Citrus Sinensis ID: 043556

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------
MSNPHVLVIPAPAQGHVIPLLEFSQCLANHGVRVTFVNSEYNHQRVLKSLEGKNNLEEKIRLVSIPDGMEPWEDRNELGNKLKKILQVMPGNLEELIEEINEKEDEKIDCFIADAYMGWTMRIAEKMKLRRGVVWPSSAASVALCFRIPKLIDDGIISSDGNYQIL
ccccEEEEEcccccccHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHcccccccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHccccEEEEccHHHHHHHHHHcHHHHHHccccccccccccc
ccccEEEEEEccccccHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHccccccccccEEEEEcccccccccccccHHHHHHHHHHHccHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHHHHHccccccccccccc
msnphvlvipapaqghvipllefsqclanhgvrvtfvnseYNHQRVLKSLegknnleekirlvsipdgmepweDRNELGNKLKKILQVMPGNLEELIEEINEKEDEKIDCFIADAYMGWTMRIAEKMKLrrgvvwpssaaSVALCFRIpkliddgiissdgnyqil
MSNPHVLVIPAPAQGHVIPLLEFSQCLANHGVRVTFVNSEYNHQRVlkslegknnleekirlvsipdgmepwEDRNELGNKLKKILQVMPGNLEELIEEInekedekiDCFIADAYMGWTMRIAEKMKLRRGVVWPSSAASVALCFRIPkliddgiissdgnyqil
MSNPHVLVIPAPAQGHVIPLLEFSQCLANHGVRVTFVNSEYNHQRVLKSLEGKNNLEEKIRLVSIPDGMEPWEDRNELGNKLKKILQVMPGnleelieeinekedekidCFIADAYMGWTMRIAEKMKLRRGVVWPSSAASVALCFRIPKLIDDGIISSDGNYQIL
*****VLVIPAPAQGHVIPLLEFSQCLANHGVRVTFVNSEYNHQRVLKSLEGKNNLEEKIRLVSIPD****W*****LGNKLKKILQVMPGNLEELIEEINEKEDEKIDCFIADAYMGWTMRIAEKMKLRRGVVWPSSAASVALCFRIPKLIDDGIIS********
MSNPHVLVIPAPAQGHVIPLLEFSQCLANHGVRVTFVNSEYNHQ***************IRLVSIPDGMEPWEDRNELGNKLKKILQVMPGNLEELIEEINEKEDEKIDCFIADAYMGWTMRIAEKMKLRRGVVWPSSAASVALCFRIPKLIDDGIISSDGNYQIL
MSNPHVLVIPAPAQGHVIPLLEFSQCLANHGVRVTFVNSEYNHQRVLKSLEGKNNLEEKIRLVSIPDGMEPWEDRNELGNKLKKILQVMPGNLEELIEEINEKEDEKIDCFIADAYMGWTMRIAEKMKLRRGVVWPSSAASVALCFRIPKLIDDGIISSDGNYQIL
*SNPHVLVIPAPAQGHVIPLLEFSQCLANHGVRVTFVNSEYNHQRVLKSLEGKNNLEEKIRLVSIPDGMEPWEDRNELGNKLKKILQVMPGNLEELIEEINEKEDEKIDCFIADAYMGWTMRIAEKMKLRRGVVWPSSAASVALCFRIPKLIDDGIISSDG*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNPHVLVIPAPAQGHVIPLLEFSQCLANHGVRVTFVNSEYNHQRVLKSLEGKNNLEEKIRLVSIPDGMEPWEDRNELGNKLKKIxxxxxxxxxxxxxxxxxxxxxKIDCFIADAYMGWTMRIAEKMKLRRGVVWPSSAASVALCFRIPKLIDDGIISSDGNYQIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query166 2.2.26 [Sep-21-2011]
Q9SGA8 464 UDP-glycosyltransferase 8 yes no 0.993 0.355 0.450 1e-36
Q9M9E7 489 UDP-glycosyltransferase 8 no no 0.915 0.310 0.375 4e-21
Q9LMF0 479 UDP-glycosyltransferase 8 no no 0.909 0.315 0.320 5e-18
Q9SJL0 490 UDP-glycosyltransferase 8 no no 0.957 0.324 0.284 7e-18
Q9LME8 487 UDP-glycosyltransferase 8 no no 0.909 0.310 0.327 1e-17
Q9ZWJ3 481 UDP-glycosyltransferase 8 no no 0.903 0.311 0.297 3e-16
Q9SK82 489 UDP-glycosyltransferase 8 no no 0.909 0.308 0.308 2e-15
Q9LMF1 488 UDP-glycosyltransferase 8 no no 0.897 0.305 0.310 3e-15
Q9SBL1 492 Cyanohydrin beta-glucosyl N/A no 0.933 0.315 0.262 3e-12
Q9ZUV0 482 UDP-glycosyltransferase 8 no no 0.855 0.294 0.28 5e-11
>sp|Q9SGA8|U83A1_ARATH UDP-glycosyltransferase 83A1 OS=Arabidopsis thaliana GN=UGT83A1 PE=2 SV=1 Back     alignment and function desciption
 Score =  152 bits (383), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 113/171 (66%), Gaps = 6/171 (3%)

Query: 1   MSNPHVLVIPAPAQGHVIPLLEFSQCLANHGVRVTFVNSEYNHQRVLKSLEG---KNNLE 57
           M  PHV+VIP PAQGHV+PL+ FS+ LA  G+++TF+N+E+NH R++ SL     ++ + 
Sbjct: 9   MGRPHVVVIPYPAQGHVLPLISFSRYLAKQGIQITFINTEFNHNRIISSLPNSPHEDYVG 68

Query: 58  EKIRLVSIPDGMEPW-EDRNELGNKLKKILQVMPGNLEELIEEINEKEDEK--IDCFIAD 114
           ++I LVSIPDG+E   E+RN  G   + +L+ MP  +EELIE +  +      I C +AD
Sbjct: 69  DQINLVSIPDGLEDSPEERNIPGKLSESVLRFMPKKVEELIERMMAETSGGTIISCVVAD 128

Query: 115 AYMGWTMRIAEKMKLRRGVVWPSSAASVALCFRIPKLIDDGIISSDGNYQI 165
             +GW + +A K  +RR    P++AAS+ L F I KLIDDG+I SDG  ++
Sbjct: 129 QSLGWAIEVAAKFGIRRTAFCPAAAASMVLGFSIQKLIDDGLIDSDGTVRV 179

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: -
>sp|Q9M9E7|U85A4_ARATH UDP-glycosyltransferase 85A4 OS=Arabidopsis thaliana GN=UGT85A4 PE=2 SV=1 Back     alignment and function description
>sp|Q9LMF0|U85A5_ARATH UDP-glycosyltransferase 85A5 OS=Arabidopsis thaliana GN=UGT85A5 PE=2 SV=1 Back     alignment and function description
>sp|Q9SJL0|U86A1_ARATH UDP-glycosyltransferase 86A1 OS=Arabidopsis thaliana GN=UGT86A1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LME8|U85A7_ARATH UDP-glycosyltransferase 85A7 OS=Arabidopsis thaliana GN=UGT85A7 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZWJ3|U85A2_ARATH UDP-glycosyltransferase 85A2 OS=Arabidopsis thaliana GN=UGT85A2 PE=2 SV=1 Back     alignment and function description
>sp|Q9SK82|U85A1_ARATH UDP-glycosyltransferase 85A1 OS=Arabidopsis thaliana GN=UGT85A1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LMF1|U85A3_ARATH UDP-glycosyltransferase 85A3 OS=Arabidopsis thaliana GN=UGT85A3 PE=2 SV=2 Back     alignment and function description
>sp|Q9SBL1|HMNGT_SORBI Cyanohydrin beta-glucosyltransferase OS=Sorghum bicolor GN=UGT85B1 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZUV0|U86A2_ARATH UDP-glycosyltransferase 86A2 OS=Arabidopsis thaliana GN=UGT86A2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query166
224080163 454 predicted protein [Populus trichocarpa] 0.975 0.356 0.580 2e-50
224141477 454 predicted protein [Populus trichocarpa] 0.975 0.356 0.574 2e-50
225451709 454 PREDICTED: UDP-glycosyltransferase 83A1 0.975 0.356 0.567 6e-50
359488535 451 PREDICTED: LOW QUALITY PROTEIN: UDP-glyc 0.975 0.359 0.543 4e-49
255570294 452 UDP-glucuronosyltransferase, putative [R 0.969 0.356 0.567 2e-47
296082221 494 unnamed protein product [Vitis vinifera] 0.909 0.305 0.543 9e-45
225451705 454 PREDICTED: UDP-glycosyltransferase 83A1 0.909 0.332 0.543 1e-44
147767625 568 hypothetical protein VITISV_004920 [Viti 0.909 0.265 0.543 1e-44
225451707 454 PREDICTED: UDP-glycosyltransferase 83A1 0.945 0.345 0.588 1e-43
397789312162 putative UDP-glucosyltransferase 83A, pa 0.951 0.975 0.515 3e-43
>gi|224080163|ref|XP_002306038.1| predicted protein [Populus trichocarpa] gi|222849002|gb|EEE86549.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 116/162 (71%)

Query: 1   MSNPHVLVIPAPAQGHVIPLLEFSQCLANHGVRVTFVNSEYNHQRVLKSLEGKNNLEEKI 60
           M  PH++VIP PAQGHVIP +E SQCL   G ++TFV++EYNH+RVLK+L G  NL  +I
Sbjct: 1   MGKPHIVVIPYPAQGHVIPFMELSQCLVKQGFKITFVSTEYNHKRVLKALRGNINLGGEI 60

Query: 61  RLVSIPDGMEPWEDRNELGNKLKKILQVMPGNLEELIEEINEKEDEKIDCFIADAYMGWT 120
            LVS+PDG+E   DRNELG   K I QVMPG LEELI+ IN  E+EKI C I D  MGW 
Sbjct: 61  SLVSLPDGLEACGDRNELGKLSKAIFQVMPGKLEELIDRINMTEEEKITCIITDWSMGWA 120

Query: 121 MRIAEKMKLRRGVVWPSSAASVALCFRIPKLIDDGIISSDGN 162
           + +AEKMK+RR + WP++AA +     IPKL+ DGII  DG 
Sbjct: 121 LEVAEKMKIRRAIYWPAAAAILCSLISIPKLLSDGIIDGDGT 162

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224141477|ref|XP_002324098.1| predicted protein [Populus trichocarpa] gi|222867100|gb|EEF04231.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225451709|ref|XP_002276804.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488535|ref|XP_003633773.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 83A1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255570294|ref|XP_002526107.1| UDP-glucuronosyltransferase, putative [Ricinus communis] gi|223534604|gb|EEF36301.1| UDP-glucuronosyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|296082221|emb|CBI21226.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225451705|ref|XP_002279246.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147767625|emb|CAN60198.1| hypothetical protein VITISV_004920 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225451707|ref|XP_002279299.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|397789312|gb|AFO67245.1| putative UDP-glucosyltransferase 83A, partial [Aralia elata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query166
TAIR|locus:2078608 464 AT3G02100 [Arabidopsis thalian 0.993 0.355 0.415 9.8e-32
TAIR|locus:2032105 489 UGT85A4 "AT1G78270" [Arabidops 0.915 0.310 0.343 7.5e-18
TAIR|locus:2196516 487 UGT85A7 "UDP-glucosyl transfer 0.439 0.149 0.454 3.6e-15
TAIR|locus:2196496 479 UGT85A5 "UDP-glucosyl transfer 0.909 0.315 0.295 7.6e-14
TAIR|locus:2196490 488 UGT85A3 "AT1G22380" [Arabidops 0.903 0.307 0.293 7e-12
TAIR|locus:2009557 489 UGT85A1 [Arabidopsis thaliana 0.945 0.321 0.279 9.1e-12
TAIR|locus:2196501 481 UGT85A2 "UDP-glucosyl transfer 0.903 0.311 0.265 2.4e-11
TAIR|locus:2057976 490 AT2G36970 [Arabidopsis thalian 0.957 0.324 0.266 6.7e-11
TAIR|locus:2130225 475 UGT84A4 "AT4G15500" [Arabidops 0.819 0.286 0.290 9.2e-09
TAIR|locus:2091628 461 AT3G22250 [Arabidopsis thalian 0.879 0.316 0.240 8.2e-08
TAIR|locus:2078608 AT3G02100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 348 (127.6 bits), Expect = 9.8e-32, P = 9.8e-32
 Identities = 71/171 (41%), Positives = 104/171 (60%)

Query:     1 MSNPHVLVIPAPAQGHVIPLLEFSQCLANHGVRVTFVNSEYNHQRVLKSLEG---KNNLE 57
             M  PHV+VIP PAQGHV+PL+ FS+ LA  G+++TF+N+E+NH R++ SL     ++ + 
Sbjct:     9 MGRPHVVVIPYPAQGHVLPLISFSRYLAKQGIQITFINTEFNHNRIISSLPNSPHEDYVG 68

Query:    58 EKIRLVSIPDGMEPW-EDRNELGNKLKKILQVMPGXXXXXXXXXXXXXXXXX--XCFIAD 114
             ++I LVSIPDG+E   E+RN  G   + +L+ MP                     C +AD
Sbjct:    69 DQINLVSIPDGLEDSPEERNIPGKLSESVLRFMPKKVEELIERMMAETSGGTIISCVVAD 128

Query:   115 AYMGWTMRIAEKMKLRRGVVWPSSAASVALCFRIPKLIDDGIISSDGNYQI 165
               +GW + +A K  +RR    P++AAS+ L F I KLIDDG+I SDG  ++
Sbjct:   129 QSLGWAIEVAAKFGIRRTAFCPAAAASMVLGFSIQKLIDDGLIDSDGTVRV 179
GO:0005634 "nucleus" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA
GO:0008194 "UDP-glycosyltransferase activity" evidence=ISS
GO:0016757 "transferase activity, transferring glycosyl groups" evidence=ISS
GO:0016758 "transferase activity, transferring hexosyl groups" evidence=IEA
TAIR|locus:2032105 UGT85A4 "AT1G78270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196516 UGT85A7 "UDP-glucosyl transferase 85A7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196496 UGT85A5 "UDP-glucosyl transferase 85A5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196490 UGT85A3 "AT1G22380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009557 UGT85A1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196501 UGT85A2 "UDP-glucosyl transferase 85A2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057976 AT2G36970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130225 UGT84A4 "AT4G15500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091628 AT3G22250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00170469
hypothetical protein (454 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
PLN02562 448 PLN02562, PLN02562, UDP-glycosyltransferase 2e-19
PLN02534 491 PLN02534, PLN02534, UDP-glycosyltransferase 4e-13
PLN02863 477 PLN02863, PLN02863, UDP-glucoronosyl/UDP-glucosyl 2e-12
PLN02555 480 PLN02555, PLN02555, limonoid glucosyltransferase 1e-11
PLN03007 482 PLN03007, PLN03007, UDP-glucosyltransferase family 5e-11
PLN02173 449 PLN02173, PLN02173, UDP-glucosyl transferase famil 6e-08
PLN02410 451 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl 7e-08
PLN02152 455 PLN02152, PLN02152, indole-3-acetate beta-glucosyl 1e-07
PLN02448 459 PLN02448, PLN02448, UDP-glycosyltransferase family 6e-07
PLN02210 456 PLN02210, PLN02210, UDP-glucosyl transferase 1e-06
PLN02670 472 PLN02670, PLN02670, transferase, transferring glyc 3e-06
PLN02992 481 PLN02992, PLN02992, coniferyl-alcohol glucosyltran 0.002
PLN00414 446 PLN00414, PLN00414, glycosyltransferase family pro 0.003
>gnl|CDD|215305 PLN02562, PLN02562, UDP-glycosyltransferase Back     alignment and domain information 
 Score = 83.4 bits (206), Expect = 2e-19
 Identities = 45/163 (27%), Positives = 81/163 (49%), Gaps = 11/163 (6%)

Query: 1   MSNPHVLVIPAPAQGHVIPLLEFSQCLANHGVRVTFVNSEYNHQRVLKSLEGKNNLEEKI 60
              P ++++P PAQGHV P+L+ +    + G     +  E+ H+R+  +L    + +  I
Sbjct: 4   TQRPKIILVPYPAQGHVTPMLKLASAFLSRGFEPVVITPEFIHRRISATL----DPKLGI 59

Query: 61  RLVSIPDGME--PWEDRNELGNKLKKILQVMPGNLEELIEEINEKEDEKIDCFIADAYMG 118
             +SI DG +  P  D   + N ++     MP  LE L+ +++  ED ++ C + D    
Sbjct: 60  TFMSISDGQDDDPPRDFFSIENSMENT---MPPQLERLLHKLD--EDGEVACMVVDLLAS 114

Query: 119 WTMRIAEKMKLRRGVVWPSSAASVALCFRIPKLIDDGIISSDG 161
           W + +A++  +     WP   A+  L   IP+L+  G+IS  G
Sbjct: 115 WAIGVADRCGVPVAGFWPVMLAAYRLIQAIPELVRTGLISETG 157

Length = 448
>gnl|CDD|215293 PLN02534, PLN02534, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|215465 PLN02863, PLN02863, UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|178170 PLN02555, PLN02555, limonoid glucosyltransferase Back     alignment and domain information
>gnl|CDD|178584 PLN03007, PLN03007, UDP-glucosyltransferase family protein Back     alignment and domain information
>gnl|CDD|177830 PLN02173, PLN02173, UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|178032 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|177813 PLN02152, PLN02152, indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>gnl|CDD|215247 PLN02448, PLN02448, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|215127 PLN02210, PLN02210, UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|178275 PLN02670, PLN02670, transferase, transferring glycosyl groups Back     alignment and domain information
>gnl|CDD|178572 PLN02992, PLN02992, coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>gnl|CDD|177807 PLN00414, PLN00414, glycosyltransferase family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 166
PLN02562 448 UDP-glycosyltransferase 99.94
PLN02410 451 UDP-glucoronosyl/UDP-glucosyl transferase family p 99.93
PLN02173 449 UDP-glucosyl transferase family protein 99.93
PLN02152 455 indole-3-acetate beta-glucosyltransferase 99.93
PLN02448 459 UDP-glycosyltransferase family protein 99.92
PLN02555 480 limonoid glucosyltransferase 99.92
PLN00164 480 glucosyltransferase; Provisional 99.92
PLN02863 477 UDP-glucoronosyl/UDP-glucosyl transferase family p 99.92
PLN02670 472 transferase, transferring glycosyl groups 99.92
PLN02210 456 UDP-glucosyl transferase 99.91
PLN02534 491 UDP-glycosyltransferase 99.91
PLN02207 468 UDP-glycosyltransferase 99.91
PLN02554 481 UDP-glycosyltransferase family protein 99.91
PLN03004 451 UDP-glycosyltransferase 99.9
PLN02992 481 coniferyl-alcohol glucosyltransferase 99.9
PLN00414 446 glycosyltransferase family protein 99.9
PLN03007 482 UDP-glucosyltransferase family protein 99.9
PLN02167 475 UDP-glycosyltransferase family protein 99.89
PLN02208 442 glycosyltransferase family protein 99.89
PLN03015 470 UDP-glucosyl transferase 99.89
PLN02764 453 glycosyltransferase family protein 99.88
cd03784 401 GT1_Gtf_like This family includes the Gtfs, a grou 99.78
TIGR01426 392 MGT glycosyltransferase, MGT family. This model de 99.73
PF03033139 Glyco_transf_28: Glycosyltransferase family 28 N-t 99.6
KOG1192 496 consensus UDP-glucuronosyl and UDP-glucosyl transf 99.29
PHA03392 507 egt ecdysteroid UDP-glucosyltransferase; Provision 99.2
COG1819 406 Glycosyl transferases, related to UDP-glucuronosyl 99.04
PF00201 500 UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera 98.96
PF13528 318 Glyco_trans_1_3: Glycosyl transferase family 1 98.89
TIGR00661 321 MJ1255 conserved hypothetical protein. This model 98.83
PRK12446 352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 98.57
COG0707 357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami 98.17
TIGR01133 348 murG undecaprenyldiphospho-muramoylpentapeptide be 98.08
PRK00726 357 murG undecaprenyldiphospho-muramoylpentapeptide be 98.02
cd03785 350 GT1_MurG MurG is an N-acetylglucosaminyltransferas 98.02
TIGR00215 385 lpxB lipid-A-disaccharide synthase. Lipid-A precur 97.93
PRK00025 380 lpxB lipid-A-disaccharide synthase; Reviewed 97.41
TIGR03590 279 PseG pseudaminic acid biosynthesis-associated prot 97.34
cd03816 415 GT1_ALG1_like This family is most closely related 97.33
cd03818 396 GT1_ExpC_like This family is most closely related 97.14
PF13477139 Glyco_trans_4_2: Glycosyl transferase 4-like 97.0
cd03800 398 GT1_Sucrose_synthase This family is most closely r 96.98
PF13579160 Glyco_trans_4_4: Glycosyl transferase 4-like domai 96.81
PRK02261137 methylaspartate mutase subunit S; Provisional 96.8
PRK13609 380 diacylglycerol glucosyltransferase; Provisional 96.72
PRK10307 412 putative glycosyl transferase; Provisional 96.72
COG4671 400 Predicted glycosyl transferase [General function p 96.67
cd03823 359 GT1_ExpE7_like This family is most closely related 96.61
PF04007 335 DUF354: Protein of unknown function (DUF354); Inte 96.59
PLN02871 465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 96.54
cd03794 394 GT1_wbuB_like This family is most closely related 96.53
cd03808 359 GT1_cap1E_like This family is most closely related 96.47
cd03814 364 GT1_like_2 This family is most closely related to 96.38
COG3980 318 spsG Spore coat polysaccharide biosynthesis protei 96.19
cd04962 371 GT1_like_5 This family is most closely related to 96.08
TIGR02470 784 sucr_synth sucrose synthase. This model represents 95.86
cd02067119 B12-binding B12 binding domain (B12-BD). This doma 95.77
PF12000171 Glyco_trans_4_3: Gkycosyl transferase family 4 gro 95.73
cd03805 392 GT1_ALG2_like This family is most closely related 95.65
cd03817 374 GT1_UGDG_like This family is most closely related 95.45
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 95.27
cd03796 398 GT1_PIG-A_like This family is most closely related 95.22
cd03819 355 GT1_WavL_like This family is most closely related 95.12
TIGR03449 405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino 95.03
PLN00142 815 sucrose synthase 94.92
TIGR02472 439 sucr_P_syn_N sucrose-phosphate synthase, putative, 94.88
cd03802 335 GT1_AviGT4_like This family is most closely relate 94.85
cd02070201 corrinoid_protein_B12-BD B12 binding domain of cor 94.71
TIGR02370197 pyl_corrinoid methyltransferase cognate corrinoid 94.23
PF08660170 Alg14: Oligosaccharide biosynthesis protein Alg14 94.06
cd04955 363 GT1_like_6 This family is most closely related to 93.88
cd03801 374 GT1_YqgM_like This family is most closely related 93.75
PF0214295 MGS: MGS-like domain This is a subfamily of this f 93.18
cd03820 348 GT1_amsD_like This family is most closely related 92.82
cd03812 358 GT1_CapH_like This family is most closely related 92.79
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 92.43
cd03795 357 GT1_like_4 This family is most closely related to 92.37
cd02069213 methionine_synthase_B12_BD B12 binding domain of m 91.78
PF13439177 Glyco_transf_4: Glycosyltransferase Family 4; PDB: 91.77
PLN02846 462 digalactosyldiacylglycerol synthase 91.23
cd01425193 RPS2 Ribosomal protein S2 (RPS2), involved in form 91.17
COG1817 346 Uncharacterized protein conserved in archaea [Func 91.15
PRK05749 425 3-deoxy-D-manno-octulosonic-acid transferase; Revi 90.94
PLN02275 371 transferase, transferring glycosyl groups 90.81
PRK13932257 stationary phase survival protein SurE; Provisiona 90.7
cd03825 365 GT1_wcfI_like This family is most closely related 90.66
cd04951 360 GT1_WbdM_like This family is most closely related 90.52
TIGR03568 365 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, 90.38
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 90.12
cd03786 363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th 90.06
PF02441129 Flavoprotein: Flavoprotein; InterPro: IPR003382 Th 89.79
PF02951119 GSH-S_N: Prokaryotic glutathione synthetase, N-ter 89.74
cd03798 377 GT1_wlbH_like This family is most closely related 89.53
COG1703 323 ArgK Putative periplasmic protein kinase ArgK and 89.26
cd03821 375 GT1_Bme6_like This family is most closely related 89.19
PRK00654 466 glgA glycogen synthase; Provisional 89.15
PRK10916 348 ADP-heptose:LPS heptosyltransferase II; Provisiona 88.95
COG2185143 Sbm Methylmalonyl-CoA mutase, C-terminal domain/su 88.32
PRK08506 472 replicative DNA helicase; Provisional 88.12
PRK14099 485 glycogen synthase; Provisional 87.97
cd02071122 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin 87.97
TIGR00236 365 wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras 87.88
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 87.29
COG2910211 Putative NADH-flavin reductase [General function p 86.54
PF02310121 B12-binding: B12 binding domain; InterPro: IPR0061 86.46
PRK05595444 replicative DNA helicase; Provisional 86.09
cd03811 353 GT1_WabH_like This family is most closely related 86.09
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 86.06
PRK01175 261 phosphoribosylformylglycinamidine synthase I; Prov 85.99
PRK08760476 replicative DNA helicase; Provisional 85.94
TIGR02095 473 glgA glycogen/starch synthases, ADP-glucose type. 85.6
smart0085190 MGS MGS-like domain. This domain composes the whol 85.55
PRK06321472 replicative DNA helicase; Provisional 85.4
cd03792 372 GT1_Trehalose_phosphorylase Trehalose phosphorylas 85.39
PRK08305196 spoVFB dipicolinate synthase subunit B; Reviewed 85.25
cd03806 419 GT1_ALG11_like This family is most closely related 85.21
TIGR00665434 DnaB replicative DNA helicase. This model describe 85.12
COG0381 383 WecB UDP-N-acetylglucosamine 2-epimerase [Cell env 84.87
cd03789 279 GT1_LPS_heptosyltransferase Lipopolysaccharide hep 84.84
COG1519 419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase 84.73
cd01423116 MGS_CPS_I_III Methylglyoxal synthase-like domain f 84.66
TIGR03492 396 conserved hypothetical protein. This protein famil 84.33
PF01975196 SurE: Survival protein SurE; InterPro: IPR002828 T 84.33
PRK10422 352 lipopolysaccharide core biosynthesis protein; Prov 84.13
TIGR02195 334 heptsyl_trn_II lipopolysaccharide heptosyltransfer 83.83
PRK01021 608 lpxB lipid-A-disaccharide synthase; Reviewed 83.75
PF04413186 Glycos_transf_N: 3-Deoxy-D-manno-octulosonic-acid 83.6
cd03791 476 GT1_Glycogen_synthase_DULL1_like This family is mo 83.08
cd01424110 MGS_CPS_II Methylglyoxal synthase-like domain from 83.03
PHA02542 473 41 41 helicase; Provisional 83.01
PRK12311 326 rpsB 30S ribosomal protein S2/unknown domain fusio 83.01
cd01635229 Glycosyltransferase_GTB_type Glycosyltransferases 82.97
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 82.6
cd03799 355 GT1_amsK_like This is a family of GT1 glycosyltran 80.93
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 80.18
>PLN02562 UDP-glycosyltransferase Back     alignment and domain information 
Probab=99.94  E-value=3e-25  Score=180.64  Aligned_cols=146  Identities=26%  Similarity=0.569  Sum_probs=115.8

Q ss_pred             CCEEEEEcCCCCCChHHHHHHHHHHHHCCCEEEEEeCCcchhHHHhhhccCCCCCCCeeeeecCCCCCCCcCchhHHHHH
Q 043556            3 NPHVLVIPAPAQGHVIPLLEFSQCLANHGVRVTFVNSEYNHQRVLKSLEGKNNLEEKIRLVSIPDGMEPWEDRNELGNKL   82 (166)
Q Consensus         3 ~~~il~~~~p~~GH~~P~l~la~~L~~rGh~Vt~~t~~~~~~~~~~~~~~~~~~~~~i~~~~l~~~~~~~~~~~~~~~~~   82 (166)
                      ++||+++|+|++||++||++||+.|++||++||++++..+..++.+...    ..++|++..+|++.+++. ..++..+.
T Consensus         6 ~~HVVlvPfPaqGHi~PmL~LAk~Las~G~~VT~vtt~~~~~~~~~~~~----~~~~i~~v~lp~g~~~~~-~~~~~~l~   80 (448)
T PLN02562          6 RPKIILVPYPAQGHVTPMLKLASAFLSRGFEPVVITPEFIHRRISATLD----PKLGITFMSISDGQDDDP-PRDFFSIE   80 (448)
T ss_pred             CcEEEEEcCccccCHHHHHHHHHHHHhCCCEEEEEeCcchhhhhhhccC----CCCCEEEEECCCCCCCCc-cccHHHHH
Confidence            4699999999999999999999999999999999999987655543211    113699999998765321 12343444


Q ss_pred             HHHHhhccHHHHHHHHHHhhcCCCCccEEEecCccchHHHHHHHhCCceEEEccccHHHHHHHhccchhhhCC
Q 043556           83 KKILQVMPGNLEELIEEINEKEDEKIDCFIADAYMGWTMRIAEKMKLRRGVVWPSSAASVALCFRIPKLIDDG  155 (166)
Q Consensus        83 ~~~~~~~~~~~~~ll~~l~~~~~~~~d~iI~D~~~~~~~~vA~~l~iP~i~~~~~~~~~~~~~~~~~~l~~~~  155 (166)
                      ..+...+.+.++++++++...  .+++|||+|.+++|+.++|+++|||++.||+++++.++.++|++.+...+
T Consensus        81 ~a~~~~~~~~l~~ll~~l~~~--~pv~cvI~D~~~~w~~~vA~~~giP~~~f~~~~a~~~~~~~~~~~~~~~~  151 (448)
T PLN02562         81 NSMENTMPPQLERLLHKLDED--GEVACMVVDLLASWAIGVADRCGVPVAGFWPVMLAAYRLIQAIPELVRTG  151 (448)
T ss_pred             HHHHHhchHHHHHHHHHhcCC--CCcEEEEECCccHhHHHHHHHhCCCEEEEechhHHHHHHHHHHHHHhhcc
Confidence            455546788899999887431  35699999999999999999999999999999999999999887654443

>PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02173 UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02152 indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>PLN02448 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02555 limonoid glucosyltransferase Back     alignment and domain information
>PLN00164 glucosyltransferase; Provisional Back     alignment and domain information
>PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02670 transferase, transferring glycosyl groups Back     alignment and domain information
>PLN02210 UDP-glucosyl transferase Back     alignment and domain information
>PLN02534 UDP-glycosyltransferase Back     alignment and domain information
>PLN02207 UDP-glycosyltransferase Back     alignment and domain information
>PLN02554 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN03004 UDP-glycosyltransferase Back     alignment and domain information
>PLN02992 coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>PLN00414 glycosyltransferase family protein Back     alignment and domain information
>PLN03007 UDP-glucosyltransferase family protein Back     alignment and domain information
>PLN02167 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02208 glycosyltransferase family protein Back     alignment and domain information
>PLN03015 UDP-glucosyl transferase Back     alignment and domain information
>PLN02764 glycosyltransferase family protein Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family Back     alignment and domain information
>PF03033 Glyco_transf_28: Glycosyltransferase family 28 N-terminal domain; InterPro: IPR004276 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>KOG1192 consensus UDP-glucuronosyl and UDP-glucosyl transferase [Carbohydrate transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule Back     alignment and domain information
>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 Back     alignment and domain information
>TIGR00661 MJ1255 conserved hypothetical protein Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>TIGR00215 lpxB lipid-A-disaccharide synthase Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF13477 Glyco_trans_4_2: Glycosyl transferase 4-like Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF13579 Glyco_trans_4_4: Glycosyl transferase 4-like domain; PDB: 3C4Q_B 3C4V_A 3C48_B 1Z2T_A Back     alignment and domain information
>PRK02261 methylaspartate mutase subunit S; Provisional Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>PRK10307 putative glycosyl transferase; Provisional Back     alignment and domain information
>COG4671 Predicted glycosyl transferase [General function prediction only] Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>PF12000 Glyco_trans_4_3: Gkycosyl transferase family 4 group; InterPro: IPR022623 This presumed domain is functionally uncharacterised and found in bacteria Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>PLN00142 sucrose synthase Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins Back     alignment and domain information
>TIGR02370 pyl_corrinoid methyltransferase cognate corrinoid proteins, Methanosarcina family Back     alignment and domain information
>PF08660 Alg14: Oligosaccharide biosynthesis protein Alg14 like; InterPro: IPR013969 Alg14 is involved dolichol-linked oligosaccharide biosynthesis and anchors the catalytic subunit Alg13 to the ER membrane [] Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>PF02142 MGS: MGS-like domain This is a subfamily of this family; InterPro: IPR011607 This domain composes the whole protein of methylglyoxal synthetase and the domain is also found in carbamoyl phosphate synthetase (CPS) where it forms a regulatory domain that binds to the allosteric effector ornithine Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd02069 methionine_synthase_B12_BD B12 binding domain of methionine synthase Back     alignment and domain information
>PF13439 Glyco_transf_4: Glycosyltransferase Family 4; PDB: 2JJM_E 3MBO_C 2GEJ_A 2GEK_A Back     alignment and domain information
>PLN02846 digalactosyldiacylglycerol synthase Back     alignment and domain information
>cd01425 RPS2 Ribosomal protein S2 (RPS2), involved in formation of the translation initiation complex, where it might contact the messenger RNA and several components of the ribosome Back     alignment and domain information
>COG1817 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>PLN02275 transferase, transferring glycosyl groups Back     alignment and domain information
>PRK13932 stationary phase survival protein SurE; Provisional Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>PF02441 Flavoprotein: Flavoprotein; InterPro: IPR003382 This entry contains a diverse range of flavoprotein enzymes, including epidermin biosynthesis protein, EpiD, which has been shown to be a flavoprotein that binds FMN [] Back     alignment and domain information
>PF02951 GSH-S_N: Prokaryotic glutathione synthetase, N-terminal domain; InterPro: IPR004215 Prokaryotic glutathione synthetase 6 Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>PRK10916 ADP-heptose:LPS heptosyltransferase II; Provisional Back     alignment and domain information
>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK14099 glycogen synthase; Provisional Back     alignment and domain information
>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain Back     alignment and domain information
>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin) Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK01175 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type Back     alignment and domain information
>smart00851 MGS MGS-like domain Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>PRK08305 spoVFB dipicolinate synthase subunit B; Reviewed Back     alignment and domain information
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03789 GT1_LPS_heptosyltransferase Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS) Back     alignment and domain information
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01423 MGS_CPS_I_III Methylglyoxal synthase-like domain found in pyr1 and URA1-like carbamoyl phosphate synthetases (CPS), including ammonia-dependent CPS Type I, and glutamine-dependent CPS Type III Back     alignment and domain information
>TIGR03492 conserved hypothetical protein Back     alignment and domain information
>PF01975 SurE: Survival protein SurE; InterPro: IPR002828 This entry represents a SurE-like structural domain with a 3-layer alpha/bete/alpha topology that bears some topological similarity to the N-terminal domain of the glutaminase/asparaginase family Back     alignment and domain information
>PRK10422 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>TIGR02195 heptsyl_trn_II lipopolysaccharide heptosyltransferase II Back     alignment and domain information
>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>PF04413 Glycos_transf_N: 3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase); InterPro: IPR007507 This is a domain found in proteins that transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd01424 MGS_CPS_II Methylglyoxal synthase-like domain from type II glutamine-dependent carbamoyl phosphate synthetase (CSP) Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>PRK12311 rpsB 30S ribosomal protein S2/unknown domain fusion protein; Provisional Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
2pq6_A 482 Crystal Structure Of Medicago Truncatula Ugt85h2- I 2e-16
2vce_A 480 Characterization And Engineering Of The Bifunctiona 9e-06
>pdb|2PQ6|A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase Length = 482 Back     alignment and structure 
Iteration: 1

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 77/161 (47%), Gaps = 8/161 (4%)
Query: 4   PHVLVIPAPAQGHVIPLLEFSQCLANHGVRVTFVNSEYNHQRVLKSLEGKNNLE--EKIR 61
           PHV++IP P QGH+ PL + ++ L   G  +TFVN+EYNH+R+LKS  G    +      
Sbjct: 9   PHVVMIPYPVQGHINPLFKLAKLLHLRGFHITFVNTEYNHKRLLKS-RGPKAFDGFTDFN 67
Query: 62  LVSIPDGMEPWEDRNELGNKLKKILQ-----VMPGXXXXXXXXXXXXXXXXXXCFIADAY 116
             SIPDG+ P E   ++   +  + Q      +                    C ++D  
Sbjct: 68  FESIPDGLTPMEGDGDVSQDVPTLCQSVRKNFLKPYCELLTRLNHSTNVPPVTCLVSDCC 127
Query: 117 MGWTMRIAEKMKLRRGVVWPSSAASVALCFRIPKLIDDGII 157
           M +T++ AE+ +L   + + SSA S+         ++ GII
Sbjct: 128 MSFTIQAAEEFELPNVLYFSSSACSLLNVMHFRSFVERGII 168
>pdb|2VCE|A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants Length = 480 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
2pq6_A 482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 5e-52
2c1x_A 456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 2e-46
3hbf_A 454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 1e-45
2acv_A 463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 6e-38
2vch_A 480 Hydroquinone glucosyltransferase; glycosyltransfer 5e-36
2iyf_A 430 OLED, oleandomycin glycosyltransferase; antibiotic 1e-10
2iya_A 424 OLEI, oleandomycin glycosyltransferase; carbohydra 3e-09
3ia7_A 402 CALG4; glycosysltransferase, calicheamicin, enediy 2e-08
3rsc_A 415 CALG2; TDP, enediyne, structural genomics, PSI-2, 1e-07
3oti_A 398 CALG3; calicheamicin, TDP, structural genomics, PS 3e-04
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Length = 482 Back     alignment and structure
 Score =  171 bits (435), Expect = 5e-52
 Identities = 50/165 (30%), Positives = 81/165 (49%), Gaps = 6/165 (3%)

Query: 4   PHVLVIPAPAQGHVIPLLEFSQCLANHGVRVTFVNSEYNHQRVLKSL-EGKNNLEEKIRL 62
           PHV++IP P QGH+ PL + ++ L   G  +TFVN+EYNH+R+LKS      +       
Sbjct: 9   PHVVMIPYPVQGHINPLFKLAKLLHLRGFHITFVNTEYNHKRLLKSRGPKAFDGFTDFNF 68

Query: 63  VSIPDGMEPWEDRNELGNKLKKILQ----VMPGNLEELIEEINE-KEDEKIDCFIADAYM 117
            SIPDG+ P E   ++   +  + Q           EL+  +N       + C ++D  M
Sbjct: 69  ESIPDGLTPMEGDGDVSQDVPTLCQSVRKNFLKPYCELLTRLNHSTNVPPVTCLVSDCCM 128

Query: 118 GWTMRIAEKMKLRRGVVWPSSAASVALCFRIPKLIDDGIISSDGN 162
            +T++ AE+ +L   + + SSA S+         ++ GII     
Sbjct: 129 SFTIQAAEEFELPNVLYFSSSACSLLNVMHFRSFVERGIIPFKDE 173
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Length = 456 Back     alignment and structure
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} PDB: 3hbj_A* Length = 454 Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Length = 463 Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Length = 480 Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Length = 430 Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Length = 424 Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Length = 402 Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Length = 415 Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Length = 398 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query166
3hbf_A 454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 99.94
2pq6_A 482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 99.93
2acv_A 463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 99.89
2vch_A 480 Hydroquinone glucosyltransferase; glycosyltransfer 99.88
2c1x_A 456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 99.87
2iya_A 424 OLEI, oleandomycin glycosyltransferase; carbohydra 99.83
4amg_A 400 Snogd; transferase, polyketide biosynthesis, GT1 f 99.74
3ia7_A 402 CALG4; glycosysltransferase, calicheamicin, enediy 99.72
1iir_A 415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 99.69
2iyf_A 430 OLED, oleandomycin glycosyltransferase; antibiotic 99.69
3rsc_A 415 CALG2; TDP, enediyne, structural genomics, PSI-2, 99.65
1rrv_A 416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 99.62
2yjn_A 441 ERYCIII, glycosyltransferase; transferase, cytochr 99.61
2p6p_A 384 Glycosyl transferase; X-RAY-diffraction,urdamycina 99.55
3oti_A 398 CALG3; calicheamicin, TDP, structural genomics, PS 99.55
3h4t_A 404 Glycosyltransferase GTFA, glycosyltransferase; van 99.51
4fzr_A 398 SSFS6; structural genomics, PSI-biology, protein s 99.49
3tsa_A 391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 99.45
3otg_A 412 CALG1; calicheamicin, TDP, structural genomics, PS 99.37
3s2u_A 365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 99.14
1f0k_A 364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 98.61
3c48_A 438 Predicted glycosyltransferases; retaining glycosyl 97.39
3fro_A 439 GLGA glycogen synthase; glycosyltransferase family 97.38
2r60_A 499 Glycosyl transferase, group 1; rossmann-fold; 1.80 97.23
3okp_A 394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino 96.75
2jjm_A 394 Glycosyl transferase, group 1 family protein; anth 96.29
1v4v_A 376 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t 96.22
2gek_A 406 Phosphatidylinositol mannosyltransferase (PIMA); G 95.98
2iuy_A 342 Avigt4, glycosyltransferase; antibiotics, family G 95.8
3beo_A 375 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a 95.64
1vgv_A 384 UDP-N-acetylglucosamine 2-epimerase; structural ge 95.58
3dzc_A 396 UDP-N-acetylglucosamine 2-epimerase; structural ge 95.54
3ot5_A 403 UDP-N-acetylglucosamine 2-epimerase; structural ge 95.37
2x6q_A 416 Trehalose-synthase TRET; biosynthetic protein; 2.2 94.74
1psw_A 348 ADP-heptose LPS heptosyltransferase II; structural 94.45
1ccw_A137 Protein (glutamate mutase); coenzyme B12, radical 94.35
3s28_A 816 Sucrose synthase 1; glycosyltransferase, sucrose m 94.03
2yxb_A161 Coenzyme B12-dependent mutase; alpha/beta, structu 93.41
2x0d_A 413 WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge 92.71
2iw1_A 374 Lipopolysaccharide core biosynthesis protein RFAG; 92.65
3vue_A 536 GBSS-I, granule-bound starch synthase 1, chloropla 92.12
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 91.46
3hbm_A 282 UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter je 91.33
1rzu_A 485 Glycogen synthase 1; glycosyl-transferase, GT-B fo 91.18
2hy7_A 406 Glucuronosyltransferase GUMK; glycosyltransferases 91.16
2qzs_A 485 Glycogen synthase; glycosyl-transferase, GT-B fold 90.93
3tov_A 349 Glycosyl transferase family 9; structural genomics 90.58
4hwg_A 385 UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc 89.83
3zqu_A209 Probable aromatic acid decarboxylase; lyase; HET: 88.76
1y80_A210 Predicted cobalamin binding protein; corrinoid, fa 88.63
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 87.97
2i2x_B258 MTAC, methyltransferase 1; TIM barrel and helix bu 87.43
1id1_A153 Putative potassium channel protein; RCK domain, E. 87.08
3qjg_A175 Epidermin biosynthesis protein EPID; structural ge 86.47
3ezx_A215 MMCP 1, monomethylamine corrinoid protein 1; N ter 86.04
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 85.79
1mvl_A209 PPC decarboxylase athal3A; flavoprotein, active si 83.92
1sbz_A197 Probable aromatic acid decarboxylase; FMN binding, 83.9
3lqk_A201 Dipicolinate synthase subunit B; flavoprotein, PSI 83.2
2ejb_A189 Probable aromatic acid decarboxylase; phenylacryli 82.19
3mcu_A207 Dipicolinate synthase, B chain; NESG, structural g 81.89
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 81.63
1g63_A181 Epidermin modifying enzyme EPID; alpha, beta prote 81.57
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 80.84
3qxc_A242 Dethiobiotin synthetase; DTBS, structural genomics 80.45
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A* Back     alignment and structure
Probab=99.94  E-value=1.5e-26  Score=187.63  Aligned_cols=149  Identities=19%  Similarity=0.343  Sum_probs=112.8

Q ss_pred             CCEEEEEcCCCCCChHHHHHHHHHHHHCC--CEEEEEeCCcchhHHHhhhccCCCCCCCeeeeecCCCCCCCc-CchhHH
Q 043556            3 NPHVLVIPAPAQGHVIPLLEFSQCLANHG--VRVTFVNSEYNHQRVLKSLEGKNNLEEKIRLVSIPDGMEPWE-DRNELG   79 (166)
Q Consensus         3 ~~~il~~~~p~~GH~~P~l~la~~L~~rG--h~Vt~~t~~~~~~~~~~~~~~~~~~~~~i~~~~l~~~~~~~~-~~~~~~   79 (166)
                      +.||+++|+|++||++||++||+.|++||  +.||+++++....++.+..   ....++|+|..+|++++++. ...+..
T Consensus        13 ~~hvv~~P~p~~GHi~P~l~Lak~L~~~g~~~~vT~~~t~~~~~~~~~~~---~~~~~~i~~~~ipdglp~~~~~~~~~~   89 (454)
T 3hbf_A           13 LLHVAVLAFPFGTHAAPLLSLVKKIATEAPKVTFSFFCTTTTNDTLFSRS---NEFLPNIKYYNVHDGLPKGYVSSGNPR   89 (454)
T ss_dssp             CCEEEEECCCSSSSHHHHHHHHHHHHHHCTTSEEEEEECHHHHHHSCSSS---SCCCTTEEEEECCCCCCTTCCCCSCTT
T ss_pred             CCEEEEEcCCcccHHHHHHHHHHHHHhCCCCEEEEEEeCHHHHHhhhccc---ccCCCCceEEecCCCCCCCccccCChH
Confidence            68999999999999999999999999999  9999999976554442211   01135799999999887652 112222


Q ss_pred             HHHHHHHhhccHHHHHHHHHHhhcCCCCccEEEecCccchHHHHHHHhCCceEEEccccHHHHHHHhccchhhhC
Q 043556           80 NKLKKILQVMPGNLEELIEEINEKEDEKIDCFIADAYMGWTMRIAEKMKLRRGVVWPSSAASVALCFRIPKLIDD  154 (166)
Q Consensus        80 ~~~~~~~~~~~~~~~~ll~~l~~~~~~~~d~iI~D~~~~~~~~vA~~l~iP~i~~~~~~~~~~~~~~~~~~l~~~  154 (166)
                      ..+..+.+.+.+.+++.++++.++...++||||+|.+++|+.++|+++|||++.||+++++.+++++|++.+.++
T Consensus        90 ~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~iI~D~~~~w~~~vA~~lgIP~~~f~t~~a~~~~~~~~~~~~~~~  164 (454)
T 3hbf_A           90 EPIFLFIKAMQENFKHVIDEAVAETGKNITCLVTDAFFWFGADLAEEMHAKWVPLWTAGPHSLLTHVYTDLIREK  164 (454)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEETTCTTHHHHHHHTTCEEEEEECSCHHHHHHHHTHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhcCCCCcEEEECCcchHHHHHHHHhCCCEEEEeCccHHHHHHHHhhHHHHhh
Confidence            223333334444566666654322125799999999999999999999999999999999999999999887654
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Back     alignment and structure
>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} SCOP: c.87.1.5 PDB: 3h4i_A* 1pn3_A* 1pnv_A* Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Back     alignment and structure
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Back     alignment and structure
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Back     alignment and structure
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Back     alignment and structure
>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Back     alignment and structure
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A Back     alignment and structure
>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* Back     alignment and structure
>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae} Back     alignment and structure
>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes} Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Back     alignment and structure
>1psw_A ADP-heptose LPS heptosyltransferase II; structural genomics, NYSGXRC, LPS biosynthetic pathway, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.87.1.7 Back     alignment and structure
>1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* Back     alignment and structure
>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* Back     alignment and structure
>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* Back     alignment and structure
>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Back     alignment and structure
>3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A* Back     alignment and structure
>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A Back     alignment and structure
>2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A* Back     alignment and structure
>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A Back     alignment and structure
>3tov_A Glycosyl transferase family 9; structural genomics, PSI-BIOL protein structure initiative, midwest center for structural genomics, MCSG; 2.98A {Veillonella parvula} Back     alignment and structure
>4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii} Back     alignment and structure
>3zqu_A Probable aromatic acid decarboxylase; lyase; HET: FNR; 1.50A {Pseudomonas aeruginosa} SCOP: c.34.1.0 Back     alignment and structure
>1y80_A Predicted cobalamin binding protein; corrinoid, factor IIIM, methyl transferase, structural genomics, PSI, protein structure initiative; HET: B1M; 1.70A {Moorella thermoacetica} Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>2i2x_B MTAC, methyltransferase 1; TIM barrel and helix bundle (MTAB), rossman fold and helix B (MTAC); HET: B13; 2.50A {Methanosarcina barkeri} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3qjg_A Epidermin biosynthesis protein EPID; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: FMN; 2.04A {Staphylococcus aureus} SCOP: c.34.1.0 Back     alignment and structure
>3ezx_A MMCP 1, monomethylamine corrinoid protein 1; N terminal all helical bundle C terminal rossmann fold, cobalt, metal-binding; HET: HCB; 2.56A {Methanosarcina barkeri} Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>1mvl_A PPC decarboxylase athal3A; flavoprotein, active site mutant C175S; HET: FMN; 2.00A {Arabidopsis thaliana} SCOP: c.34.1.1 PDB: 1mvn_A* 1e20_A* Back     alignment and structure
>1sbz_A Probable aromatic acid decarboxylase; FMN binding, PAD1, UBIX, montreal-kingston bacterial structu genomics initiative, BSGI; HET: FMN; 2.00A {Escherichia coli} SCOP: c.34.1.1 Back     alignment and structure
>3lqk_A Dipicolinate synthase subunit B; flavoprotein, PSI2, MCSG, structural protein structure initiative, midwest center for structural genomics; 2.10A {Bacillus halodurans} Back     alignment and structure
>2ejb_A Probable aromatic acid decarboxylase; phenylacrylic acid decarboxylase, X-RAY diffraction, structural genomics, NPPSFA; 2.15A {Aquifex aeolicus} Back     alignment and structure
>3mcu_A Dipicolinate synthase, B chain; NESG, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Bacillus cereus} Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>1g63_A Epidermin modifying enzyme EPID; alpha, beta protein, rossmann like fold, oxidoreductase; HET: FMN; 2.50A {Staphylococcus epidermidis} SCOP: c.34.1.1 PDB: 1g5q_A* Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>3qxc_A Dethiobiotin synthetase; DTBS, structural genomics, ATP BIND biology, protein structure initiative, midwest center for S genomics, MCSG; HET: ATP; 1.34A {Helicobacter pylori} PDB: 3mle_A* 3qxh_A* 3qxj_A* 3qxs_A* 3qxx_A* 3qy0_A* 2qmo_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 166
d2c1xa1 450 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-gluc 2e-29
d2pq6a1 473 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransfe 4e-28
d2acva1 461 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transf 1e-24
d2vcha1 471 c.87.1.10 (A:6-476) Hydroquinone glucosyltransfera 8e-22
d1rrva_ 401 c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Am 2e-11
d1iira_ 401 c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycol 1e-10
d1pn3a_ 391 c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA 4e-10
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Length = 450 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: UDPGT-like
domain: UDP glucose:flavonoid 3-o-glucosyltransferase
species: Grape (Vitis vinifera) [TaxId: 29760]

 Score =  109 bits (273), Expect = 2e-29
 Identities = 29/160 (18%), Positives = 64/160 (40%), Gaps = 5/160 (3%)

Query: 3   NPHVLVIPAPAQGHVIPLLEFSQCLANHGVRVTFV--NSEYNHQRVLKSLEGKNNLEEKI 60
           NPHV V+  P   H  PLL   + LA       F   ++  ++  +       + ++  I
Sbjct: 1   NPHVAVLAFPFSTHAAPLLAVVRRLAAAAPHAVFSFFSTSQSNASIFHD--SMHTMQCNI 58

Query: 61  RLVSIPDGM-EPWEDRNELGNKLKKILQVMPGNLEELIEEINEKEDEKIDCFIADAYMGW 119
           +   I DG+ E +         ++   +  P +  + +     +    + C +ADA++ +
Sbjct: 59  KSYDISDGVPEGYVFAGRPQEDIELFTRAAPESFRQGMVMAVAETGRPVSCLVADAFIWF 118

Query: 120 TMRIAEKMKLRRGVVWPSSAASVALCFRIPKLIDDGIISS 159
              +A +M +     W +   S++    I ++ +   +S 
Sbjct: 119 AADMAAEMGVAWLPFWTAGPNSLSTHVYIDEIREKIGVSG 158
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Length = 473 Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Length = 461 Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 471 Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Length = 391 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query166
d2c1xa1 450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 99.83
d2acva1 461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 99.83
d2pq6a1 473 (Iso)flavonoid glycosyltransferase {Medicago trunc 99.81
d2vcha1 471 Hydroquinone glucosyltransferase {Thale cress (Ara 99.78
d1pn3a_ 391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 99.63
d1rrva_ 401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 99.6
d1iira_ 401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 99.52
d1f0ka_ 351 Peptidoglycan biosynthesis glycosyltransferase Mur 98.43
d2bisa1 437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 96.91
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 96.07
d1rzua_ 477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 95.59
d2iw1a1 370 Lipopolysaccharide core biosynthesis protein RfaG 93.29
d1o6ca_ 377 UDP-N-acetylglucosamine 2-epimerase {Bacillus subt 91.31
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 90.37
d2qy9a2211 GTPase domain of the signal recognition particle r 88.81
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 88.39
d1f6da_ 376 UDP-N-acetylglucosamine 2-epimerase {Escherichia c 88.11
d3bula2156 Methionine synthase, C-terminal domain {Escherichi 87.21
d1a9xa2138 Carbamoyl phosphate synthetase, large subunit allo 85.08
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 84.12
d1ep3b2160 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 84.1
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 83.89
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 83.65
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 82.28
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 82.22
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 80.37
d1pswa_ 348 ADP-heptose LPS heptosyltransferase II {Escherichi 80.08
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: UDPGT-like
domain: UDP glucose:flavonoid 3-o-glucosyltransferase
species: Grape (Vitis vinifera) [TaxId: 29760]

Probab=99.83  E-value=1.8e-20  Score=147.77  Aligned_cols=143  Identities=19%  Similarity=0.296  Sum_probs=97.0

Q ss_pred             CCEEEEEcCCCCCChHHHHHHHHHHHHCCCEEEEEeCCcchhHHHhhhccC-CCCCCCeeeeecCCCCCCCc-Cch----
Q 043556            3 NPHVLVIPAPAQGHVIPLLEFSQCLANHGVRVTFVNSEYNHQRVLKSLEGK-NNLEEKIRLVSIPDGMEPWE-DRN----   76 (166)
Q Consensus         3 ~~~il~~~~p~~GH~~P~l~la~~L~~rGh~Vt~~t~~~~~~~~~~~~~~~-~~~~~~i~~~~l~~~~~~~~-~~~----   76 (166)
                      .+||+++|+|++||++|++.||++|++|||+||+++.......... .... ......+++..++++++... ...    
T Consensus         1 ~~hvl~~p~P~~gH~~p~l~la~~L~~rGH~Vt~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   79 (450)
T d2c1xa1           1 NPHVAVLAFPFSTHAAPLLAVVRRLAAAAPHAVFSFFSTSQSNASI-FHDSMHTMQCNIKSYDISDGVPEGYVFAGRPQE   79 (450)
T ss_dssp             CCEEEEECCCSSSSHHHHHHHHHHHHHHCTTSEEEEEECHHHHHHH-C-------CTTEEEEECCCCCCTTCCCCCCTTH
T ss_pred             CCEEEEECchhHhHHHHHHHHHHHHHHCCCcEEEEEccCccchhhh-hcccccccCCCceeeecCCCCCcchhhccchHH
Confidence            3799999999999999999999999999999999875433222111 1110 11234678888887775432 111    


Q ss_pred             hHHHHHHHHHhhccHHHHHHHHHHhhcCCCCccEEEecCccchHHHHHHHhCCceEEEccccHHHHHHHhccch
Q 043556           77 ELGNKLKKILQVMPGNLEELIEEINEKEDEKIDCFIADAYMGWTMRIAEKMKLRRGVVWPSSAASVALCFRIPK  150 (166)
Q Consensus        77 ~~~~~~~~~~~~~~~~~~~ll~~l~~~~~~~~d~iI~D~~~~~~~~vA~~l~iP~i~~~~~~~~~~~~~~~~~~  150 (166)
                      .+..+.........+.+.+++..   . ..++|+||+|.+..|+..+|+++|+|++.++++++...+....++.
T Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~---~-~~~~Dlvi~D~~~~~~~~~a~~~~~p~v~~~~~~~~~~~~~~~~~~  149 (450)
T d2c1xa1          80 DIELFTRAAPESFRQGMVMAVAE---T-GRPVSCLVADAFIWFAADMAAEMGVAWLPFWTAGPNSLSTHVYIDE  149 (450)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHH---H-TCCCCEEEEETTSTTHHHHHHHHTCEEEEEECSCHHHHHHHHTHHH
T ss_pred             HHHHHHHHHHHHhHHHHHHHHHh---C-CCCCeEEEECCccHHHHHHHHHhCCCEEEEecCchhhhhhhhcccc
Confidence            12222222222222233333332   2 2689999999999999999999999999999999998887766654
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bula2 c.23.6.1 (A:741-896) Methionine synthase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa2 c.24.1.1 (A:936-1073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pswa_ c.87.1.7 (A:) ADP-heptose LPS heptosyltransferase II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure