Citrus Sinensis ID: 043552


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MEDQKVFRFYSFPIIILINYLFFTGIKSEVYTVGGDEQWNTGANFDSWSQQYNYSIGDVLVFKYTEGQHNVYEVTQATYRSCVASSGVIGKYESGNDQVTLTEAKKYWFICNVAGHCLGGMRFSIDVKENPTLIQQQLQHQPHHQKFWNHLILL
ccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccHHHHHccccEEEccEEEEEEccccccEEEEcHHHHHHccccccccccccccccEEEcccccEEEEEcccccccccccEEEEEEEcccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEcccccccccccHHHHHccccEccccEEEEEccEccEcEEEEcHHHHHccccccccHHEccccccEEEEcccccEEEEEccccccccccEEEEEEccccccccccccccccccHHHHHHHcc
medqkvfrfysFPIIILINYLFFTGIKSevytvggdeqwntganfdswsqqyNYSIGDVLVFKYTEGQHNVYEVTQATYRSCVAssgvigkyesgndqvTLTEAKKYWFICNVaghclggmrfsidvkenptliqqqlqhqphhqKFWNHLILL
MEDQKVFRFYSFPIIILINYLFFTGIKSEVYTVGGDEQWNTGANFDSWSQQYNYSIGDVLVFKYTEGQHNVYEVTQATYRSCVASSGVIGKYESGNDQVTLTEAKKYWFICNVAGHCLGGMRFSIDVKENPTLIQQQlqhqphhqkFWNHLILL
MEDQKVFRFYSFPIIILINYLFFTGIKSEVYTVGGDEQWNTGANFDSWSQQYNYSIGDVLVFKYTEGQHNVYEVTQATYRSCVASSGVIGKYESGNDQVTLTEAKKYWFICNVAGHCLGGMRFSIDVKENPTLIqqqlqhqphhqKFWNHLILL
*****VFRFYSFPIIILINYLFFTGIKSEVYTVGGDEQWNTGANFDSWSQQYNYSIGDVLVFKYTEGQHNVYEVTQATYRSCVASSGVIGKYESGNDQVTLTEAKKYWFICNVAGHCLGGMRFSIDVKENPTLIQQQLQHQPHHQKFWNHLIL*
***********FPIIILINYLFFTGIKSEVYTVGGDEQWNTGANFDSWSQQYNYSIGDVLVFKYTEGQHNVYEVTQATYRSCVASSGVIGKYESGNDQVTLTEAKKYWFICNVAGHCLGGMRFSI*************************LILL
MEDQKVFRFYSFPIIILINYLFFTGIKSEVYTVGGDEQWNTGANFDSWSQQYNYSIGDVLVFKYTEGQHNVYEVTQATYRSCVASSGVIGKYESGNDQVTLTEAKKYWFICNVAGHCLGGMRFSIDVKENPTLIQQQLQHQPHHQKFWNHLILL
***QKVFRFYSFPIIILINYLFFTGIKSEVYTVGGDEQWNTGANFDSWSQQYNYSIGDVLVFKYTEGQHNVYEVTQATYRSCVASSGVIGKYESGNDQVTLTEAKKYWFICNVAGHCLGGMRFSIDVKEN************************
iiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDQKVFRFYSFPIIILINYLFFTGIKSEVYTVGGDEQWNTGANFDSWSQQYNYSIGDVLVFKYTEGQHNVYEVTQATYRSCVASSGVIGKYESGNDQVTLTEAKKYWFICNVAGHCLGGMRFSIDVKENPTLIQQQLQHQPHHQKFWNHLILL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query154 2.2.26 [Sep-21-2011]
Q41001189 Blue copper protein OS=Pi N/A no 0.649 0.529 0.405 5e-17
P60496126 Chemocyanin OS=Lilium lon N/A no 0.616 0.753 0.424 6e-15
Q39131172 Lamin-like protein OS=Ara no no 0.798 0.715 0.312 1e-13
P0030396 Basic blue protein OS=Cuc N/A no 0.616 0.989 0.373 6e-13
P00302107 Stellacyanin OS=Toxicoden N/A no 0.629 0.906 0.368 1e-11
P80728108 Mavicyanin OS=Cucurbita p N/A no 0.642 0.916 0.333 4e-11
Q9SK27182 Early nodulin-like protei no no 0.727 0.615 0.299 6e-11
Q8LG89129 Basic blue protein OS=Ara no no 0.623 0.744 0.34 7e-11
O80517202 Uclacyanin-2 OS=Arabidops no no 0.571 0.435 0.336 3e-09
Q02917187 Early nodulin-55-2 OS=Gly no no 0.714 0.588 0.284 5e-08
>sp|Q41001|BCP_PEA Blue copper protein OS=Pisum sativum PE=2 SV=1 Back     alignment and function desciption
 Score = 86.7 bits (213), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 58/101 (57%), Gaps = 1/101 (0%)

Query: 28  SEVYTVGGDEQWNTGANFDSWSQQYNYSIGDVLVFKYTEGQHNVYEVTQATYRSCVASSG 87
           + VYTVG    W  G ++ +W+    +++GD LVF Y  G H V EV ++ Y+SC  S  
Sbjct: 24  ATVYTVGDTSGWVIGGDYSTWASDKTFAVGDSLVFNYGAGAHTVDEVKESDYKSCT-SGN 82

Query: 88  VIGKYESGNDQVTLTEAKKYWFICNVAGHCLGGMRFSIDVK 128
            I    +G   + L +A K++FIC V GH  GGM+ SI VK
Sbjct: 83  SISTDSTGATTIPLKKAGKHYFICGVPGHSTGGMKLSIKVK 123





Pisum sativum (taxid: 3888)
>sp|P60496|BABL_LILLO Chemocyanin OS=Lilium longiflorum PE=1 SV=1 Back     alignment and function description
>sp|Q39131|LAML_ARATH Lamin-like protein OS=Arabidopsis thaliana GN=At5g15350 PE=1 SV=1 Back     alignment and function description
>sp|P00303|BABL_CUCSA Basic blue protein OS=Cucumis sativus PE=1 SV=1 Back     alignment and function description
>sp|P00302|STEL_TOXVR Stellacyanin OS=Toxicodendron vernicifluum PE=1 SV=1 Back     alignment and function description
>sp|P80728|MAVI_CUCPE Mavicyanin OS=Cucurbita pepo PE=1 SV=1 Back     alignment and function description
>sp|Q9SK27|ENL1_ARATH Early nodulin-like protein 1 OS=Arabidopsis thaliana GN=At2g25060 PE=1 SV=2 Back     alignment and function description
>sp|Q8LG89|BABL_ARATH Basic blue protein OS=Arabidopsis thaliana GN=ARPN PE=1 SV=2 Back     alignment and function description
>sp|O80517|BCB2_ARATH Uclacyanin-2 OS=Arabidopsis thaliana GN=At2g44790 PE=1 SV=1 Back     alignment and function description
>sp|Q02917|NO552_SOYBN Early nodulin-55-2 OS=Glycine max GN=ENOD55-2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
255560533188 Blue copper protein precursor, putative 0.766 0.627 0.677 1e-42
359474843183 PREDICTED: blue copper protein-like [Vit 0.857 0.721 0.626 4e-42
224105149171 predicted protein [Populus trichocarpa] 0.831 0.748 0.625 7e-41
221185999171 blue copper-like protein [Gossypium hirs 0.824 0.742 0.553 3e-36
388490568182 unknown [Medicago truncatula] 0.779 0.659 0.558 5e-36
356536382156 PREDICTED: blue copper protein-like [Gly 0.662 0.653 0.666 7e-36
449458632176 PREDICTED: blue copper protein-like [Cuc 0.798 0.698 0.546 2e-33
449489621151 PREDICTED: blue copper protein-like [Cuc 0.720 0.735 0.576 1e-32
326530850176 predicted protein [Hordeum vulgare subsp 0.772 0.676 0.455 1e-25
357117110187 PREDICTED: blue copper protein-like [Bra 0.753 0.620 0.433 5e-25
>gi|255560533|ref|XP_002521281.1| Blue copper protein precursor, putative [Ricinus communis] gi|223539549|gb|EEF41137.1| Blue copper protein precursor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 80/118 (67%), Positives = 99/118 (83%)

Query: 16  ILINYLFFTGIKSEVYTVGGDEQWNTGANFDSWSQQYNYSIGDVLVFKYTEGQHNVYEVT 75
           +LI  LFF+ ++SEVYTVG DE W + +N+DSWS++YN+S+GDVLVFKY +GQHNVYEV 
Sbjct: 23  VLITGLFFSCVRSEVYTVGDDEGWISDSNYDSWSRKYNFSVGDVLVFKYVKGQHNVYEVM 82

Query: 76  QATYRSCVASSGVIGKYESGNDQVTLTEAKKYWFICNVAGHCLGGMRFSIDVKENPTL 133
           + TYRSC  S GVI KYESG D+V LT+ KKYWFICNVAGHCLGGMRF+IDVK + ++
Sbjct: 83  EGTYRSCDVSRGVIEKYESGKDEVRLTQQKKYWFICNVAGHCLGGMRFNIDVKASTSV 140




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359474843|ref|XP_002277916.2| PREDICTED: blue copper protein-like [Vitis vinifera] gi|297744596|emb|CBI37858.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224105149|ref|XP_002313702.1| predicted protein [Populus trichocarpa] gi|222850110|gb|EEE87657.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|221185999|gb|ACM07442.1| blue copper-like protein [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|388490568|gb|AFK33350.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356536382|ref|XP_003536717.1| PREDICTED: blue copper protein-like [Glycine max] Back     alignment and taxonomy information
>gi|449458632|ref|XP_004147051.1| PREDICTED: blue copper protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449489621|ref|XP_004158367.1| PREDICTED: blue copper protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|326530850|dbj|BAK01223.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|357117110|ref|XP_003560317.1| PREDICTED: blue copper protein-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
TAIR|locus:4010713753106 AT3G17675 [Arabidopsis thalian 0.655 0.952 0.384 4.1e-17
TAIR|locus:2151069187 AT5G26330 [Arabidopsis thalian 0.649 0.534 0.398 1.8e-16
TAIR|locus:2062525 261 UCC1 "uclacyanin 1" [Arabidops 0.772 0.455 0.357 2.3e-16
TAIR|locus:2086518174 AT3G27200 [Arabidopsis thalian 0.727 0.643 0.313 4.7e-16
TAIR|locus:2043833206 AT2G26720 [Arabidopsis thalian 0.746 0.558 0.324 1.6e-15
TAIR|locus:2052866200 AT2G31050 [Arabidopsis thalian 0.746 0.575 0.341 1.6e-15
TAIR|locus:2150951172 ENODL17 "early nodulin-like pr 0.688 0.616 0.342 2e-15
TAIR|locus:1006230143163 ENODL20 "early nodulin-like pr 0.681 0.644 0.336 3.3e-15
TAIR|locus:504956334192 AT5G07475 [Arabidopsis thalian 0.772 0.619 0.297 1.4e-14
TAIR|locus:2116767177 ENODL15 "early nodulin-like pr 0.733 0.638 0.310 3e-14
TAIR|locus:4010713753 AT3G17675 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 210 (79.0 bits), Expect = 4.1e-17, P = 4.1e-17
 Identities = 40/104 (38%), Positives = 54/104 (51%)

Query:    26 IKSE--VYTVGGDEQWNTGANFDSWSQQYNYSIGDVLVFKYTEGQHNVYEVTQATYRSCV 83
             +KSE   + VG    W    N+ +W+Q   + +GDVLVF Y   QHNV +V    Y  C 
Sbjct:     2 LKSEGTEHIVGDSNGWELFTNYTNWTQGREFHVGDVLVFNYKSDQHNVMQVNSTAYTDC- 60

Query:    84 ASSGVIGKYESGNDQVTLTEAKKYWFICNVAGHCLGGMRFSIDV 127
                     +  GND + L+E  K WFIC V  HC+ G + SI+V
Sbjct:    61 GLDNYTTLFTKGNDSIILSEVGKLWFICGVDDHCVNGQKLSINV 104




GO:0005507 "copper ion binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA
TAIR|locus:2151069 AT5G26330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062525 UCC1 "uclacyanin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086518 AT3G27200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043833 AT2G26720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2052866 AT2G31050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150951 ENODL17 "early nodulin-like protein 17" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1006230143 ENODL20 "early nodulin-like protein 20" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956334 AT5G07475 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116767 ENODL15 "early nodulin-like protein 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00036136001
SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (183 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
pfam0229884 pfam02298, Cu_bind_like, Plastocyanin-like domain 6e-25
PLN03148167 PLN03148, PLN03148, Blue copper-like protein; Prov 2e-23
>gnl|CDD|216965 pfam02298, Cu_bind_like, Plastocyanin-like domain Back     alignment and domain information
 Score = 91.2 bits (227), Expect = 6e-25
 Identities = 36/82 (43%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 40  NTGANFDSWSQQYNYSIGDVLVFKYTEGQHNVYEVTQATYRSCVASSGVIGKYESGNDQV 99
              A++  W+    + +GD LVF Y +G HNV EVT+A Y SC  S   I  Y +GND +
Sbjct: 4   PLNADYTLWASGKTFRVGDTLVFNYDKGFHNVVEVTKADYESCNTSKP-IRTYTTGNDII 62

Query: 100 TLTEAKKYWFICNVAGHCLGGM 121
            LT+  +++FIC V GHC GG 
Sbjct: 63  PLTKPGQHYFICGVPGHCKGGQ 84


This family represents a domain found in flowering plants related to the copper binding protein plastocyanin. Some members of this family may not bind copper due to the lack of key residues. Length = 84

>gnl|CDD|178693 PLN03148, PLN03148, Blue copper-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 154
PLN03148167 Blue copper-like protein; Provisional 100.0
PF0229885 Cu_bind_like: Plastocyanin-like domain; InterPro: 99.97
PRK02710119 plastocyanin; Provisional 98.84
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 98.68
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 98.6
COG3794128 PetE Plastocyanin [Energy production and conversio 98.53
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 98.44
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 98.42
TIGR0265783 amicyanin amicyanin. Members of this family are am 97.8
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 97.64
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 96.36
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 95.91
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 95.48
COG4454158 Uncharacterized copper-binding protein [Inorganic 95.27
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 95.0
KOG3858233 consensus Ephrin, ligand for Eph receptor tyrosine 93.69
TIGR02376 311 Cu_nitrite_red nitrite reductase, copper-containin 93.35
PRK02888635 nitrous-oxide reductase; Validated 93.04
PLN02354 552 copper ion binding / oxidoreductase 92.62
PLN02604 566 oxidoreductase 91.86
PF07732117 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR01 91.73
TIGR02695125 azurin azurin. Azurin is a blue copper-binding pro 91.71
PF00116120 COX2: Cytochrome C oxidase subunit II, periplasmic 91.08
PF00812145 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a 88.66
TIGR02866201 CoxB cytochrome c oxidase, subunit II. Cytochrome 86.6
PLN00044 596 multi-copper oxidase-related protein; Provisional 85.29
PLN02191 574 L-ascorbate oxidase 85.27
PRK10378 375 inactive ferrous ion transporter periplasmic prote 85.0
PLN02168 545 copper ion binding / pectinesterase 84.01
PLN02835 539 oxidoreductase 83.93
TIGR03388 541 ascorbase L-ascorbate oxidase, plant type. Members 83.48
MTH00047194 COX2 cytochrome c oxidase subunit II; Provisional 81.9
KOG1263 563 consensus Multicopper oxidases [Secondary metaboli 80.74
>PLN03148 Blue copper-like protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.8e-42  Score=270.25  Aligned_cols=112  Identities=33%  Similarity=0.750  Sum_probs=102.6

Q ss_pred             HHhhcccceeEEEecCCCCCCCCCCCccccCCceeEeCCEEEEEEcCCcccEEEECccccccccCCCCcccccccCcceE
Q 043552           20 YLFFTGIKSEVYTVGGDEQWNTGANFDSWSQQYNYSIGDVLVFKYTEGQHNVYEVTQATYRSCVASSGVIGKYESGNDQV   99 (154)
Q Consensus        20 ~~~~~~a~a~~~~VGg~~GW~~~~~Y~~Was~~~f~vGDtLvF~y~~~~HsV~~V~~~~y~~C~~~~~~~~~~~~G~~~v   99 (154)
                      +++...+.|++|+|||+.||+.+.+|++|+++++|++||+|+|+|+++.|||+||++++|+.|+.++ ++..+++|++.|
T Consensus        12 ~~~~~~~~a~~~~VGd~~GW~~~~~Y~~WA~~k~F~VGD~LvF~Y~~~~hnV~~V~~~~Y~~C~~~~-pi~~~tsG~d~v   90 (167)
T PLN03148         12 LFSASATTATDHIVGANKGWNPGINYTLWANNQTFYVGDLISFRYQKTQYNVFEVNQTGYDNCTTEG-AAGNWTSGKDFI   90 (167)
T ss_pred             HHhhhhccceEEEeCCCCCcCCCCChhHhhcCCCCccCCEEEEEecCCCceEEEEChHHcCcccCCC-CcceecCCCcEE
Confidence            3444677899999999999999889999999999999999999999999999999999999999986 567899999999


Q ss_pred             EccCCceEEEEcCCCCCCCCCCeEEEEeeCCCCC
Q 043552          100 TLTEAKKYWFICNVAGHCLGGMRFSIDVKENPTL  133 (154)
Q Consensus       100 ~l~~~G~~YFic~v~~HC~~GmKl~I~V~~~~~~  133 (154)
                      +|+++|++||||+ .+||++||||+|+|.+.++|
T Consensus        91 ~L~~~G~~YFIcg-~ghC~~GmKl~I~V~~~~~p  123 (167)
T PLN03148         91 PLNKAKRYYFICG-NGQCFNGMKVTILVHPLPPP  123 (167)
T ss_pred             EecCCccEEEEcC-CCccccCCEEEEEEcCCCCC
Confidence            9999999999999 69999999999999865444



>PF02298 Cu_bind_like: Plastocyanin-like domain; InterPro: IPR003245 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>KOG3858 consensus Ephrin, ligand for Eph receptor tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PLN02354 copper ion binding / oxidoreductase Back     alignment and domain information
>PLN02604 oxidoreductase Back     alignment and domain information
>PF07732 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>TIGR02695 azurin azurin Back     alignment and domain information
>PF00116 COX2: Cytochrome C oxidase subunit II, periplasmic domain This family corresponds to chains b and o Back     alignment and domain information
>PF00812 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a family of proteins [] that are ligands of class V (EPH-related) receptor protein-tyrosine kinases (see IPR001426 from INTERPRO) Back     alignment and domain information
>TIGR02866 CoxB cytochrome c oxidase, subunit II Back     alignment and domain information
>PLN00044 multi-copper oxidase-related protein; Provisional Back     alignment and domain information
>PLN02191 L-ascorbate oxidase Back     alignment and domain information
>PRK10378 inactive ferrous ion transporter periplasmic protein EfeO; Provisional Back     alignment and domain information
>PLN02168 copper ion binding / pectinesterase Back     alignment and domain information
>PLN02835 oxidoreductase Back     alignment and domain information
>TIGR03388 ascorbase L-ascorbate oxidase, plant type Back     alignment and domain information
>MTH00047 COX2 cytochrome c oxidase subunit II; Provisional Back     alignment and domain information
>KOG1263 consensus Multicopper oxidases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
1f56_A91 Spinach Plantacyanin Length = 91 2e-14
2cbp_A96 Cucumber Basic Protein, A Blue Copper Protein Lengt 4e-14
1ws7_A109 Crystal Structure Of Mavicyanin From Cucurbita Pepo 2e-12
1x9r_A116 Umecyanin From Horse Raddish- Crystal Structure Of 1e-08
1jer_A138 Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 9e-07
>pdb|1F56|A Chain A, Spinach Plantacyanin Length = 91 Back     alignment and structure

Iteration: 1

Score = 75.1 bits (183), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 40/91 (43%), Positives = 56/91 (61%), Gaps = 3/91 (3%) Query: 39 WNTGANFD-SWSQQYNYSIGDVLVFKYTEGQHNVYEVTQATYRSCVASSGVIGKYESGND 97 +N G +F+ + ++ ++ GDVLVFKY +GQHNV V Y SC A G Y SG D Sbjct: 3 YNIGWSFNVNGARGKSFRAGDVLVFKYIKGQHNVVAVNGRGYASCSAPRGAR-TYSSGQD 61 Query: 98 QVTLTEAKKYWFICNVAGHCLGGMRFSIDVK 128 ++ LT + Y FIC+ GHC GGM+ +I+ K Sbjct: 62 RIKLTRGQNY-FICSFPGHCGGGMKIAINAK 91
>pdb|2CBP|A Chain A, Cucumber Basic Protein, A Blue Copper Protein Length = 96 Back     alignment and structure
>pdb|1WS7|A Chain A, Crystal Structure Of Mavicyanin From Cucurbita Pepo Medullosa (Zucchini) Length = 109 Back     alignment and structure
>pdb|1X9R|A Chain A, Umecyanin From Horse Raddish- Crystal Structure Of The Oxidised Form Length = 116 Back     alignment and structure
>pdb|1JER|A Chain A, Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 5e-33
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 1e-32
1jer_A138 Cucumber stellacyanin; electron transport, copper, 3e-32
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 1e-30
2cbp_A96 Cucumber basic protein; electron transport, phytoc 7e-30
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 4e-05
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Length = 116 Back     alignment and structure
 Score =  112 bits (281), Expect = 5e-33
 Identities = 29/106 (27%), Positives = 50/106 (47%), Gaps = 4/106 (3%)

Query: 29  EVYTVGGDEQWNTGAN---FDSWSQQYNYSIGDVLVFKYTEGQHNVYEVTQATYRSCVAS 85
           E Y VGGD +W   ++   + +W+    + +GD L F +  G H+V  VT+  + +C   
Sbjct: 2   EDYDVGGDMEWKRPSDPKFYITWATGKTFRVGDELEFDFAAGMHDVAVVTKDAFDNCKKE 61

Query: 86  SGVIGKYESGNDQVTLTEAKKYWFICNVAGHCLGGMRFSIDVKENP 131
           +  I    +   ++ L      ++IC V  HC  G + SI+V    
Sbjct: 62  NP-ISHMTTPPVKIMLNTTGPQYYICTVGDHCRVGQKLSINVVGAG 106


>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Length = 109 Back     alignment and structure
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Length = 138 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Length = 91 Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Length = 96 Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Length = 140 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
1jer_A138 Cucumber stellacyanin; electron transport, copper, 100.0
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 100.0
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 100.0
2cbp_A96 Cucumber basic protein; electron transport, phytoc 100.0
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 100.0
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 99.42
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 99.26
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 99.21
2cal_A154 Rusticyanin; iron respiratory electron transport c 99.2
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 99.18
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 99.14
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 99.12
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 99.11
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 99.06
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 99.04
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 99.03
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 99.02
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 98.96
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 98.94
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 98.92
1byp_A99 Protein (plastocyanin); electron transfer, photosy 98.91
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 98.81
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 98.56
3c75_A132 Amicyanin; copper proteins, electron transfer comp 98.55
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 98.43
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 98.38
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 98.32
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 98.27
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 98.21
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 98.19
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 98.09
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 98.07
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 98.05
1iko_P178 Ephrin-B2; greek KEY, glycosylation, signaling pro 97.47
2x11_B177 Ephrin-A5; receptor-signaling protein complex, dev 97.38
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 97.36
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 97.28
3czu_B182 Ephrin-A1; ATP-binding, kinase, nucleotide-binding 96.91
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 96.78
1shx_A138 Ephrin-A5; ephrin signaling, hormone-growth factor 96.52
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 96.43
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 96.36
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 96.06
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 95.84
3d12_B141 Ephrin-B3; beta propeller, protein-receptor comple 94.81
2vsm_B140 Ephrin-B2; developmental protein, henipavirus, neu 94.55
2wo3_B157 Ephrin-A2; transferase-signaling protein complex, 93.51
1oe1_A 336 Dissimilatory copper-containing nitrite reductase; 91.53
1mzy_A 333 Copper-containing nitrite reductase; mutant M182T, 90.98
1oe1_A336 Dissimilatory copper-containing nitrite reductase; 90.45
3gdc_A 288 Multicopper oxidase; beta sandwich, plasmid, oxido 90.1
1kbv_A 327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 89.42
2zoo_A 442 Probable nitrite reductase; electron transfer, ele 85.15
2bw4_A 340 Copper-containing nitrite reductase; oxidoreductas 84.59
1fft_B315 Ubiquinol oxidase; electron transport, cytochrome 83.28
1zpu_A 534 Iron transport multicopper oxidase FET3; ferroxida 81.67
3g5w_A 318 Multicopper oxidase type 1; two domain, laccase, n 80.56
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
Probab=100.00  E-value=9.5e-42  Score=258.36  Aligned_cols=109  Identities=25%  Similarity=0.527  Sum_probs=98.6

Q ss_pred             ceeEEEecCCCCCCCC---CCCccccCCceeEeCCEEEEEEcCCcccEEEE-CccccccccCCCCcccccccCcceEEc-
Q 043552           27 KSEVYTVGGDEQWNTG---ANFDSWSQQYNYSIGDVLVFKYTEGQHNVYEV-TQATYRSCVASSGVIGKYESGNDQVTL-  101 (154)
Q Consensus        27 ~a~~~~VGg~~GW~~~---~~Y~~Was~~~f~vGDtLvF~y~~~~HsV~~V-~~~~y~~C~~~~~~~~~~~~G~~~v~l-  101 (154)
                      +|++|+|||+.||+++   .+|++|+++++|++||+|+|+|.++.|+|+|| ++++|+.|+.++ ++..+++|+++|+| 
T Consensus         2 ~a~~~~VGg~~GW~~~~~~~~Y~~Wa~~~~F~vGD~LvF~y~~~~HsV~~V~~~~~y~~C~~s~-p~~~~~~G~~~v~L~   80 (138)
T 1jer_A            2 QSTVHIVGDNTGWSVPSSPNFYSQWAAGKTFRVGDSLQFNFPANAHNVHEMETKQSFDACNFVN-SDNDVERTSPVIERL   80 (138)
T ss_dssp             CCCEEETTGGGCSSCCSSTTHHHHHHHTCCEETTCEEEECCCTTTCCCEEESCHHHHHHTCCTT-SCCCCCCCSCEEEEC
T ss_pred             CceEEEECCcCcCcCCCCccchhhhhcCCcCcCCCEEEEeecCCCceEEEeCchhhcCccCCCC-ccccccCCCeEEEec
Confidence            5789999999999998   78999999999999999999999999999999 999999999986 56788999999999 


Q ss_pred             cCCceEEEEcCCCCCCCCCCeEEEEeeCCCCCccc
Q 043552          102 TEAKKYWFICNVAGHCLGGMRFSIDVKENPTLIQQ  136 (154)
Q Consensus       102 ~~~G~~YFic~v~~HC~~GmKl~I~V~~~~~~~~~  136 (154)
                      +++|++||||++++||++||||+|+|.+..+++++
T Consensus        81 ~~~G~~YFicg~~gHC~~GmKl~I~V~~~~~~~~~  115 (138)
T 1jer_A           81 DELGMHYFVCTVGTHCSNGQKLSINVVAANATVSM  115 (138)
T ss_dssp             CSSEEEEEECCSTTTGGGTCEEEEEEECCC-----
T ss_pred             cCCcCEEEEcCCCCccccCCEEEEEEcCCCCCCCC
Confidence            99999999999999999999999999877554433



>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Back     alignment and structure
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>1iko_P Ephrin-B2; greek KEY, glycosylation, signaling protein; HET: NAG MAN; 1.92A {Mus musculus} SCOP: b.6.1.5 Back     alignment and structure
>2x11_B Ephrin-A5; receptor-signaling protein complex, developmental protein, signaling platform, kinase, transferase, neurogenesis, receptor, cataract; 4.83A {Homo sapiens} Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>3czu_B Ephrin-A1; ATP-binding, kinase, nucleotide-binding, receptor, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG MAN; 2.65A {Homo sapiens} PDB: 3mbw_B* Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>1shx_A Ephrin-A5; ephrin signaling, hormone-growth factor complex; HET: NAG; 2.10A {Mus musculus} SCOP: b.6.1.5 PDB: 1shw_A* 3mx0_B* Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3d12_B Ephrin-B3; beta propeller, protein-receptor complex, envelope protein, glycoprotein, hemagglutinin, hydrolase, membrane, signal-AN transmembrane; HET: NAG BMA MAN BGC LXZ NGA GL0 GLC LXB NGZ GXL; 3.00A {Mus musculus} Back     alignment and structure
>2vsm_B Ephrin-B2; developmental protein, henipavirus, neurogenesis, glycoprotein, paramyxovirus, envelope protein, cell surface receptor, hendra, virion; HET: NAG; 1.80A {Homo sapiens} PDB: 2wo2_B* 2i85_A 3gxu_B 2vsk_B 2hle_B 1kgy_E Back     alignment and structure
>2wo3_B Ephrin-A2; transferase-signaling protein complex, EFN, EPHA4, KINA ephrin, complex, membrane, cell surface receptor, tyrosine- kinase, glycoprotein; HET: NAG; 2.35A {Homo sapiens} Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Back     alignment and structure
>1fft_B Ubiquinol oxidase; electron transport, cytochrome oxidase, membrane protein, oxidoreductase; HET: HEM HEO; 3.50A {Escherichia coli} SCOP: b.6.1.2 f.17.2.1 Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 154
d2cbpa_96 b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativ 3e-33
d1ws8a_104 b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) 3e-32
d1f56a_91 b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia olera 2e-29
d1jera_110 b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativ 2e-29
d1qhqa_139 b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus 2e-04
d2jxma197 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prok 9e-04
d1bypa_99 b.6.1.1 (A:) Plastocyanin {White campion (Silene p 0.002
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 96 Back     information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Plantacyanin
species: Cucumber (Cucumis sativus) [TaxId: 3659]
 Score =  110 bits (277), Expect = 3e-33
 Identities = 36/98 (36%), Positives = 52/98 (53%), Gaps = 4/98 (4%)

Query: 30  VYTVGGDEQWNTGANFDSWSQQYNYSIGDVLVFKYTEGQHNVYEVTQATYRSCVASSGVI 89
           VY VGG   W    N +SW +   +  GD+L+F Y    HNV  V Q  + +C   +G  
Sbjct: 2   VYVVGGSGGWTF--NTESWPKGKRFRAGDILLFNYNPSMHNVVVVNQGGFSTCNTPAG-A 58

Query: 90  GKYESGNDQVTLTEAKKYWFICNVAGHCLGGMRFSIDV 127
             Y SG DQ+ L +  + +FICN  GHC  GM+ +++ 
Sbjct: 59  KVYTSGRDQIKLPK-GQSYFICNFPGHCQSGMKIAVNA 95


>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Length = 104 Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 91 Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 110 Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Length = 139 Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Length = 97 Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Length = 99 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
d1ws8a_104 Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663 100.0
d2cbpa_96 Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1jera_110 Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1f56a_91 Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 99.97
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 99.27
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 99.24
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 99.15
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 99.09
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 99.08
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 99.07
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 99.04
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 99.01
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 98.99
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 98.98
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 98.93
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 98.91
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.89
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 98.76
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.73
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 98.52
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 98.26
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 98.1
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 97.98
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 97.76
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 97.54
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 97.23
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 97.22
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 97.2
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 97.07
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 97.0
d1shxa1138 Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} 96.76
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 96.41
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 96.33
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 95.51
d1ikop_141 Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 95.34
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 94.87
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 94.36
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 94.29
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 93.25
d1hfua1131 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 92.63
d1v10a1136 Laccase {Rigidoporus lignosus [TaxId: 219653]} 90.5
d1kv7a1140 multi-copper oxidase CueO {Escherichia coli [TaxId 88.03
d1kcwa2146 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 86.39
d2j5wa2145 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 85.37
d1kbva2151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 82.58
d1sddb2139 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 82.55
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Back     information, alignment and structure
class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Mavicyanin
species: Zucchini (Cucurbita pepo) [TaxId: 3663]
Probab=100.00  E-value=5.1e-39  Score=230.86  Aligned_cols=102  Identities=32%  Similarity=0.733  Sum_probs=95.5

Q ss_pred             ceeEEEecCCCCCCC--CCCCccccCCceeEeCCEEEEEEcCCcccEEEECccccccccCCCCcccccccCcceEEccCC
Q 043552           27 KSEVYTVGGDEQWNT--GANFDSWSQQYNYSIGDVLVFKYTEGQHNVYEVTQATYRSCVASSGVIGKYESGNDQVTLTEA  104 (154)
Q Consensus        27 ~a~~~~VGg~~GW~~--~~~Y~~Was~~~f~vGDtLvF~y~~~~HsV~~V~~~~y~~C~~~~~~~~~~~~G~~~v~l~~~  104 (154)
                      .|++|+|||+.||+.  +.+|+.|+++++|++||+|+|+|+++.|+|++|++++|+.|+..+ ++..+++|++.++|+++
T Consensus         1 ~at~~~VGg~~gW~~~~~~~Y~~Wa~~~~f~vGD~l~F~y~~~~h~V~~v~~~~y~~C~~~~-~~~~~~~G~~~v~l~~~   79 (104)
T d1ws8a_           1 MATVHKVGDSTGWTTLVPYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNSSS-PAASYTSGADSIPLKRP   79 (104)
T ss_dssp             CCCEEETTGGGCSCSSSCCCHHHHHHTSCBCTTCEEEEECCTTTCCEEEECHHHHHHTCCSS-CSEEECSSEEEEECCSS
T ss_pred             CCcEEEeCCcCccCcCCCcCHHHHhhCCcCCCCCEEEEEECCCCceEEEECHHHhcCCcCCC-ccccccCCCeEEEEecC
Confidence            478999999999985  458999999999999999999999999999999999999999986 46778999999999999


Q ss_pred             ceEEEEcCCCCCCCCCCeEEEEeeC
Q 043552          105 KKYWFICNVAGHCLGGMRFSIDVKE  129 (154)
Q Consensus       105 G~~YFic~v~~HC~~GmKl~I~V~~  129 (154)
                      |++||||++++||++||||+|+|++
T Consensus        80 g~~yF~C~~~~HC~~Gmkl~I~V~P  104 (104)
T d1ws8a_          80 GTFYFLCGIPGHCQLGQKVEIKVDP  104 (104)
T ss_dssp             EEEEEECCSTTTTTTTCEEEEEECC
T ss_pred             ccEEEECCCcchhhCCCEEEEEECC
Confidence            9999999999999999999999964



>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1shxa1 b.6.1.5 (A:32-170) Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1ikop_ b.6.1.5 (P:) Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure