Citrus Sinensis ID: 043549

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MSDPTGKELIGCCLLCSRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWNLLTVTPIKDDSGKTIKFIGMQVEVSKYTEGVNDKALRPNGLSKSLIRYDARQKEKALGSITEVIQTVKRSQSHIRALSLDTTNKLEEKRSSILIVLCLHLLKM
ccccccccccccccccccccccccccHHHHHHHHHHHHccccEEEEEEcEEccccccEEEEEEEEEEcccccEEEEEEEEcccccccccccHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccc
cccccHHHHHcccccccHHHccccccHHHHHHHHHHHHccccEEEEEEEEcccccEEEEEEEEEEEEcccccEEEEEEEEEEccHccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccccccccccHHHHHHHHccccc
msdptgkeligccllcsrflqgpetdkneVEKIRDAVRNGKSYCGRllnykkdgtpfwnlltvtpikddsgktiKFIGMQVEVSKytegvndkalrpnglsksLIRYDARQKEKALGSITEVIQTVKRSQSHIRALSLDTTNKLEEKRSSILIVLCLHLLKM
msdptgkeligCCLLCSRflqgpetdknevekirdAVRNGKSYCGRLLnykkdgtpfWNLLTVtpikddsgkTIKFIGMQVEVSkytegvndkalrpnglskslIRYDARQKEKalgsiteviqtvkrsqshiralsldttnkleekrssiLIVLCLHLLKM
MSDPTGKELIGCCLLCSRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWNLLTVTPIKDDSGKTIKFIGMQVEVSKYTEGVNDKALRPNGLSKSLIRYDARQKEKALGSITEVIQTVKRSQSHIRALSLDTTNKLEEKRSSILIVLCLHLLKM
*******ELIGCCLLCSRFLQGP******VEKIRDAVRNGKSYCGRLLNYKKDGTPFWNLLTVTPIKDDSGKTIKFIGMQVEVSKYTEGVNDKAL*******SLIRYD******ALGSITEVIQTV******IRAL***********RSSILIVLCLHLL**
MSDPTGKELIGCCLLCSRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWNLLTVTPIKDDSGKTIKFIGMQVEVSKYTE*******************************T********************************IVLCLHLLKM
********LIGCCLLCSRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWNLLTVTPIKDDSGKTIKFIGMQVEVSKYTEGVNDKALRPNGLSKSLIRYDARQKEKALGSITEVIQTVKRSQSHIRALSLDTTNKLEEKRSSILIVLCLHLLKM
*SDPTGKELIGCCLLCSRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWNLLTVTPIKDDSGKTIKFIGMQVEVSKYTEGVNDKALRPNGLSKSLIRYDARQKEKALGSITEVIQTVKRSQSHIRALSLDTTNKL***RSSILIVLCLHLLKM
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDPTGKELIGCCLLCSRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWNLLTVTPIKDDSGKTIKFIGMQVEVSKYTEGVNDKALRPNGLSKSLIRYDARQKEKALGSITEVIQTVKRSQSHIRALSLDTTNKLEEKRSSILIVLCLHLLKM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query162 2.2.26 [Sep-21-2011]
P93025 915 Phototropin-2 OS=Arabidop no no 0.839 0.148 0.767 7e-57
Q9ST27 907 Phototropin-2 OS=Oryza sa no no 0.697 0.124 0.743 4e-47
O48963 996 Phototropin-1 OS=Arabidop no no 0.820 0.133 0.615 2e-42
Q2RBR1 921 Phototropin-1B OS=Oryza s no no 0.858 0.150 0.567 5e-42
Q2QYY8 921 Phototropin-1A OS=Oryza s no no 0.858 0.150 0.567 5e-42
Q4ZSY3 534 Blue-light-activated prot yes no 0.635 0.192 0.358 2e-14
Q881J7 534 Blue-light-activated prot yes no 0.629 0.191 0.355 3e-14
Q48IV1 534 Blue-light-activated prot yes no 0.635 0.192 0.358 1e-13
A6X554 491 Blue-light-activated hist yes no 0.413 0.136 0.447 5e-11
O64511399 Protein TWIN LOV 1 OS=Ara no no 0.481 0.195 0.402 7e-11
>sp|P93025|PHOT2_ARATH Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=1 SV=2 Back     alignment and function desciption
 Score =  219 bits (557), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 109/142 (76%), Positives = 123/142 (86%), Gaps = 6/142 (4%)

Query: 1   MSDPTGKELIG-CCLLCSRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWN 59
           M+  + KE++G  C    RFLQGP+TDKNEV KIRD V+NGKSYCGRLLNYKKDGTPFWN
Sbjct: 157 MTGYSSKEIVGRNC----RFLQGPDTDKNEVAKIRDCVKNGKSYCGRLLNYKKDGTPFWN 212

Query: 60  LLTVTPIKDDSGKTIKFIGMQVEVSKYTEGVNDKALRPNGLSKSLIRYDARQKEKALGSI 119
           LLTVTPIKDD G TIKFIGMQVEVSKYTEGVNDKALRPNGLSKSLIRYDARQKEKAL SI
Sbjct: 213 LLTVTPIKDDQGNTIKFIGMQVEVSKYTEGVNDKALRPNGLSKSLIRYDARQKEKALDSI 272

Query: 120 TEVIQTVKRSQSHIR-ALSLDT 140
           TEV+QT++  +S ++ ++S DT
Sbjct: 273 TEVVQTIRHRKSQVQESVSNDT 294
Protein kinase that acts as a blue-light photoreceptor in a signal-transduction pathway for photo-induced movements. Mediates calcium spiking of extra- and intracellular origins in response to blue light. Involved in hypocotyl phototropism. Contributes to the chloroplast accumulation in low blue light and mediates their translocation (avoidance response) at high fluence. Regulates stomata opening and photomorphogenesis response of leaf tissue. Not involved in hypocotyl elongation inhibition, anthocyanin accumulation or cotyledon opening.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9ST27|PHOT2_ORYSJ Phototropin-2 OS=Oryza sativa subsp. japonica GN=PHOT2 PE=1 SV=1 Back     alignment and function description
>sp|O48963|PHOT1_ARATH Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=1 SV=1 Back     alignment and function description
>sp|Q2RBR1|PHT1B_ORYSJ Phototropin-1B OS=Oryza sativa subsp. japonica GN=PHOT1B PE=1 SV=2 Back     alignment and function description
>sp|Q2QYY8|PHT1A_ORYSJ Phototropin-1A OS=Oryza sativa subsp. japonica GN=PHOT1A PE=1 SV=2 Back     alignment and function description
>sp|Q4ZSY3|LOVHK_PSEU2 Blue-light-activated protein OS=Pseudomonas syringae pv. syringae (strain B728a) GN=Psyr_2700 PE=3 SV=1 Back     alignment and function description
>sp|Q881J7|LOVHK_PSESM Blue-light-activated protein OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=PSPTO_2896 PE=1 SV=1 Back     alignment and function description
>sp|Q48IV1|LOVHK_PSE14 Blue-light-activated protein OS=Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6) GN=PSPPH_2483 PE=3 SV=2 Back     alignment and function description
>sp|A6X554|LOVHK_OCHA4 Blue-light-activated histidine kinase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=Oant_3652 PE=3 SV=1 Back     alignment and function description
>sp|O64511|TLOV1_ARATH Protein TWIN LOV 1 OS=Arabidopsis thaliana GN=TLP1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
356559155 990 PREDICTED: phototropin-2-like [Glycine m 0.882 0.144 0.770 3e-57
255546656 984 serine/threonine protein kinase, putativ 0.870 0.143 0.753 4e-57
60099458 996 phototropin [Phaseolus vulgaris] 0.882 0.143 0.75 2e-56
356526675 996 PREDICTED: phototropin-2-like [Glycine m 0.882 0.143 0.763 2e-56
449475890 629 PREDICTED: phototropin-2-like [Cucumis s 0.876 0.225 0.755 6e-56
449444602 921 PREDICTED: phototropin-2-like [Cucumis s 0.796 0.140 0.821 1e-55
20260484 549 unknown protein [Arabidopsis thaliana] g 0.839 0.247 0.767 2e-55
113911589 952 phototropin-2 [Solanum lycopersicum] 0.925 0.157 0.711 2e-55
357517333 941 Phototropin [Medicago truncatula] gi|355 0.882 0.151 0.736 2e-55
30697015 689 phototropin 2 [Arabidopsis thaliana] gi| 0.839 0.197 0.767 2e-55
>gi|356559155|ref|XP_003547866.1| PREDICTED: phototropin-2-like [Glycine max] Back     alignment and taxonomy information
 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 124/148 (83%), Gaps = 5/148 (3%)

Query: 1   MSDPTGKELIG-CCLLCSRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWN 59
           M+  + KE+IG  C    RFLQGPETDKNEV KIRDA RNG+SYCGRLLNYKKDGTPFWN
Sbjct: 217 MTGYSSKEIIGRNC----RFLQGPETDKNEVAKIRDATRNGRSYCGRLLNYKKDGTPFWN 272

Query: 60  LLTVTPIKDDSGKTIKFIGMQVEVSKYTEGVNDKALRPNGLSKSLIRYDARQKEKALGSI 119
           LLT+TPIKDD G TIKFIGMQVEVSKYTEGVN+KALRPNGL KSLIRYDARQKEKALGSI
Sbjct: 273 LLTITPIKDDHGNTIKFIGMQVEVSKYTEGVNEKALRPNGLPKSLIRYDARQKEKALGSI 332

Query: 120 TEVIQTVKRSQSHIRALSLDTTNKLEEK 147
           TEV+QTVK  +S I   + DT  K EE+
Sbjct: 333 TEVVQTVKDPKSIINDRNGDTAAKPEEQ 360

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255546656|ref|XP_002514387.1| serine/threonine protein kinase, putative [Ricinus communis] gi|223546484|gb|EEF47983.1| serine/threonine protein kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|60099458|dbj|BAD89968.1| phototropin [Phaseolus vulgaris] Back     alignment and taxonomy information
>gi|356526675|ref|XP_003531942.1| PREDICTED: phototropin-2-like [Glycine max] Back     alignment and taxonomy information
>gi|449475890|ref|XP_004154580.1| PREDICTED: phototropin-2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449444602|ref|XP_004140063.1| PREDICTED: phototropin-2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|20260484|gb|AAM13140.1| unknown protein [Arabidopsis thaliana] gi|31711968|gb|AAP68340.1| At5g58140 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|113911589|gb|ABI48276.1| phototropin-2 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|357517333|ref|XP_003628955.1| Phototropin [Medicago truncatula] gi|355522977|gb|AET03431.1| Phototropin [Medicago truncatula] Back     alignment and taxonomy information
>gi|30697015|ref|NP_568874.2| phototropin 2 [Arabidopsis thaliana] gi|332009618|gb|AED97001.1| phototropin 2 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
TAIR|locus:2155821 915 PHOT2 "phototropin 2" [Arabido 0.864 0.153 0.763 1.2e-52
UNIPROTKB|Q9ST27 907 PHOT2 "Phototropin-2" [Oryza s 0.771 0.137 0.687 1.9e-42
TAIR|locus:2102674 996 PHOT1 "phototropin 1" [Arabido 0.827 0.134 0.619 1.2e-39
UNIPROTKB|Q8H935 963 Vfphot1a "Phototropin" [Vicia 0.845 0.142 0.611 2.3e-39
UNIPROTKB|Q2QYY8 921 PHOT1A "Phototropin-1A" [Oryza 0.895 0.157 0.559 2.6e-39
UNIPROTKB|Q2RBR1 921 PHOT1B "Phototropin-1B" [Oryza 0.895 0.157 0.559 2.6e-39
UNIPROTKB|G4NFS7 961 MGG_08735 "Uncharacterized pro 0.629 0.106 0.398 7.5e-12
TAIR|locus:2058852399 PLPB "PAS/LOV PROTEIN C" [Arab 0.530 0.215 0.377 1.6e-11
UNIPROTKB|Q887F0 425 PSPTO_1346 "Sensory box/GGDEF 0.604 0.230 0.306 5.9e-11
UNIPROTKB|F8WCG6195 KCNH8 "Potassium voltage-gated 0.623 0.517 0.301 9.7e-09
TAIR|locus:2155821 PHOT2 "phototropin 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 552 (199.4 bits), Expect = 1.2e-52, P = 1.2e-52
 Identities = 110/144 (76%), Positives = 124/144 (86%)

Query:     1 MSDPTGKELIGCCLLCSRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWNL 60
             M+  + KE++G    C RFLQGP+TDKNEV KIRD V+NGKSYCGRLLNYKKDGTPFWNL
Sbjct:   157 MTGYSSKEIVG--RNC-RFLQGPDTDKNEVAKIRDCVKNGKSYCGRLLNYKKDGTPFWNL 213

Query:    61 LTVTPIKDDSGKTIKFIGMQVEVSKYTEGVNDKALRPNGLSKSLIRYDARQKEKALGSIT 120
             LTVTPIKDD G TIKFIGMQVEVSKYTEGVNDKALRPNGLSKSLIRYDARQKEKAL SIT
Sbjct:   214 LTVTPIKDDQGNTIKFIGMQVEVSKYTEGVNDKALRPNGLSKSLIRYDARQKEKALDSIT 273

Query:   121 EVIQTVKRSQSHIR-ALSLDTTNK 143
             EV+QT++  +S ++ ++S DT  K
Sbjct:   274 EVVQTIRHRKSQVQESVSNDTMVK 297
GO:0000155 "phosphorelay sensor kinase activity" evidence=IEA
GO:0000160 "phosphorelay signal transduction system" evidence=IEA
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;IMP;IDA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0004871 "signal transducer activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0007165 "signal transduction" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0009638 "phototropism" evidence=IGI;IMP
GO:0010118 "stomatal movement" evidence=IGI;IMP
GO:0009902 "chloroplast relocation" evidence=RCA;TAS
GO:0016020 "membrane" evidence=ISS
GO:0009637 "response to blue light" evidence=IGI;RCA
GO:0010181 "FMN binding" evidence=IDA;TAS
GO:0046777 "protein autophosphorylation" evidence=RCA;TAS
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0009882 "blue light photoreceptor activity" evidence=IMP
GO:0010362 "negative regulation of anion channel activity by blue light" evidence=IMP
GO:0042802 "identical protein binding" evidence=IPI
GO:0000023 "maltose metabolic process" evidence=RCA
GO:0006364 "rRNA processing" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0009744 "response to sucrose stimulus" evidence=RCA
GO:0010027 "thylakoid membrane organization" evidence=RCA
GO:0010103 "stomatal complex morphogenesis" evidence=RCA
GO:0010114 "response to red light" evidence=RCA
GO:0010155 "regulation of proton transport" evidence=RCA
GO:0010207 "photosystem II assembly" evidence=RCA
GO:0010218 "response to far red light" evidence=RCA
GO:0016556 "mRNA modification" evidence=RCA
GO:0019252 "starch biosynthetic process" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
GO:0034660 "ncRNA metabolic process" evidence=RCA
GO:0035304 "regulation of protein dephosphorylation" evidence=RCA
GO:0042793 "transcription from plastid promoter" evidence=RCA
GO:0043085 "positive regulation of catalytic activity" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
UNIPROTKB|Q9ST27 PHOT2 "Phototropin-2" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2102674 PHOT1 "phototropin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8H935 Vfphot1a "Phototropin" [Vicia faba (taxid:3906)] Back     alignment and assigned GO terms
UNIPROTKB|Q2QYY8 PHOT1A "Phototropin-1A" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q2RBR1 PHOT1B "Phototropin-1B" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|G4NFS7 MGG_08735 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
TAIR|locus:2058852 PLPB "PAS/LOV PROTEIN C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q887F0 PSPTO_1346 "Sensory box/GGDEF domain protein" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)] Back     alignment and assigned GO terms
UNIPROTKB|F8WCG6 KCNH8 "Potassium voltage-gated channel subfamily H member 8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
PHOT2
PHOT2 (PHOTOTROPIN 2); FMN binding / blue light photoreceptor/ kinase/ protein serine/threonine kinase; Membrane-bound protein serine/threonine kinase that functions as blue light photoreceptor in redundancy with PHO1. Involved in stomatal opening, chloroplast movement and phototropism. Mediates blue light-induced growth enhancements. PHOT1 and PHOT2 mediate blue light-dependent activation of the plasma membrane H+-ATPase in guard cell protoplasts. PHOT2 possesses two LOV (LOV1 and LOV2, for light-oxygen-voltage-sensing) domains involved in FMN-binding and a C-terminus forming a serine [...] (915 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
NPH3
NPH3 (NON-PHOTOTROPIC HYPOCOTYL 3); protein binding / signal transducer; Involved in blue light [...] (746 aa)
   •• • 0.981
LOV1
LOV1; ATP binding; Encodes LOV1, a disease susceptibility gene that, paradoxically, is a member [...] (727 aa)
      • 0.962
PKS2
PKS2 (PHYTOCHROME KINASE SUBSTRATE 2); Encodes phytochrome kinase substrate 2. PKS proteins are [...] (442 aa)
   •• • 0.951
PKS1
PKS1 (PHYTOCHROME KINASE SUBSTRATE 1); protein binding; Encodes a basic soluble protein which c [...] (439 aa)
    • • 0.950
CHUP1
CHUP1 (CHLOROPLAST UNUSUAL POSITIONING 1); actin binding protein required for normal chloroplas [...] (1004 aa)
   •  • 0.942
CRY1
CRY1 (CRYPTOCHROME 1); ATP binding / blue light photoreceptor/ protein homodimerization/ protei [...] (681 aa)
   •  • 0.935
CRY2
CRY2 (CRYPTOCHROME 2); blue light photoreceptor/ protein homodimerization; Blue light receptor [...] (612 aa)
      • 0.927
RCN1
RCN1 (ROOTS CURL IN NPA); protein phosphatase type 2A regulator; One of three genes encoding ph [...] (588 aa)
    • • 0.887
COP1
COP1 (CONSTITUTIVE PHOTOMORPHOGENIC 1); protein binding / ubiquitin-protein ligase; Represses p [...] (675 aa)
    • • 0.882
GRF6
GRF6 (G-box regulating factor 6); protein binding / protein phosphorylated amino acid binding; [...] (248 aa)
    • • 0.882

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
PRK13557 540 PRK13557, PRK13557, histidine kinase; Provisional 2e-21
PRK13559 361 PRK13559, PRK13559, hypothetical protein; Provisio 1e-20
PRK13558 665 PRK13558, PRK13558, bacterio-opsin activator; Prov 4e-17
pfam13426101 pfam13426, PAS_9, PAS domain 2e-15
TIGR02938 494 TIGR02938, nifL_nitrog, nitrogen fixation negative 2e-06
smart0008643 smart00086, PAC, Motif C-terminal to PAS motifs (l 6e-06
>gnl|CDD|237425 PRK13557, PRK13557, histidine kinase; Provisional Back     alignment and domain information 
 Score = 89.3 bits (222), Expect = 2e-21
 Identities = 46/122 (37%), Positives = 69/122 (56%), Gaps = 21/122 (17%)

Query: 1   MSDPTGKELIG--CCLLCSRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFW 58
           M+    +E+IG  C     RFLQGPETD+  V ++RDA+   +     +LNY+KDG+ FW
Sbjct: 65  MTGYAAEEIIGNNC-----RFLQGPETDRATVAEVRDAIAERREIATEILNYRKDGSSFW 119

Query: 59  NLLTVTPIKDDSGKTIKFIGMQVEVSKYTEGVNDKALRPNGLSKSLIRYDARQKEKALGS 118
           N L V+P+ +D+G  + F G Q++VS+  +   + ALR              QK +ALG 
Sbjct: 120 NALFVSPVYNDAGDLVYFFGSQLDVSRRRDA--EDALR------------QAQKMEALGQ 165

Query: 119 IT 120
           +T
Sbjct: 166 LT 167

Length = 540
>gnl|CDD|237427 PRK13559, PRK13559, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|237426 PRK13558, PRK13558, bacterio-opsin activator; Provisional Back     alignment and domain information
>gnl|CDD|222120 pfam13426, PAS_9, PAS domain Back     alignment and domain information
>gnl|CDD|131984 TIGR02938, nifL_nitrog, nitrogen fixation negative regulator NifL Back     alignment and domain information
>gnl|CDD|197509 smart00086, PAC, Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 162
PF13426104 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_ 99.5
PRK13559 361 hypothetical protein; Provisional 99.23
PF08448110 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold 99.19
PRK13557 540 histidine kinase; Provisional 99.16
PRK13558 665 bacterio-opsin activator; Provisional 99.09
PRK10060 663 RNase II stability modulator; Provisional 99.08
PRK11091 779 aerobic respiration control sensor protein ArcB; P 98.97
PRK13560 807 hypothetical protein; Provisional 98.96
PF0844791 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold 98.89
PRK09776 1092 putative diguanylate cyclase; Provisional 98.89
PF00989113 PAS: PAS fold; InterPro: IPR013767 PAS domains are 98.86
TIGR02938 494 nifL_nitrog nitrogen fixation negative regulator N 98.85
PRK13560 807 hypothetical protein; Provisional 98.74
KOG0501 971 consensus K+-channel KCNQ [Inorganic ion transport 98.71
PRK11359 799 cyclic-di-GMP phosphodiesterase; Provisional 98.66
PRK09776 1092 putative diguanylate cyclase; Provisional 98.65
PF14598111 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W 98.52
TIGR00229124 sensory_box PAS domain S-box. The PAS domain was p 98.44
TIGR02040442 PpsR-CrtJ transcriptional regulator PpsR. This mod 98.4
cd00130103 PAS PAS domain; PAS motifs appear in archaea, euba 98.35
TIGR02040 442 PpsR-CrtJ transcriptional regulator PpsR. This mod 98.03
PRK11359 799 cyclic-di-GMP phosphodiesterase; Provisional 98.03
PRK11360 607 sensory histidine kinase AtoS; Provisional 98.0
PRK11073 348 glnL nitrogen regulation protein NR(II); Provision 97.79
smart0008643 PAC Motif C-terminal to PAS motifs (likely to cont 97.64
PF13596106 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D. 97.52
COG5002 459 VicK Signal transduction histidine kinase [Signal 97.51
TIGR02966 333 phoR_proteo phosphate regulon sensor kinase PhoR. 97.26
KOG1229 775 consensus 3'5'-cyclic nucleotide phosphodiesterase 96.85
TIGR02938 494 nifL_nitrog nitrogen fixation negative regulator N 96.65
KOG3558 768 consensus Hypoxia-inducible factor 1/Neuronal PAS 96.62
PF12860115 PAS_7: PAS fold 96.5
COG2461409 Uncharacterized conserved protein [Function unknow 95.44
COG5000 712 NtrY Signal transduction histidine kinase involved 95.1
COG2202232 AtoS FOG: PAS/PAC domain [Signal transduction mech 94.71
KOG3560 712 consensus Aryl-hydrocarbon receptor [Transcription 94.46
PF07310137 PAS_5: PAS domain; InterPro: IPR009922 This family 93.96
PRK11086 542 sensory histidine kinase DcuS; Provisional 92.74
PF08348118 PAS_6: YheO-like PAS domain; InterPro: IPR013559 T 92.14
PRK11006 430 phoR phosphate regulon sensor protein; Provisional 91.96
COG3829 560 RocR Transcriptional regulator containing PAS, AAA 91.68
PF08670148 MEKHLA: MEKHLA domain; InterPro: IPR013978 The MEK 91.54
PRK10820 520 DNA-binding transcriptional regulator TyrR; Provis 89.1
>PF13426 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_B 3P7N_B 1LL8_A 3MJQ_A 3BWL_A 4EET_B 4EEP_A Back     alignment and domain information 
Probab=99.50  E-value=1.3e-13  Score=85.24  Aligned_cols=82  Identities=27%  Similarity=0.469  Sum_probs=74.4

Q ss_pred             CCCCCcccccCCCCCCcccccCCCCCHHHHHHHHHHHHcCCceEEEEEEEecCCceEEEEEEeeeeeCCCCCeEEEEEEe
Q 043549            1 MSDPTGKELIGCCLLCSRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWNLLTVTPIKDDSGKTIKFIGMQ   80 (162)
Q Consensus         1 l~G~~~~e~~g~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~dG~~~~~~~~~~~i~d~~g~~~~~v~~~   80 (162)
                      ++||++++++|++   +..+.++.........+.+.+..+..+..+....+++|+.+|+.+++.|+.+++|++.++++++
T Consensus        23 ~~g~~~~~~~g~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~g~~~~~~~~~~~i~~~~g~~~~~i~~~   99 (104)
T PF13426_consen   23 LFGYSREELIGKS---ISDFFPEEDRPEFEEQIERALEEGGSWSGEVRLRRKDGETFWVEVSASPIRDEDGEITGIIGIF   99 (104)
T ss_dssp             HHTS-HHHHTTSB---GGGGCSTTSCHHHHHHHHHHHHHTSSEEEEEEEEETTSEEEEEEEEEEEEEETTSSEEEEEEEE
T ss_pred             HHCcCHHHHcCCC---cccccCcccchhhHHHHHHHHhcCCceeEEEEEEcCCCCEEEEEEEEEEEECCCCCEEEEEEEE
Confidence            4799999999999   8778877777778888999999999999999999999999999999999999999999999999


Q ss_pred             eeccc
Q 043549           81 VEVSK   85 (162)
Q Consensus        81 ~DITe   85 (162)
                      +||||
T Consensus       100 ~DiTe  104 (104)
T PF13426_consen  100 RDITE  104 (104)
T ss_dssp             EEEHH
T ss_pred             EECCC
Confidence            99996

...
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>PF08448 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PRK10060 RNase II stability modulator; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>PF08447 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>PRK09776 putative diguanylate cyclase; Provisional Back     alignment and domain information
>PF00989 PAS: PAS fold; InterPro: IPR013767 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain [] Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11359 cyclic-di-GMP phosphodiesterase; Provisional Back     alignment and domain information
>PRK09776 putative diguanylate cyclase; Provisional Back     alignment and domain information
>PF14598 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W_A 3F1P_A 3H82_A 3F1N_A 4F3L_B 4DJ3_A 2KDK_A Back     alignment and domain information
>TIGR00229 sensory_box PAS domain S-box Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR Back     alignment and domain information
>cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR Back     alignment and domain information
>PRK11359 cyclic-di-GMP phosphodiesterase; Provisional Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>smart00086 PAC Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain) Back     alignment and domain information
>PF13596 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR Back     alignment and domain information
>KOG1229 consensus 3'5'-cyclic nucleotide phosphodiesterases [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL Back     alignment and domain information
>KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] Back     alignment and domain information
>PF12860 PAS_7: PAS fold Back     alignment and domain information
>COG2461 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>COG2202 AtoS FOG: PAS/PAC domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] Back     alignment and domain information
>PF07310 PAS_5: PAS domain; InterPro: IPR009922 This family contains a number of hypothetical bacterial proteins of unknown function approximately 200 residues long Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>PF08348 PAS_6: YheO-like PAS domain; InterPro: IPR013559 This domain is found in various hypothetical bacterial proteins that are similar to the Escherichia coli protein YheO (P64624 from SWISSPROT) Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF08670 MEKHLA: MEKHLA domain; InterPro: IPR013978 The MEKHLA domain shares similarity with the PAS domain and is found in the 3' end of plant HD-ZIP III homeobox genes, and bacterial proteins Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
2z6d_A130 Crystal Structure Of Lov1 Domain Of Phototropin2 Fr 3e-38
2z6c_A129 Crystal Structure Of Lov1 Domain Of Phototropin1 Fr 1e-27
1n9l_A109 Crystal Structure Of The Phot-lov1 Domain From Chla 2e-20
4ees_A115 Crystal Structure Of Ilov Length = 115 2e-15
4eer_A115 Crystal Structure Of Lov2 Domain Of Arabidopsis Tha 4e-15
4eep_A115 Crystal Structure Of Lov2 Domain Of Arabidopsis Tha 8e-15
2wkq_A 332 Structure Of A Photoactivatable Rac1 Containing The 9e-15
2v1a_A144 N- And C-Terminal Helices Of Oat Lov2 (404-546) Are 1e-14
2v0u_A146 N- And C-terminal Helices Of Oat Lov2 (404-546) Are 1e-14
3ulf_A170 The Light State Structure Of The Blue-light Photore 1e-14
3ue6_A166 The Dark Structure Of The Blue-light Photoreceptor 1e-14
2wkr_A 332 Structure Of A Photoactivatable Rac1 Containing The 1e-14
4eeu_A118 Crystal Structure Of Philov2.1 Length = 118 2e-14
2wkp_A 332 Structure Of A Photoactivatable Rac1 Containing Lov 2e-14
3p7n_A258 Crystal Structure Of Light Activated Transcription 7e-12
3sw1_A162 Structure Of A Full-Length Bacterial Lov Protein Le 2e-11
1g28_A104 Structure Of A Flavin-Binding Domain, Lov2, From Th 1e-10
2pr5_A132 Structural Basis For Light-dependent Signaling In T 2e-10
3t50_A128 X-Ray Structure Of The Lov Domain From The Lov-Hk S 8e-09
3rh8_B148 Crystal Structure Of The Light-State Dimer Of Funga 7e-06
3hji_A154 1.8 Angstrom Crystal Structure Of The I74v:i85v Var 2e-05
3is2_B154 2.3 Angstrom Crystal Structure Of A Cys71 Sulfenic 2e-05
3hjk_A154 2.0 Angstrom Structure Of The Ile74val Variant Of V 2e-05
2pd7_A149 2.0 Angstrom Crystal Structure Of The Fungal Blue-L 2e-05
3d72_A149 1.65 Angstrom Crystal Structure Of The Cys71val Var 2e-05
3is2_A154 2.3 Angstrom Crystal Structure Of A Cys71 Sulfenic 3e-05
2pd8_A149 1.8 Angstrom Crystal Structure Of The Cys71ser Muta 3e-05
4hj6_A178 Crystal Structure Of Rhodobacter Sphaeroides Lov Pr 4e-04
4hj4_A177 Crystal Structure Of Rhodobacter Sphaeroides Lov Pr 5e-04
4hj3_A176 Crystal Structure Of Rhodobacter Sphaeroides Lov Pr 5e-04
4hia_A176 Crystal Structure Of Rhodobacter Sphaeroides Lov Pr 5e-04
3ewk_A227 Structure Of The Redox Sensor Domain Of Methylococc 7e-04
>pdb|2Z6D|A Chain A, Crystal Structure Of Lov1 Domain Of Phototropin2 From Arabidopsis Thaliana Length = 130 Back     alignment and structure 
Iteration: 1

 Score =  154 bits (388), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 75/95 (78%), Positives = 81/95 (85%), Gaps = 7/95 (7%)
Query: 1   MSDPTGKELIG--CCLLCSRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFW 58
           M+  + KE++G  C     RFLQGP+TDKNEV KIRD V+NGKSYCGRLLNYKKDGTPFW
Sbjct: 41  MTGYSSKEIVGRNC-----RFLQGPDTDKNEVAKIRDCVKNGKSYCGRLLNYKKDGTPFW 95
Query: 59  NLLTVTPIKDDSGKTIKFIGMQVEVSKYTEGVNDK 93
           NLLTVTPIKDD G TIKFIGMQVEVSKYTEGVNDK
Sbjct: 96  NLLTVTPIKDDQGNTIKFIGMQVEVSKYTEGVNDK 130
>pdb|2Z6C|A Chain A, Crystal Structure Of Lov1 Domain Of Phototropin1 From Arabidopsis Thaliana Length = 129 Back     alignment and structure
>pdb|1N9L|A Chain A, Crystal Structure Of The Phot-lov1 Domain From Chlamydomonas Reinhardtii In The Dark State. Length = 109 Back     alignment and structure
>pdb|4EES|A Chain A, Crystal Structure Of Ilov Length = 115 Back     alignment and structure
>pdb|4EER|A Chain A, Crystal Structure Of Lov2 Domain Of Arabidopsis Thaliana Phototropin 2 C426a Mutant Length = 115 Back     alignment and structure
>pdb|4EEP|A Chain A, Crystal Structure Of Lov2 Domain Of Arabidopsis Thaliana Phototropin 2 Length = 115 Back     alignment and structure
>pdb|2WKQ|A Chain A, Structure Of A Photoactivatable Rac1 Containing The Lov2 C450a Mutant Length = 332 Back     alignment and structure
>pdb|2V1A|A Chain A, N- And C-Terminal Helices Of Oat Lov2 (404-546) Are Involved In Light-Induced Signal Transduction (Room Temperature (293k) Dark Structure Of Lov2 (404-546)) Length = 144 Back     alignment and structure
>pdb|2V0U|A Chain A, N- And C-terminal Helices Of Oat Lov2 (404-546) Are Involved In Light-induced Signal Transduction (cryo Dark Structure Of Lov2 (404-546)) Length = 146 Back     alignment and structure
>pdb|3ULF|A Chain A, The Light State Structure Of The Blue-light Photoreceptor Aureochrome1 Lov Length = 170 Back     alignment and structure
>pdb|3UE6|A Chain A, The Dark Structure Of The Blue-light Photoreceptor Aureochrome1 Lov Length = 166 Back     alignment and structure
>pdb|2WKR|A Chain A, Structure Of A Photoactivatable Rac1 Containing The Lov2 C450m Mutant Length = 332 Back     alignment and structure
>pdb|4EEU|A Chain A, Crystal Structure Of Philov2.1 Length = 118 Back     alignment and structure
>pdb|2WKP|A Chain A, Structure Of A Photoactivatable Rac1 Containing Lov2 Wildtype Length = 332 Back     alignment and structure
>pdb|3P7N|A Chain A, Crystal Structure Of Light Activated Transcription Factor El222 From Erythrobacter Litoralis Length = 258 Back     alignment and structure
>pdb|3SW1|A Chain A, Structure Of A Full-Length Bacterial Lov Protein Length = 162 Back     alignment and structure
>pdb|1G28|A Chain A, Structure Of A Flavin-Binding Domain, Lov2, From The Chimeric PhytochromePHOTOTROPIN PHOTORECEPTOR PHY3 Length = 104 Back     alignment and structure
>pdb|2PR5|A Chain A, Structural Basis For Light-dependent Signaling In The Dimeric Lov Photosensor Ytva (dark Structure) Length = 132 Back     alignment and structure
>pdb|3T50|A Chain A, X-Ray Structure Of The Lov Domain From The Lov-Hk Sensory Protein From Brucella Abortus (Dark State). Length = 128 Back     alignment and structure
>pdb|3RH8|B Chain B, Crystal Structure Of The Light-State Dimer Of Fungal Blue-Light Photoreceptor Vivid Length = 148 Back     alignment and structure
>pdb|3HJI|A Chain A, 1.8 Angstrom Crystal Structure Of The I74v:i85v Variant Of Vivid (Vvd). Length = 154 Back     alignment and structure
>pdb|3IS2|B Chain B, 2.3 Angstrom Crystal Structure Of A Cys71 Sulfenic Acid Form Of Vivid Length = 154 Back     alignment and structure
>pdb|3HJK|A Chain A, 2.0 Angstrom Structure Of The Ile74val Variant Of Vivid (Vvd). Length = 154 Back     alignment and structure
>pdb|2PD7|A Chain A, 2.0 Angstrom Crystal Structure Of The Fungal Blue-Light Photoreceptor Vivid Length = 149 Back     alignment and structure
>pdb|3D72|A Chain A, 1.65 Angstrom Crystal Structure Of The Cys71val Variant In The Fungal Photoreceptor Vvd Length = 149 Back     alignment and structure
>pdb|3IS2|A Chain A, 2.3 Angstrom Crystal Structure Of A Cys71 Sulfenic Acid Form Of Vivid Length = 154 Back     alignment and structure
>pdb|2PD8|A Chain A, 1.8 Angstrom Crystal Structure Of The Cys71ser Mutant Of Vivid Length = 149 Back     alignment and structure
>pdb|4HJ6|A Chain A, Crystal Structure Of Rhodobacter Sphaeroides Lov Protein Length = 178 Back     alignment and structure
>pdb|4HJ4|A Chain A, Crystal Structure Of Rhodobacter Sphaeroides Lov Protein Length = 177 Back     alignment and structure
>pdb|4HJ3|A Chain A, Crystal Structure Of Rhodobacter Sphaeroides Lov Protein Length = 176 Back     alignment and structure
>pdb|4HIA|A Chain A, Crystal Structure Of Rhodobacter Sphaeroides Lov Protein Length = 176 Back     alignment and structure
>pdb|3EWK|A Chain A, Structure Of The Redox Sensor Domain Of Methylococcus Capsulatus (Bath) Mmos Length = 227 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
2z6d_A130 Phototropin-2; PAS-fold, LOV-fold, alternative spl 4e-38
1n9l_A109 PHOT-LOV1, putative blue light receptor; phototrop 7e-37
4eet_B115 Phototropin-2; LOV, blue light photoreceptor, sign 6e-35
1byw_A110 Protein (human ERG potassium channel); PAS domain, 8e-35
2l0w_A138 Potassium voltage-gated channel, subfamily H (EAG 3e-34
2v0u_A146 NPH1-1, LOV2; kinase, transferase, ATP-binding, se 4e-34
3p7n_A258 Sensor histidine kinase; LOV domain, light-activat 4e-34
3ue6_A166 Aureochrome1; PAS/LOV domain, FMN-binding blue-lig 9e-34
3sw1_A162 Sensory box protein; light-oxygen-voltage, LOV, PA 2e-33
3t50_A128 Blue-light-activated histidine kinase; PAS superfa 4e-33
2pr5_A132 Blue-light photoreceptor; light-oxygen-voltage, LO 1e-30
3d72_A149 Vivid PAS protein VVD; circadian, photoreceptor, b 4e-29
2wkq_A 332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 2e-22
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinas 2e-14
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinas 4e-12
3lyx_A124 Sensory BOX/ggdef domain protein; structural genom 5e-12
2gj3_A120 Nitrogen fixation regulatory protein; PAS domain, 6e-10
3mqq_A120 Transcriptional regulator, LUXR family; PAS domain 2e-06
3b33_A115 Sensor protein; structural genomics, PAS domain, n 3e-05
>2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Length = 130 Back     alignment and structure
 Score =  125 bits (317), Expect = 4e-38
 Identities = 76/93 (81%), Positives = 80/93 (86%), Gaps = 8/93 (8%)

Query: 5   TG---KELIGC-CLLCSRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWNL 60
           TG   KE++G  C    RFLQGP+TDKNEV KIRD V+NGKSYCGRLLNYKKDGTPFWNL
Sbjct: 42  TGYSSKEIVGRNC----RFLQGPDTDKNEVAKIRDCVKNGKSYCGRLLNYKKDGTPFWNL 97

Query: 61  LTVTPIKDDSGKTIKFIGMQVEVSKYTEGVNDK 93
           LTVTPIKDD G TIKFIGMQVEVSKYTEGVNDK
Sbjct: 98  LTVTPIKDDQGNTIKFIGMQVEVSKYTEGVNDK 130
>1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Length = 109 Back     alignment and structure
>4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Length = 115 Back     alignment and structure
>1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Length = 110 Back     alignment and structure
>2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Length = 138 Back     alignment and structure
>2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Length = 146 Back     alignment and structure
>3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Length = 258 Back     alignment and structure
>3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Length = 166 Back     alignment and structure
>3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} Length = 162 Back     alignment and structure
>3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Length = 128 Back     alignment and structure
>2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Length = 132 Back     alignment and structure
>3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Length = 149 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Length = 332 Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Length = 227 Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Length = 227 Back     alignment and structure
>3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} Length = 124 Back     alignment and structure
>2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} Length = 120 Back     alignment and structure
>3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A Length = 120 Back     alignment and structure
>3b33_A Sensor protein; structural genomics, PAS domain, nitrogen regulation protein APC91440.4, PSI-2; HET: MSE; 1.83A {Vibrio parahaemolyticus rimd 2210633} Length = 115 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
4hia_A176 LOV protein; PAS, HTH, signaling protein; HET: FMN 99.68
1n9l_A109 PHOT-LOV1, putative blue light receptor; phototrop 99.65
2gj3_A120 Nitrogen fixation regulatory protein; PAS domain, 99.62
2pr5_A132 Blue-light photoreceptor; light-oxygen-voltage, LO 99.58
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinas 99.57
3f1p_A117 Endothelial PAS domain-containing protein 1; PAS d 99.57
3f1p_B121 ARYL hydrocarbon receptor nuclear translocator; PA 99.57
3mr0_A142 Sensory box histidine kinase/response regulator; P 99.54
3p7n_A258 Sensor histidine kinase; LOV domain, light-activat 99.53
3t50_A128 Blue-light-activated histidine kinase; PAS superfa 99.53
3h9w_A115 Diguanylate cyclase with PAS/PAC sensor; alpha-bet 99.52
3ue6_A166 Aureochrome1; PAS/LOV domain, FMN-binding blue-lig 99.49
4eet_B115 Phototropin-2; LOV, blue light photoreceptor, sign 99.48
2wkq_A 332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.44
3mqq_A120 Transcriptional regulator, LUXR family; PAS domain 99.42
3nja_A125 Probable ggdef family protein; structural genomics 99.41
3sw1_A162 Sensory box protein; light-oxygen-voltage, LOV, PA 99.38
2vv6_A119 FIXL, sensor protein FIXL; signaling protein, tran 99.37
2z6d_A130 Phototropin-2; PAS-fold, LOV-fold, alternative spl 99.36
3lyx_A124 Sensory BOX/ggdef domain protein; structural genom 99.32
2v0u_A146 NPH1-1, LOV2; kinase, transferase, ATP-binding, se 99.32
2kdk_A121 ARYL hydrocarbon receptor nuclear translocator-LI 99.27
4eho_A635 Bacteriophytochrome, PAS/PAC sensor; photoreceptor 99.27
4f3l_A361 Mclock, circadian locomoter output cycles protein 99.25
1byw_A110 Protein (human ERG potassium channel); PAS domain, 99.24
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinas 99.23
3icy_A118 Sensor protein; sensory box histidine kinase/respo 99.22
3k3c_A158 Protein RV1364C/MT1410; sensor, PAS, signal transd 99.17
4f3l_B387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 99.15
3d72_A149 Vivid PAS protein VVD; circadian, photoreceptor, b 99.13
3luq_A114 Sensor protein; PAS, histidine, kinase, PSI, MCSG, 99.13
3kx0_X185 Uncharacterized protein RV1364C/MT1410; PAS domain 99.09
2l0w_A138 Potassium voltage-gated channel, subfamily H (EAG 99.05
3mxq_A152 Sensor protein; PSI2, MCSG, structural genomics, p 99.0
2r78_A117 Sensor protein; sensory box sensor histidine kinas 98.99
1d06_A130 Nitrogen fixation regulatory protein FIXL; oxygen 98.99
3mjq_A126 Uncharacterized protein; NESG, structural genomics 98.97
1v9y_A167 Heme PAS sensor protein; signaling protein; HET: H 98.86
3eeh_A125 Putative light and redox sensing histidine kinase; 98.8
3vol_A233 Aerotaxis transducer AER2; heme, oxygen sensor pro 98.73
3olo_A118 Two-component sensor histidine kinase; structural 98.7
3rty_A339 Period circadian protein; PAS domain, signalling, 98.58
3mfx_A129 Sensory BOX/ggdef family protein; alpha-beta prote 98.57
2qkp_A151 Uncharacterized protein; structural genomics, unkn 98.55
4dj3_A317 Period circadian protein homolog 3; PAS domain, ci 98.52
3bwl_A126 Sensor protein; structural genomics, APC87707.1, P 98.44
3gdi_A309 Period circadian protein homolog 2; tandem PAS dom 98.41
3a0r_A 349 Sensor protein; four helix bundle, PAS fold, kinas 98.4
2vlg_A111 Sporulation kinase A; histidine kinase, two-compon 98.38
1ll8_A114 PAS kinase; PAS domain, ligand binding, ligand scr 98.37
4dj2_A320 Period circadian protein homolog 1; PAS domains, c 98.33
3fg8_A118 Uncharacterized protein RHA05790; PAS domain, stru 98.33
3cax_A369 Uncharacterized protein PF0695; structural genomic 98.32
4hi4_A121 Aerotaxis transducer AER2; PAS domain, diatomic GA 98.3
3fc7_A125 HTR-like protein, sensor protein; APC87712.1, HTR- 98.11
3b33_A115 Sensor protein; structural genomics, PAS domain, n 98.1
3a0s_A96 Sensor protein; PAS-fold, kinase, phosphoprotein, 97.76
1mzu_A129 PPR; photoactive yellow protein, PAS, PYP, signali 97.18
1nwz_A125 PYP, photoactive yellow protein; PAS, LOV, GAF, do 97.13
2w0n_A118 Sensor protein DCUS; signal transduction, two-comp 97.11
2jhe_A190 Transcription regulator TYRR; aromatic hydrocarbon 96.91
1oj5_A132 Steroid receptor coactivator 1A; transcriptional c 96.68
2ykf_A305 Pdtas, probable sensor histidine kinase pdtas; tra 94.83
3rty_A 339 Period circadian protein; PAS domain, signalling, 95.65
4f3l_A361 Mclock, circadian locomoter output cycles protein 89.61
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 84.83
>4hia_A LOV protein; PAS, HTH, signaling protein; HET: FMN; 1.95A {Rhodobacter sphaeroides} PDB: 4hnb_A* 4hj4_A* 4hj6_A* 4hj3_A* Back     alignment and structure
Probab=99.68  E-value=2.9e-16  Score=104.94  Aligned_cols=103  Identities=26%  Similarity=0.376  Sum_probs=86.9

Q ss_pred             CCCCCcccccCCCCCCcccccCCCCCHHHHHHHHHHHHcCCceEEEEEEEecCCceEEEEEEeeeeeCCCCCeEEEEEEe
Q 043549            1 MSDPTGKELIGCCLLCSRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWNLLTVTPIKDDSGKTIKFIGMQ   80 (162)
Q Consensus         1 l~G~~~~e~~g~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~dG~~~~~~~~~~~i~d~~g~~~~~v~~~   80 (162)
                      ++||++++++|++   +..+.++.........+.+.+..+..+..++...+++|+.+|+.+.+.|+.+.+|.+.+++++.
T Consensus        42 ~~G~~~~e~~g~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~dG~~~~~~~~~~pi~~~~g~~~~~~~~~  118 (176)
T 4hia_A           42 MTGYTEGQILGFN---CRFLQRGDENAQARADIRDALKLGRELQVVLRNYRANDEPFDNLLFLHPVGGRPDAPDYFLGSQ  118 (176)
T ss_dssp             HHTCCHHHHTTSC---GGGGCCTTCCHHHHHHHHHHHHHTCCEEEEEEEECTTCCEEEEEEEEEEESSBTTBCSEEEEEE
T ss_pred             HHCcCHHHHcCCC---cceeeCCCCCHHHHHHHHHHHHcCCceEEEEEEEcCCCCEEEEEEEEEEeeCCCCCeEEEEEEE
Confidence            4799999999999   8878777777777788888888899999999999999999999999999999999999999999


Q ss_pred             eeccccchhhhhhhcc----cCCchhhhhh
Q 043549           81 VEVSKYTEGVNDKALR----PNGLSKSLIR  106 (162)
Q Consensus        81 ~DITe~k~~e~e~~~~----~~~l~~~~~~  106 (162)
                      +|||++|++|++..+.    .|+|||+...
T Consensus       119 ~DITe~k~~e~~~~~a~~d~LtgL~NR~~~  148 (176)
T 4hia_A          119 FELGRSGNSEEAAAAGHAGALTGELARIGT  148 (176)
T ss_dssp             EEESSSGGGHHHHHHHHHHHHHHHHHHTTS
T ss_pred             EECcHhhHHHHHHHHhhhhHHhhhhhhhhh
Confidence            9999999977662111    1566776543
>1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Back     alignment and structure
>2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} Back     alignment and structure
>2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Back     alignment and structure
>3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.7 PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A 4h6j_A Back     alignment and structure
>3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.0 PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 4h6j_B 2b02_A* 2k7s_A 2a24_B Back     alignment and structure
>3mr0_A Sensory box histidine kinase/response regulator; PAS fold, structural genomics, PSI-2; HET: PG5; 1.49A {Burkholderia thailandensis} Back     alignment and structure
>3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Back     alignment and structure
>3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Back     alignment and structure
>3h9w_A Diguanylate cyclase with PAS/PAC sensor; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.90A {Marinobacter aquaeolei} Back     alignment and structure
>3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Back     alignment and structure
>4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A Back     alignment and structure
>3nja_A Probable ggdef family protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.37A {Chromobacterium violaceum} Back     alignment and structure
>3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} Back     alignment and structure
>2vv6_A FIXL, sensor protein FIXL; signaling protein, transferase, phosphoprotein, nitrogen FIX PER-ARNT-SIM, metal-binding, PAS, iron, heme; HET: HEM; 1.5A {Bradyrhizobium japonicum} PDB: 1xj6_A* 1xj4_A* 2vv7_A* 2vv8_A* 1lsw_A* 1dp8_A* 1dp9_A* 1drm_A* 1lsv_A* 1dp6_A* 1lsx_A* 1lt0_A* 1y28_A* 2cmn_A* 1xj3_A* 1xj2_A* 2owh_A* 2owj_A* Back     alignment and structure
>2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Back     alignment and structure
>3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Back     alignment and structure
>2kdk_A ARYL hydrocarbon receptor nuclear translocator-LI 2; circadian clock, PAS domain, transcription, activator, biolo rhythms, DNA-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Back     alignment and structure
>3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} Back     alignment and structure
>3k3c_A Protein RV1364C/MT1410; sensor, PAS, signal transduction, fatty-acid binding, sigma regulator, signaling protein; HET: PLM; 1.62A {Mycobacterium tuberculosis} PDB: 3k3d_A Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Back     alignment and structure
>3luq_A Sensor protein; PAS, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: PGE; 2.49A {Geobacter sulfurreducens} Back     alignment and structure
>3kx0_X Uncharacterized protein RV1364C/MT1410; PAS domain, sensory domain, mycobacteium tuberculos molecule binding domain; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Back     alignment and structure
>3mxq_A Sensor protein; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.78A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>2r78_A Sensor protein; sensory box sensor histidine kinase/response regulator, structural genomics, PSI, MCSG; 1.60A {Geobacter sulfurreducens pca} Back     alignment and structure
>1d06_A Nitrogen fixation regulatory protein FIXL; oxygen sensor, histidine kinase, PAS, high-resolution, two-C system, signaling protein; HET: HEM; 1.40A {Sinorhizobium meliloti} SCOP: d.110.3.2 PDB: 1ew0_A* Back     alignment and structure
>3mjq_A Uncharacterized protein; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium; 2.60A {Desulfitobacterium hafniense} Back     alignment and structure
>1v9y_A Heme PAS sensor protein; signaling protein; HET: HEM; 1.32A {Escherichia coli} SCOP: d.110.3.2 PDB: 1v9z_A* 1vb6_A* 1s67_L* 1s66_L* Back     alignment and structure
>3eeh_A Putative light and redox sensing histidine kinase; structural genomic MCSG, protein structure initiative, midwest center for STRU genomics; HET: PG5; 1.95A {Haloarcula marismortui} Back     alignment and structure
>3vol_A Aerotaxis transducer AER2; heme, oxygen sensor protein, PAS, HAMP, cyanoMet, CN-bound, protein; HET: HEM; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3olo_A Two-component sensor histidine kinase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, TRA; 2.09A {Nostoc SP} Back     alignment and structure
>3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A Back     alignment and structure
>3mfx_A Sensory BOX/ggdef family protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Shewanella oneidensis} Back     alignment and structure
>2qkp_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 1.75A {Streptococcus mutans} Back     alignment and structure
>4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} Back     alignment and structure
>3bwl_A Sensor protein; structural genomics, APC87707.1, PAS domain, HTR-like protei protein structure initiative; HET: MSE I3A; 1.73A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Back     alignment and structure
>2vlg_A Sporulation kinase A; histidine kinase, two-component regulatory system, two-component signal transduction, transferase, phosphorylation, SCOD; 1.7A {Bacillus subtilis} Back     alignment and structure
>1ll8_A PAS kinase; PAS domain, ligand binding, ligand screening, kinase regulation, transferase; NMR {Homo sapiens} SCOP: d.110.3.5 Back     alignment and structure
>4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} Back     alignment and structure
>3fg8_A Uncharacterized protein RHA05790; PAS domain, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; HET: 3PB; 1.80A {Rhodococcus SP} Back     alignment and structure
>3cax_A Uncharacterized protein PF0695; structural genomics, unknown function, PSI-2, protein struct initiative; 2.43A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>4hi4_A Aerotaxis transducer AER2; PAS domain, diatomic GAS sensor, signaling protein; HET: HEM GOL; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3fc7_A HTR-like protein, sensor protein; APC87712.1, HTR-like protein,haloarcula marismortui ATCC 430 structural genomics, PSI-2; 2.65A {Haloarcula marismortui} Back     alignment and structure
>3b33_A Sensor protein; structural genomics, PAS domain, nitrogen regulation protein APC91440.4, PSI-2; HET: MSE; 1.83A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3a0s_A Sensor protein; PAS-fold, kinase, phosphoprotein, transferase, two-component regulatory system; HET: PG4 PGE; 1.47A {Thermotoga maritima} PDB: 3a0v_A* Back     alignment and structure
>1mzu_A PPR; photoactive yellow protein, PAS, PYP, signaling protein; HET: HC4; 2.00A {Rhodospirillum centenum} SCOP: d.110.3.1 Back     alignment and structure
>1nwz_A PYP, photoactive yellow protein; PAS, LOV, GAF, domains fold, signaling protein; HET: HC4; 0.82A {Halorhodospira halophila} SCOP: d.110.3.1 PDB: 1kou_A* 1ot9_A* 1otb_A* 1s4r_A* 1s4s_A* 1ts0_A* 1ts6_A* 1ts7_A* 1ts8_A* 1uwn_X* 1uwp_X* 2d01_A* 2phy_A* 2pyp_A* 2pyr_A* 2qj5_A* 2qj7_A* 2qws_A* 2zoh_A* 2zoi_A* ... Back     alignment and structure
>2w0n_A Sensor protein DCUS; signal transduction, two-component regulatory system, PAS, kinase, membrane, transferase, solid state cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>1oj5_A Steroid receptor coactivator 1A; transcriptional coactivator, complex, LXXLL motif, transcriptional regulation; 2.2A {Mus musculus} SCOP: d.110.3.8 Back     alignment and structure
>2ykf_A Pdtas, probable sensor histidine kinase pdtas; transferase, two-component system, GAF domain, PAS domain; 2.00A {Mycobacterium tuberculosis} PDB: 2ykh_A Back     alignment and structure
>3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 162
d1n9la_109 d.110.3.6 (A:) Putative blue light receptor, phot- 3e-09
d1jnua_104 d.110.3.6 (A:) Photoreceptor phy3 flavin-binding d 4e-06
d1ew0a_130 d.110.3.2 (A:) Histidine kinase FixL heme domain { 0.003
>d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 109 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Profilin-like
superfamily: PYP-like sensor domain (PAS domain)
family: Flavin-binding PAS domain
domain: Putative blue light receptor, phot-lov1 domain
species: Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]

 Score = 49.9 bits (118), Expect = 3e-09
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 3/77 (3%)

Query: 8   ELIGCCLLCSRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWNLLTVTPIK 67
           E++G      RFLQG  TD  EV+KIRDA++ G++   RLLNY+KDGTPFWNLLTVTPIK
Sbjct: 35  EVLGHN---CRFLQGEGTDPKEVQKIRDAIKKGEACSVRLLNYRKDGTPFWNLLTVTPIK 91

Query: 68  DDSGKTIKFIGMQVEVS 84
              G+  KF+G+QV+V+
Sbjct: 92  TPDGRVSKFVGVQVDVT 108
>d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} Length = 104 Back     information, alignment and structure
>d1ew0a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti [TaxId: 382]} Length = 130 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
d1n9la_109 Putative blue light receptor, phot-lov1 domain {Gr 99.74
d1bywa_110 Erg potassium channel, N-terminal domain {Human (H 99.69
d1jnua_104 Photoreceptor phy3 flavin-binding domain, lov2 {Ma 99.61
d1p97a_114 Hypoxia-inducible factor Hif2a, C-terminal domain 99.57
d1xj3a1106 Histidine kinase FixL heme domain {Bradyrhizobium 99.16
d1ew0a_130 Histidine kinase FixL heme domain {Rhizobium melil 99.08
d1v9ya_113 Direct oxygen sensor protein, DOS {Escherichia col 98.8
d1oj5a_109 PAS domain of steroid receptor coactivator 1A, NCo 98.7
d1ll8a_114 N-terminal PAS domain of Pas kinase {Human (Homo s 98.64
d1nwza_125 Photoactive yellow protein, PYP {Ectothiorhodospir 98.38
d1mzua_110 PYP domain of sensor histidine kinase Ppr {Rhodosp 98.25
d2oola2114 Sensor protein PhyB2 {Rhodopseudomonas palustris [ 87.35
>d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Profilin-like
superfamily: PYP-like sensor domain (PAS domain)
family: Flavin-binding PAS domain
domain: Putative blue light receptor, phot-lov1 domain
species: Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]

Probab=99.74  E-value=8.5e-18  Score=103.52  Aligned_cols=82  Identities=56%  Similarity=0.948  Sum_probs=76.5

Q ss_pred             CCCCCcccccCCCCCCcccccCCCCCHHHHHHHHHHHHcCCceEEEEEEEecCCceEEEEEEeeeeeCCCCCeEEEEEEe
Q 043549            1 MSDPTGKELIGCCLLCSRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWNLLTVTPIKDDSGKTIKFIGMQ   80 (162)
Q Consensus         1 l~G~~~~e~~g~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~dG~~~~~~~~~~~i~d~~g~~~~~v~~~   80 (162)
                      ++||+++|++|++   +..+.+++..+.....+.+.+..++.+.+|++.+++||+.+|+.+++.|++|++|.+.++++++
T Consensus        28 ~~Gy~~~El~G~~---~~~l~~~~~~~~~~~~~~~~l~~~~~~~~e~~~~~kdG~~~w~~~~~~pi~d~~G~v~~~v~~~  104 (109)
T d1n9la_          28 MTGYGPDEVLGHN---CRFLQGEGTDPKEVQKIRDAIKKGEACSVRLLNYRKDGTPFWNLLTVTPIKTPDGRVSKFVGVQ  104 (109)
T ss_dssp             HHCCCHHHHTTSC---GGGGCCTTCCHHHHHHHHHHHHHTCCEEEEEEEECTTSCEEEEEEEEEEEECTTSCEEEEEEEE
T ss_pred             HHCcCHHHHcCCc---ceeeecccCCHHHhhhhhhHhhcCCceeeeEEEEecCCeEEEEEEEEEEEECCCCCEEEEEEEE
Confidence            4799999999999   8888888777788888999999999999999999999999999999999999999999999999


Q ss_pred             eeccc
Q 043549           81 VEVSK   85 (162)
Q Consensus        81 ~DITe   85 (162)
                      +|||.
T Consensus       105 ~DITa  109 (109)
T d1n9la_         105 VDVTS  109 (109)
T ss_dssp             EECCC
T ss_pred             EECCC
Confidence            99994
>d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xj3a1 d.110.3.2 (A:154-259) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1ew0a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ll8a_ d.110.3.5 (A:) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nwza_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]} Back     information, alignment and structure
>d1mzua_ d.110.3.1 (A:) PYP domain of sensor histidine kinase Ppr {Rhodospirillum centenum [TaxId: 34018]} Back     information, alignment and structure
>d2oola2 d.110.3.9 (A:26-139) Sensor protein PhyB2 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure