66030.84210.7880yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00000121001
SubName- Full=Chromosome chr17 scaffold_101, whole genome shotgun sequence; (433 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 1e-16
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-12
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 5e-11
pfam0134446 pfam01344, Kelch_1, Kelch motif 6e-10
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 1e-06
pfam1396450 pfam13964, Kelch_6, Kelch motif 4e-06
smart0061247 smart00612, Kelch, Kelch domain 4e-06
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 6e-06
pfam0134446 pfam01344, Kelch_1, Kelch motif 2e-05
PRK14131 376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 4e-05
PHA02790480 PHA02790, PHA02790, Kelch-like protein; Provisiona 2e-04
smart0061247 smart00612, Kelch, Kelch domain 6e-04
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 0.001
pfam0764648 pfam07646, Kelch_2, Kelch motif 0.002
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 0.003
PRK14131376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 0.003
TIGR03547346 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family 0.003
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 0.004
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information 
 Score = 81.4 bits (201), Expect = 1e-16
 Identities = 43/204 (21%), Positives = 65/204 (31%), Gaps = 28/204 (13%)

Query: 197 NAIYRYNLLTNTWSTGMTMNTPRCLFGSASLGEIAILAGGCDPRGKLLKSAELYNSITGT 256
                     +  +T +        FGS  L  +    GG +     + S   Y++ T +
Sbjct: 264 YNYITNYSPLSEINT-IIDIHYVYCFGSVVLNNVIYFIGGMNKNNLSVNSVVSYDTKTKS 322

Query: 257 WMPISSMHKARKMCSGVFMDGKFYVIGGIGEGSSAMLTDVEMYDLETGKWTQITDMFPAR 316
           W  +  +   RK       + + YVIGGI    S  L  VE +     KW +   +   R
Sbjct: 323 WNKVPELIYPRKNPGVTVFNNRIYVIGGIYNSIS--LNTVESWKPGESKWREEPPLIFPR 380

Query: 317 IGSDGVSVISAAGEAPPLLAVVNNELYAA------DHEKEEVRKFDKGRKLWRTLGRLPE 370
                           P +  VNN +Y        D   + V  F      W     LP 
Sbjct: 381 YN--------------PCVVNVNNLIYVIGGISKNDELLKTVECFSLNTNKWSKGSPLP- 425

Query: 371 QASSMNGWGLAFRACGDQLIVIGG 394
              S  G    +     ++ VIGG
Sbjct: 426 --ISHYGGCAIYH--DGKIYVIGG 445

Length = 534
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|165153 PHA02790, PHA02790, Kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|116261 pfam07646, Kelch_2, Kelch motif Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 437
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PHA02713557 hypothetical protein; Provisional 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PLN02153341 epithiospecifier protein 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PLN02153341 epithiospecifier protein 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PLN02193470 nitrile-specifier protein 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
PLN02193470 nitrile-specifier protein 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
PHA03098534 kelch-like protein; Provisional 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 99.97
KOG4693392 consensus Uncharacterized conserved protein, conta 99.97
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.93
KOG0379482 consensus Kelch repeat-containing proteins [Genera 99.91
KOG1230 521 consensus Protein containing repeated kelch motifs 99.9
KOG1230 521 consensus Protein containing repeated kelch motifs 99.89
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.88
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.86
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.78
COG3055 381 Uncharacterized protein conserved in bacteria [Fun 99.62
PF1396450 Kelch_6: Kelch motif 99.28
PF1396450 Kelch_6: Kelch motif 99.13
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.1
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 99.04
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.01
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.94
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.88
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.86
PF1341549 Kelch_3: Galactose oxidase, central domain 98.86
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 98.8
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.76
PF1341549 Kelch_3: Galactose oxidase, central domain 98.74
smart0061247 Kelch Kelch domain. 98.73
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.72
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.68
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.66
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.65
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 98.55
smart0061247 Kelch Kelch domain. 98.45
PLN02772 398 guanylate kinase 98.42
PF1385442 Kelch_5: Kelch motif 98.3
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.29
PF1385442 Kelch_5: Kelch motif 98.14
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.03
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.0
PLN02772 398 guanylate kinase 97.98
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.95
KOG0281499 consensus Beta-TrCP (transducin repeats containing 97.93
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 97.91
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.89
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.76
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.74
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.7
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.67
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.56
PF03089337 RAG2: Recombination activating protein 2; InterPro 97.52
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.42
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.06
PRK11028330 6-phosphogluconolactonase; Provisional 96.94
PF12768281 Rax2: Cortical protein marker for cell polarity 96.85
PF03089337 RAG2: Recombination activating protein 2; InterPro 96.77
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.63
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 96.39
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 96.19
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 96.13
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 95.71
PRK04792448 tolB translocation protein TolB; Provisional 95.61
KOG2055 514 consensus WD40 repeat protein [General function pr 95.57
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.56
smart00284255 OLF Olfactomedin-like domains. 95.55
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 95.53
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 95.51
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 95.42
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 95.42
PF12768281 Rax2: Cortical protein marker for cell polarity 95.29
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 95.22
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 95.21
PRK13684334 Ycf48-like protein; Provisional 95.12
PF09910339 DUF2139: Uncharacterized protein conserved in arch 95.11
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.1
KOG2055514 consensus WD40 repeat protein [General function pr 95.05
PRK13684334 Ycf48-like protein; Provisional 94.96
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 94.89
PRK05137435 tolB translocation protein TolB; Provisional 94.88
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 94.7
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 94.48
COG1520370 FOG: WD40-like repeat [Function unknown] 94.46
PRK11028330 6-phosphogluconolactonase; Provisional 94.42
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 94.4
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 94.35
PRK00178430 tolB translocation protein TolB; Provisional 94.1
KOG0289506 consensus mRNA splicing factor [General function p 94.05
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 94.02
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 94.02
PRK04922433 tolB translocation protein TolB; Provisional 93.85
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 93.83
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 93.65
PRK04792448 tolB translocation protein TolB; Provisional 93.52
KOG0316307 consensus Conserved WD40 repeat-containing protein 93.48
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 93.3
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 93.25
KOG2997366 consensus F-box protein FBX9 [General function pre 93.22
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 93.1
PRK00178430 tolB translocation protein TolB; Provisional 92.59
PLN029191057 haloacid dehalogenase-like hydrolase family protei 92.5
COG1520370 FOG: WD40-like repeat [Function unknown] 92.37
KOG0310 487 consensus Conserved WD40 repeat-containing protein 92.19
KOG0310 487 consensus Conserved WD40 repeat-containing protein 92.01
PRK04043419 tolB translocation protein TolB; Provisional 91.87
PLN00181793 protein SPA1-RELATED; Provisional 91.78
PRK03629429 tolB translocation protein TolB; Provisional 91.74
smart00284255 OLF Olfactomedin-like domains. 91.62
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 91.45
COG3823262 Glutamine cyclotransferase [Posttranslational modi 91.19
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 90.67
PRK05137435 tolB translocation protein TolB; Provisional 90.66
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 90.37
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 90.16
COG4946 668 Uncharacterized protein related to the periplasmic 90.0
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 89.89
PRK04922433 tolB translocation protein TolB; Provisional 89.45
COG4946 668 Uncharacterized protein related to the periplasmic 89.39
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 89.22
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 89.14
KOG0289506 consensus mRNA splicing factor [General function p 89.12
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 88.12
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 88.0
COG3386307 Gluconolactonase [Carbohydrate transport and metab 87.89
PLN00033398 photosystem II stability/assembly factor; Provisio 87.69
PLN00181793 protein SPA1-RELATED; Provisional 87.49
PF12217367 End_beta_propel: Catalytic beta propeller domain o 86.51
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 85.97
PTZ00421 493 coronin; Provisional 85.9
PRK02889427 tolB translocation protein TolB; Provisional 85.79
PRK04043419 tolB translocation protein TolB; Provisional 85.53
PRK01742429 tolB translocation protein TolB; Provisional 85.32
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 84.51
KOG0316307 consensus Conserved WD40 repeat-containing protein 84.18
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 83.89
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 83.82
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 83.3
PF07734164 FBA_1: F-box associated; InterPro: IPR006527 This 82.8
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 82.3
KOG0286343 consensus G-protein beta subunit [General function 82.21
KOG2321 703 consensus WD40 repeat protein [General function pr 81.92
PTZ00421 493 coronin; Provisional 81.13
KOG2321 703 consensus WD40 repeat protein [General function pr 80.51
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-43  Score=362.28  Aligned_cols=260  Identities=29%  Similarity=0.449  Sum_probs=229.4

Q ss_pred             CceEEEeccCCCCeeeCCCCCCccccccCCceeEEeCCEEEEEcCcc----CCceEEEEECCCCceecCCCCCCCcccee
Q 043540          148 LKEWEAFDPIHHRWMHLPPMNASDCFMCADKESLAVGTELLVFGKEV----HGNAIYRYNLLTNTWSTGMTMNTPRCLFG  223 (437)
Q Consensus       148 ~~~~~~yDp~~~~W~~l~~~p~~~~~~~~~~~~~~~~~~lyv~GG~~----~~~~v~~yd~~t~~W~~~~~~~~~r~~~~  223 (437)
                      ...++.|||.++.|..+++||.+|+.++    ++++++.||++||..    ..+.+++|||.+|+|+.+++|+.+|..++
T Consensus       300 ~~~ve~yd~~~~~w~~~a~m~~~r~~~~----~~~~~~~lYv~GG~~~~~~~l~~ve~YD~~~~~W~~~a~M~~~R~~~~  375 (571)
T KOG4441|consen  300 LRSVECYDPKTNEWSSLAPMPSPRCRVG----VAVLNGKLYVVGGYDSGSDRLSSVERYDPRTNQWTPVAPMNTKRSDFG  375 (571)
T ss_pred             cceeEEecCCcCcEeecCCCCccccccc----EEEECCEEEEEccccCCCcccceEEEecCCCCceeccCCccCccccce
Confidence            4678999999999999999999988554    488999999999966    35799999999999999999999999999


Q ss_pred             eEEECCEEEEEeccCCCCCCCceEEEEECCCCcEEecCCCCcCCcCeeEEEECCEEEEEecccCCCCccCCeEEEEECCC
Q 043540          224 SASLGEIAILAGGCDPRGKLLKSAELYNSITGTWMPISSMHKARKMCSGVFMDGKFYVIGGIGEGSSAMLTDVEMYDLET  303 (437)
Q Consensus       224 ~~~~~~~iyv~GG~~~~~~~~~~~~~yd~~t~~W~~~~~~~~~r~~~~~~~~~g~lyv~GG~~~~~~~~~~~v~~yd~~~  303 (437)
                      ++++++.||++||.++.. .++++|+|||.+++|+.+++|+.+|..+++++++|+||++||.+ +....++++++|||.+
T Consensus       376 v~~l~g~iYavGG~dg~~-~l~svE~YDp~~~~W~~va~m~~~r~~~gv~~~~g~iYi~GG~~-~~~~~l~sve~YDP~t  453 (571)
T KOG4441|consen  376 VAVLDGKLYAVGGFDGEK-SLNSVECYDPVTNKWTPVAPMLTRRSGHGVAVLGGKLYIIGGGD-GSSNCLNSVECYDPET  453 (571)
T ss_pred             eEEECCEEEEEecccccc-ccccEEEecCCCCcccccCCCCcceeeeEEEEECCEEEEEcCcC-CCccccceEEEEcCCC
Confidence            999999999999999664 68999999999999999999999999999999999999999987 3334899999999999


Q ss_pred             CceEecCCCCCcccCCCCcccccccCCCCCEEEEECCEEEEEeCC-----CCeEEEEeCCCCcEEEccCCCCcccCCCcc
Q 043540          304 GKWTQITDMFPARIGSDGVSVISAAGEAPPLLAVVNNELYAADHE-----KEEVRKFDKGRKLWRTLGRLPEQASSMNGW  378 (437)
Q Consensus       304 ~~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ly~~gg~-----~~~v~~yd~~~~~W~~v~~lp~~~~~~~~~  378 (437)
                      ++|+.+++|+.+|.+              +++++++++||++||.     ...+++|||++++|+.+..|+.++.     
T Consensus       454 ~~W~~~~~M~~~R~~--------------~g~a~~~~~iYvvGG~~~~~~~~~VE~ydp~~~~W~~v~~m~~~rs-----  514 (571)
T KOG4441|consen  454 NTWTLIAPMNTRRSG--------------FGVAVLNGKIYVVGGFDGTSALSSVERYDPETNQWTMVAPMTSPRS-----  514 (571)
T ss_pred             CceeecCCccccccc--------------ceEEEECCEEEEECCccCCCccceEEEEcCCCCceeEcccCccccc-----
Confidence            999999999999999              7899999999999984     3469999999999999999988876     


Q ss_pred             cEEEEEeCCEEEEEcCCCCCCCCeeEEEeeecCCCCCCceecCccCCCceEeeeEEe
Q 043540          379 GLAFRACGDQLIVIGGPRDSGGGIVELNGWVPDEGPPHWKLLARQPMCGFVFNCTVM  435 (437)
Q Consensus       379 ~~a~~~~~~~l~v~GG~~~~~~~~~~~~~~~~d~~~~~W~~l~~~p~~~~~~~~~v~  435 (437)
                      ++++++.+++||++||.+   +......+-.||+.+++|+.++.+...+...+|+++
T Consensus       515 ~~g~~~~~~~ly~vGG~~---~~~~l~~ve~ydp~~d~W~~~~~~~~~~~~~~~~~~  568 (571)
T KOG4441|consen  515 AVGVVVLGGKLYAVGGFD---GNNNLNTVECYDPETDTWTEVTEPESGRGGAGVAVI  568 (571)
T ss_pred             cccEEEECCEEEEEeccc---CccccceeEEcCCCCCceeeCCCccccccCcceEEe
Confidence            466788999999999965   333444455679999999999985556666666554

>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF07734 FBA_1: F-box associated; InterPro: IPR006527 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 5e-11
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 9e-11
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 6e-10
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 6e-09
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 3e-05
1x2j_A316 Structural Basis For The Defects Of Human Lung Canc 6e-08
1x2j_A316 Structural Basis For The Defects Of Human Lung Canc 5e-06
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 8e-08
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 2e-05
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 8e-08
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 2e-05
2dyh_A318 Crystal Structure Of The Keap1 Protein In Complexed 8e-08
2dyh_A318 Crystal Structure Of The Keap1 Protein In Complexed 6e-06
4asc_A315 Crystal Structure Of The Kelch Domain Of Human Kbtb 3e-06
1zgk_A308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 1e-05
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure 
Iteration: 1

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 56/189 (29%), Positives = 82/189 (43%), Gaps = 18/189 (9%)
Query: 145 SCKLKEWEAFDPIHHRWMHLPPMN---ASDCFMCADKESLAVGTELLVFGKEVHG----N 197
           S  L   EA++   + W H+ PMN   +S           AVG      G +V      +
Sbjct: 120 STGLSSVEAYNIKSNEWFHVAPMNTRRSSVGVGVVGGLLYAVG------GYDVASRQCLS 173
Query: 198 AIYRYNLLTNTWSTGMTMNTPRCLFGSASLGEIAILAGGCDPRGKLL-KSAELYNSITGT 256
            +  YN  TN W+    M+T R   G   L  +    GG D  G L+ KS E+Y+  T  
Sbjct: 174 TVECYNATTNEWTYIAEMSTRRSGAGVGVLNNLLYAVGGHD--GPLVRKSVEVYDPTTNA 231
Query: 257 WMPISSMHKARKMCSGVFMDGKFYVIGGIGEGSSAMLTDVEMYDLETGKWTQITDMFPAR 316
           W  ++ M+  R+      ++G  YV+G  G+  S  L  VE Y+  T KWT ++      
Sbjct: 232 WRQVADMNMCRRNAGVCAVNGLLYVVG--GDDGSCNLASVEYYNPTTDKWTVVSSCMSTG 289
Query: 317 IGSDGVSVI 325
               GV+VI
Sbjct: 290 RSYAGVTVI 298
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure
>pdb|4ASC|A Chain A, Crystal Structure Of The Kelch Domain Of Human Kbtbd5 Length = 315 Back     alignment and structure
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 5e-40
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-31
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 3e-30
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 5e-22
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-05
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 8e-40
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 4e-34
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-39
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 7e-32
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 3e-31
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-23
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 9e-37
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 6e-33
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-25
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 4e-08
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-36
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-33
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-27
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-23
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-06
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-34
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 6e-30
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-27
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 5e-07
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 5e-23
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-19
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 1e-16
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 6e-14
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-07
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 5e-18
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 4e-09
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 1e-13
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 2e-10
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 1e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 3e-05
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
 Score =  144 bits (365), Expect = 5e-40
 Identities = 57/251 (22%), Positives = 92/251 (36%), Gaps = 32/251 (12%)

Query: 152 EAFDPIHHRWMHLPPMNASDCFMCADKESLAVGTELLVFG---KEVHGNAIYRYNLLTNT 208
           E +D    RW  +  + +  C        + +   +   G     +    +  Y+ + + 
Sbjct: 33  ECYDFKEERWHQVAELPSRRCRAGM----VYMAGLVFAVGGFNGSLRVRTVDSYDPVKDQ 88

Query: 209 WSTGMTMNTPRCLFGSASLGEIAILAGGCDPRGKLLKSAELYNSITGTWMPISSMHKARK 268
           W++   M   R   G+A L  +    GG D    L  S E YN  +  W  ++ M+  R 
Sbjct: 89  WTSVANMRDRRSTLGAAVLNGLLYAVGGFDGSTGL-SSVEAYNIKSNEWFHVAPMNTRRS 147

Query: 269 MCSGVFMDGKFYVIGGIGEGSSAMLTDVEMYDLETGKWTQITDMFPARIGSDGVSVISAA 328
                 + G  Y +GG    S   L+ VE Y+  T +WT I +M   R    G  V    
Sbjct: 148 SVGVGVVGGLLYAVGGYDVASRQCLSTVECYNATTNEWTYIAEMSTRR---SGAGV---- 200

Query: 329 GEAPPLLAVVNNELYAA-----DHEKEEVRKFDKGRKLWRTLGRLPEQASSMNGWGLAFR 383
                   V+NN LYA         ++ V  +D     WR +  +     +    G+   
Sbjct: 201 -------GVLNNLLYAVGGHDGPLVRKSVEVYDPTTNAWRQVADMNMCRRNA---GVC-- 248

Query: 384 ACGDQLIVIGG 394
           A    L V+GG
Sbjct: 249 AVNGLLYVVGG 259
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query437
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.98
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 99.96
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.91
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.77
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.65
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.56
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.5
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.46
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.22
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.18
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.02
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.98
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.97
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.94
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 97.92
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.88
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.73
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.71
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.69
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.63
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.59
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.53
3jrp_A379 Fusion protein of protein transport protein SEC13 97.38
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.38
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.38
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.33
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.33
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.29
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.26
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.26
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.2
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.18
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 97.18
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 97.17
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.15
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.14
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.13
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.12
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.12
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.11
3v9f_A 781 Two-component system sensor histidine kinase/RESP 97.1
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.09
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.07
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.05
3jrp_A 379 Fusion protein of protein transport protein SEC13 97.04
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.03
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.0
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 96.99
4a2l_A 795 BT_4663, two-component system sensor histidine kin 96.98
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.97
2p4o_A306 Hypothetical protein; putative lactonase, structur 96.96
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 96.94
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 96.91
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 96.9
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.89
3jro_A 753 Fusion protein of protein transport protein SEC13 96.87
3v9f_A781 Two-component system sensor histidine kinase/RESP 96.87
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 96.86
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.82
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.81
3v65_B386 Low-density lipoprotein receptor-related protein; 96.8
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 96.8
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.78
4a2l_A 795 BT_4663, two-component system sensor histidine kin 96.77
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.76
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 96.72
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 96.71
2pm7_B297 Protein transport protein SEC13, protein transport 96.65
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.63
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.58
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.56
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.52
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 96.49
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 96.46
2pm7_B297 Protein transport protein SEC13, protein transport 96.43
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.41
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 96.4
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 96.39
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.38
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.35
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 96.31
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.29
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.29
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 96.26
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.26
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 96.25
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 96.24
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.23
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.17
2fp8_A322 Strictosidine synthase; six bladed beta propeller 96.17
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 96.17
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 96.16
3p5b_L400 Low density lipoprotein receptor variant; B-propel 96.14
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 96.13
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.13
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.13
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 96.11
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 96.09
3jro_A 753 Fusion protein of protein transport protein SEC13 96.07
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 96.05
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 96.05
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.02
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 96.01
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 96.0
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 96.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 95.98
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.98
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 95.97
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 95.96
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 95.92
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 95.91
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 95.84
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 95.83
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 95.78
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 95.77
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 95.76
4g56_B357 MGC81050 protein; protein arginine methyltransfera 95.73
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 95.72
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 95.71
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.71
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 95.7
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 95.69
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 95.67
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 95.67
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 95.65
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 95.62
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 95.59
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 95.57
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 95.54
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 95.53
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 95.5
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 95.47
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 95.44
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.44
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 95.43
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 95.41
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 95.4
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 95.38
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 95.38
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 95.37
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 95.35
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 95.31
2fp8_A322 Strictosidine synthase; six bladed beta propeller 95.26
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 95.23
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 95.19
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.18
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 95.17
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 95.14
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 95.14
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 95.02
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 95.01
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 94.99
3ott_A758 Two-component system sensor histidine kinase; beta 94.89
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 94.88
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.84
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 94.82
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 94.81
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 94.81
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 94.69
2p4o_A306 Hypothetical protein; putative lactonase, structur 94.66
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 94.62
3v65_B386 Low-density lipoprotein receptor-related protein; 94.62
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 94.6
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 94.58
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 94.56
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 94.55
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 94.53
3b7f_A 394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 94.52
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 94.4
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 94.38
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 94.34
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 94.31
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 94.21
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 94.15
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 94.12
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 94.08
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 94.04
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 93.96
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 93.79
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 93.78
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 93.74
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 93.73
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 93.7
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 93.66
3ott_A 758 Two-component system sensor histidine kinase; beta 93.64
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 93.63
1itv_A195 MMP9; adaptive molecular recognition, beta propell 93.62
4e54_B435 DNA damage-binding protein 2; beta barrel, double 93.59
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 93.55
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 93.54
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 93.53
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 93.51
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 93.48
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 93.35
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 93.33
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 93.31
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, he 93.2
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 93.17
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 93.06
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 93.05
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 93.04
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 92.88
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 92.84
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 92.77
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 92.49
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 92.46
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 92.43
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 92.42
2ymu_A577 WD-40 repeat protein; unknown function, two domain 92.4
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 92.33
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 92.21
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 92.21
2xyi_A430 Probable histone-binding protein CAF1; transcripti 92.14
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 91.96
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 91.95
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 91.94
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 91.91
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 91.88
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 91.63
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 91.62
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 91.57
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 91.5
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 91.39
2ymu_A577 WD-40 repeat protein; unknown function, two domain 91.39
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 91.28
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 91.25
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 91.23
2xyi_A430 Probable histone-binding protein CAF1; transcripti 91.13
1hxn_A219 Hemopexin, HPX; heme, binding protein; 1.80A {Oryc 91.1
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 91.01
3p5b_L400 Low density lipoprotein receptor variant; B-propel 90.96
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 90.68
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 90.54
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 90.51
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 90.42
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 90.42
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 90.41
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, he 90.39
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 90.37
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 90.33
3lp9_A227 LS-24; SEED albumin, plant protein; HET: SPM; 2.20 90.27
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 90.15
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 90.13
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 89.88
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 89.83
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 89.77
1itv_A195 MMP9; adaptive molecular recognition, beta propell 89.53
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 89.23
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 89.06
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 88.99
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 88.84
3ju4_A 670 Endo-N-acetylneuraminidase; endonf, polysia, high- 88.78
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 88.72
2ece_A462 462AA long hypothetical selenium-binding protein; 88.69
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 88.64
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 88.47
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 88.41
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 87.93
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 87.91
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 87.49
1hxn_A219 Hemopexin, HPX; heme, binding protein; 1.80A {Oryc 87.38
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 86.79
1k32_A 1045 Tricorn protease; protein degradation, substrate g 86.55
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 86.47
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 86.0
3kya_A496 Putative phosphatase; structural genomics, joint c 85.39
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 85.06
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 84.92
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 84.78
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 84.77
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 84.65
1gen_A218 Gelatinase A; hydrolase, hemopexin domain, metallo 84.58
2qe8_A 343 Uncharacterized protein; structural genomics, join 84.36
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 84.12
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 83.47
2cn3_A 737 Xyloglucanase, beta-1,4-xyloglucan hydrolase; glyc 82.78
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 82.6
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 81.74
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 81.48
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
Probab=100.00  E-value=6.6e-45  Score=348.21  Aligned_cols=280  Identities=21%  Similarity=0.321  Sum_probs=242.7

Q ss_pred             HHHHhhcCcchHHhhhhcCccccEEEEEecCceEEEeccCCCCeeeCCCCCCccccccCCceeEEeCCEEEEEcCcc---
Q 043540          118 AFRSLIQSGELYRLRREMGIIEHWVYFSCKLKEWEAFDPIHHRWMHLPPMNASDCFMCADKESLAVGTELLVFGKEV---  194 (437)
Q Consensus       118 ~w~sli~s~~~y~~~~~~~~~~~~l~~~~~~~~~~~yDp~~~~W~~l~~~p~~~~~~~~~~~~~~~~~~lyv~GG~~---  194 (437)
                      ..+++..++.+|++||.. ..        ..++++.||+.+++|..++++|.++..++    +++++++||++||..   
T Consensus        17 ~~~~~~~~~~i~v~GG~~-~~--------~~~~~~~~d~~~~~W~~~~~~p~~r~~~~----~~~~~~~lyv~GG~~~~~   83 (308)
T 1zgk_A           17 GSHAPKVGRLIYTAGGYF-RQ--------SLSYLEAYNPSNGTWLRLADLQVPRSGLA----GCVVGGLLYAVGGRNNSP   83 (308)
T ss_dssp             ----CCCCCCEEEECCBS-SS--------BCCCEEEEETTTTEEEECCCCSSCCBSCE----EEEETTEEEEECCEEEET
T ss_pred             CccccCCCCEEEEEeCcC-CC--------CcceEEEEcCCCCeEeECCCCCcccccce----EEEECCEEEEECCCcCCC
Confidence            345567788999999972 21        35779999999999999999999887543    478899999999962   


Q ss_pred             ----CCceEEEEECCCCceecCCCCCCCccceeeEEECCEEEEEeccCCCCCCCceEEEEECCCCcEEecCCCCcCCcCe
Q 043540          195 ----HGNAIYRYNLLTNTWSTGMTMNTPRCLFGSASLGEIAILAGGCDPRGKLLKSAELYNSITGTWMPISSMHKARKMC  270 (437)
Q Consensus       195 ----~~~~v~~yd~~t~~W~~~~~~~~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~yd~~t~~W~~~~~~~~~r~~~  270 (437)
                          ..+++++||+.+++|+.+++||.+|..|++++++++|||+||.+.. ..++++++||+.+++|+.++++|.+|..+
T Consensus        84 ~~~~~~~~~~~~d~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~-~~~~~~~~yd~~~~~W~~~~~~p~~r~~~  162 (308)
T 1zgk_A           84 DGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGC-IHHNSVERYEPERDEWHLVAPMLTRRIGV  162 (308)
T ss_dssp             TEEEECCCEEEEETTTTEEEECCCCSSCCBTCEEEEETTEEEEECCEETT-EECCCEEEEETTTTEEEECCCCSSCCBSC
T ss_pred             CCCeecceEEEECCCCCeEeECCCCCcCccccEEEEECCEEEEEcCCCCC-cccccEEEECCCCCeEeECCCCCccccce
Confidence                3478999999999999999999999999999999999999998754 35789999999999999999999999999


Q ss_pred             eEEEECCEEEEEecccCCCCccCCeEEEEECCCCceEecCCCCCcccCCCCcccccccCCCCCEEEEECCEEEEEeCC--
Q 043540          271 SGVFMDGKFYVIGGIGEGSSAMLTDVEMYDLETGKWTQITDMFPARIGSDGVSVISAAGEAPPLLAVVNNELYAADHE--  348 (437)
Q Consensus       271 ~~~~~~g~lyv~GG~~~~~~~~~~~v~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ly~~gg~--  348 (437)
                      ++++++++||++||..  ....++++++||+.+++|+.++++|.+|..              +.+++++++||++||.  
T Consensus       163 ~~~~~~~~iyv~GG~~--~~~~~~~~~~yd~~~~~W~~~~~~p~~r~~--------------~~~~~~~~~iyv~GG~~~  226 (308)
T 1zgk_A          163 GVAVLNRLLYAVGGFD--GTNRLNSAECYYPERNEWRMITAMNTIRSG--------------AGVCVLHNCIYAAGGYDG  226 (308)
T ss_dssp             EEEEETTEEEEECCBC--SSCBCCCEEEEETTTTEEEECCCCSSCCBS--------------CEEEEETTEEEEECCBCS
T ss_pred             EEEEECCEEEEEeCCC--CCCcCceEEEEeCCCCeEeeCCCCCCcccc--------------ceEEEECCEEEEEeCCCC
Confidence            9999999999999987  334478899999999999999999999988              7889999999999985  


Q ss_pred             ---CCeEEEEeCCCCcEEEccCCCCcccCCCcccEEEEEeCCEEEEEcCCCCCCCCeeEEEeeecCCCCCCceecCccCC
Q 043540          349 ---KEEVRKFDKGRKLWRTLGRLPEQASSMNGWGLAFRACGDQLIVIGGPRDSGGGIVELNGWVPDEGPPHWKLLARQPM  425 (437)
Q Consensus       349 ---~~~v~~yd~~~~~W~~v~~lp~~~~~~~~~~~a~~~~~~~l~v~GG~~~~~~~~~~~~~~~~d~~~~~W~~l~~~p~  425 (437)
                         .+++++||+++++|+.++.+|.++.     ++++++++++|||+||.+.   ......++.||+.+++|++++.+|.
T Consensus       227 ~~~~~~v~~yd~~~~~W~~~~~~p~~r~-----~~~~~~~~~~i~v~GG~~~---~~~~~~v~~yd~~~~~W~~~~~~p~  298 (308)
T 1zgk_A          227 QDQLNSVERYDVETETWTFVAPMKHRRS-----ALGITVHQGRIYVLGGYDG---HTFLDSVECYDPDTDTWSEVTRMTS  298 (308)
T ss_dssp             SSBCCCEEEEETTTTEEEECCCCSSCCB-----SCEEEEETTEEEEECCBCS---SCBCCEEEEEETTTTEEEEEEECSS
T ss_pred             CCccceEEEEeCCCCcEEECCCCCCCcc-----ceEEEEECCEEEEEcCcCC---CcccceEEEEcCCCCEEeecCCCCC
Confidence               4789999999999999999988765     4566788999999999763   2334578899999999999999999


Q ss_pred             CceEeeeEEe
Q 043540          426 CGFVFNCTVM  435 (437)
Q Consensus       426 ~~~~~~~~v~  435 (437)
                      +|+.|+|+++
T Consensus       299 ~r~~~~~~~l  308 (308)
T 1zgk_A          299 GRSGVGVAVT  308 (308)
T ss_dssp             CCBSCEEEEC
T ss_pred             CcccceeEeC
Confidence            9999999874
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1hxn_A Hemopexin, HPX; heme, binding protein; 1.80A {Oryctolagus cuniculus} SCOP: b.66.1.1 Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3lp9_A LS-24; SEED albumin, plant protein; HET: SPM; 2.20A {Lathyrus sativus} PDB: 3s0l_A 3v6n_A 4hsd_A 3s18_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1hxn_A Hemopexin, HPX; heme, binding protein; 1.80A {Oryctolagus cuniculus} SCOP: b.66.1.1 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1gen_A Gelatinase A; hydrolase, hemopexin domain, metalloprotease, hydrolase (metalloprotease); 2.15A {Homo sapiens} SCOP: b.66.1.1 PDB: 1rtg_A Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 437
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-15
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 4e-08
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 5e-08
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-06
d1zgka1 288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 7e-05
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 9e-13
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 3e-09
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 8e-09
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 9e-09
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 5e-08
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 74.2 bits (180), Expect = 2e-15
 Identities = 48/190 (25%), Positives = 67/190 (35%), Gaps = 9/190 (4%)

Query: 135 MGIIEHWVYFSCKLKEWEAFDPIHHRWMHLPPMNASDCFMCADKESLAVGTELLVFGKEV 194
           +G     ++ +   +     D  H     L         +         G     F    
Sbjct: 107 VGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGG-----FDGTN 161

Query: 195 HGNAIYRYNLLTNTWSTGMTMNTPRCLFGSASLGEIAILAGGCDPRGKLLKSAELYNSIT 254
             N+   Y    N W     MNT R   G   L      AGG D + +L  S E Y+  T
Sbjct: 162 RLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQL-NSVERYDVET 220

Query: 255 GTWMPISSMHKARKMCSGVFMDGKFYVIGGIGEGSSAMLTDVEMYDLETGKWTQITDMFP 314
            TW  ++ M   R         G+ YV+GG        L  VE YD +T  W+++T M  
Sbjct: 221 ETWTFVAPMKHRRSALGITVHQGRIYVLGG--YDGHTFLDSVECYDPDTDTWSEVTRMTS 278

Query: 315 ARIGSDGVSV 324
            R G  GV+V
Sbjct: 279 GRSGV-GVAV 287
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query437
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.96
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.95
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 98.59
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.75
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 97.37
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.3
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 97.14
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.13
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.84
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.82
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.71
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.43
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.37
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 96.36
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 96.29
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.18
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 96.12
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 96.1
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 96.04
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 95.95
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 95.73
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 95.66
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 95.65
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 95.38
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 95.25
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 95.09
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 95.03
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 94.82
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 94.78
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 94.66
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 94.61
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 94.56
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 94.55
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 94.29
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 94.25
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 94.06
d1tbga_340 beta1-subunit of the signal-transducing G protein 93.94
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 93.94
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 93.78
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 93.76
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 93.57
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 93.43
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 92.95
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 92.69
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 92.67
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 92.39
d1tbga_340 beta1-subunit of the signal-transducing G protein 92.15
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 91.9
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 91.67
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 91.39
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 91.11
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 90.99
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 90.06
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 90.0
d1v0ea1516 Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 34 88.4
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 87.99
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 87.83
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 87.58
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 86.7
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 85.31
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 83.44
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 82.51
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 81.33
d1flga_ 582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 80.9
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=7.2e-40  Score=306.89  Aligned_cols=272  Identities=22%  Similarity=0.343  Sum_probs=236.6

Q ss_pred             CcchHHhhhhcCccccEEEEEecCceEEEeccCCCCeeeCCCCCCccccccCCceeEEeCCEEEEEcCc-------cCCc
Q 043540          125 SGELYRLRREMGIIEHWVYFSCKLKEWEAFDPIHHRWMHLPPMNASDCFMCADKESLAVGTELLVFGKE-------VHGN  197 (437)
Q Consensus       125 s~~~y~~~~~~~~~~~~l~~~~~~~~~~~yDp~~~~W~~l~~~p~~~~~~~~~~~~~~~~~~lyv~GG~-------~~~~  197 (437)
                      ...+|++||....         .+++++.||+.+++|.++++||.+|..+    ++++++++|||+||.       ...+
T Consensus         4 g~~iyv~GG~~~~---------~~~~~~~yd~~t~~W~~~~~~p~~R~~~----~~~~~~~~iyv~GG~~~~~~~~~~~~   70 (288)
T d1zgka1           4 GRLIYTAGGYFRQ---------SLSYLEAYNPSNGTWLRLADLQVPRSGL----AGCVVGGLLYAVGGRNNSPDGNTDSS   70 (288)
T ss_dssp             CCCEEEECCBSSS---------BCCCEEEEETTTTEEEECCCCSSCCBSC----EEEEETTEEEEECCEEEETTEEEECC
T ss_pred             CCEEEEECCcCCC---------CCceEEEEECCCCeEEECCCCCCcccee----EEEEECCEEEEEeCcccCCCCccccc
Confidence            4567888887532         3567899999999999999999998754    448889999999984       2357


Q ss_pred             eEEEEECCCCceecCCCCCCCccceeeEEECCEEEEEeccCCCCCCCceEEEEECCCCcEEecCCCCcCCcCeeEEEECC
Q 043540          198 AIYRYNLLTNTWSTGMTMNTPRCLFGSASLGEIAILAGGCDPRGKLLKSAELYNSITGTWMPISSMHKARKMCSGVFMDG  277 (437)
Q Consensus       198 ~v~~yd~~t~~W~~~~~~~~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~yd~~t~~W~~~~~~~~~r~~~~~~~~~g  277 (437)
                      ++++||+.+++|+.+++||.+|..|++++++++||++||..+. ..++.++.||+.+++|...+.++..|..+++++.++
T Consensus        71 ~~~~yd~~~~~w~~~~~~p~~r~~~~~~~~~~~i~~~gg~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~  149 (288)
T d1zgka1          71 ALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGC-IHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNR  149 (288)
T ss_dssp             CEEEEETTTTEEEECCCCSSCCBTCEEEEETTEEEEECCEETT-EECCCEEEEETTTTEEEECCCCSSCCBSCEEEEETT
T ss_pred             hhhhcccccccccccccccceecceeccccceeeEEecceecc-cccceeeeeccccCccccccccccccccceeeeeee
Confidence            8999999999999999999999999999999999999998654 357889999999999999999999999999999999


Q ss_pred             EEEEEecccCCCCccCCeEEEEECCCCceEecCCCCCcccCCCCcccccccCCCCCEEEEECCEEEEEeCC-----CCeE
Q 043540          278 KFYVIGGIGEGSSAMLTDVEMYDLETGKWTQITDMFPARIGSDGVSVISAAGEAPPLLAVVNNELYAADHE-----KEEV  352 (437)
Q Consensus       278 ~lyv~GG~~~~~~~~~~~v~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ly~~gg~-----~~~v  352 (437)
                      ++|++||..  .......++.||+.+++|...+.++..+..              +++++.+++||++||.     .+..
T Consensus       150 ~~~~~GG~~--~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~--------------~~~~~~~~~i~i~GG~~~~~~~~~~  213 (288)
T d1zgka1         150 LLYAVGGFD--GTNRLNSAECYYPERNEWRMITAMNTIRSG--------------AGVCVLHNCIYAAGGYDGQDQLNSV  213 (288)
T ss_dssp             EEEEECCBC--SSCBCCCEEEEETTTTEEEECCCCSSCCBS--------------CEEEEETTEEEEECCBCSSSBCCCE
T ss_pred             cceEecCcc--cccccceEEEeecccccccccccccccccc--------------ccccceeeeEEEecCccccccccce
Confidence            999999986  455677899999999999999988888877              7889999999999873     4678


Q ss_pred             EEEeCCCCcEEEccCCCCcccCCCcccEEEEEeCCEEEEEcCCCCCCCCeeEEEeeecCCCCCCceecCccCCCceEeee
Q 043540          353 RKFDKGRKLWRTLGRLPEQASSMNGWGLAFRACGDQLIVIGGPRDSGGGIVELNGWVPDEGPPHWKLLARQPMCGFVFNC  432 (437)
Q Consensus       353 ~~yd~~~~~W~~v~~lp~~~~~~~~~~~a~~~~~~~l~v~GG~~~~~~~~~~~~~~~~d~~~~~W~~l~~~p~~~~~~~~  432 (437)
                      ++||..+++|..++++|.++.     ++++++++++|||+||.+.   ......+|.||+.+++|+++++||.+|..|++
T Consensus       214 ~~~~~~~~~~~~~~~~p~~r~-----~~~~~~~~~~l~v~GG~~~---~~~~~~v~~yd~~~~~W~~~~~~p~~R~~~~~  285 (288)
T d1zgka1         214 ERYDVETETWTFVAPMKHRRS-----ALGITVHQGRIYVLGGYDG---HTFLDSVECYDPDTDTWSEVTRMTSGRSGVGV  285 (288)
T ss_dssp             EEEETTTTEEEECCCCSSCCB-----SCEEEEETTEEEEECCBCS---SCBCCEEEEEETTTTEEEEEEECSSCCBSCEE
T ss_pred             eeeeecceeeecccCccCccc-----ceEEEEECCEEEEEecCCC---CeecceEEEEECCCCEEEECCCCCCCcEeEEE
Confidence            999999999999998888765     4667788999999999763   23334678999999999999999999999988


Q ss_pred             EE
Q 043540          433 TV  434 (437)
Q Consensus       433 ~v  434 (437)
                      ||
T Consensus       286 ~~  287 (288)
T d1zgka1         286 AV  287 (288)
T ss_dssp             EE
T ss_pred             EE
Confidence            86
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1v0ea1 b.68.1.2 (A:245-760) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure