Citrus Sinensis ID: 043567


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-
MKGYCFAMESTSFIKLSLISSVILMVVLNQMHGYKACLKTERAALSEIKSFFIPFMDTQYEDPVLATWVDDGGMSSDCCNWKGVRCNATTGRVIQLLLNDTSKFIEYSKNYTYGDMVLSLNVSLFHPFEELQSLDLSNNSFEGVYENQAYDTLGSLKRLKILNLGYNYFDDSIFLYLNALTSLTTLILRENNIQGSRTKQGLSKLKNLEALDLSSNFINGSLESQGICELKNLFVLNLEKNNIEDHLPNCLNNMTRLKVLDISFNQLSGSFPSIISNLTSLEYLALFDNNFEGTFPLSSLANHSKLEVLLLSTRNNMLQVQTENFLPTFQLKVLRLPNCSLNVIPPFLLHQFDLKYLDLSHNDLDGAFPTWALQNNTKLEVLLLTNNSFTGNLQLPDDKHDFLHHLDISSNNFTGKLPQDMGIILQKLLYMDMSNNHFEGNIASSIAEMKELRFLDLSKNNFSGELSAALLTSCFSLLWLGLSDNNFYGRIFPGYMNLTQLQYLYLENNKFSGKIEEGLLKSKKLVELRMSSNMLSGHIPHWMGNLSYLEVLLMSKNFFEGNIPVQLLNHRRLQLFSVSENYLSGFMTTSFNISSVEHLYLQKNSLSGPIPIALFRSSNLLTLDLRDNGFSGVIPHQINECSNLRFLLLRGNNLEGQIPNQICQLTGLGMMDLSHNKFNGSIPSCFTNITLWSVGNLDRYRLEHLTFVERLDVNSIGIYYSSMLDMGQLSSEERGPFTFDYLVEVEFVTKNRYEVYNGSNLDYMVGLDLSCNKLTGEIPSEIGELQEIPVLNMSHNFLSESIPESFSNLKMIESLDLSHNRLSGQIPPKLTELNFLSNFNVSYNNLSGLIPDKGQFATFDESSYRGNLHLCGPTINKSCNGVEEIPATDSNREEGDDSAIDMVSLFWSFCA
cccEEEEEcHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEccccccEEEEEcccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccHHHHcccccccEEEccccccccccccccccccccccEEEccccccccccHHHHccccccEEEccccccccccccccccccccccEEEccccccEEEccccccccccccEEEcccccccEEccccHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHHccccccEEEccccEEEEEccccccccccccEEEccccccEEcccccccccccccEEEcccccccccccccccccccccEEEccccccEEcccccccccccccEEEccccccEEEcccccccccccEEEccccccEEcccHHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEccEEEEccccccccEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEEcccccEEEEEEccccccccccccHHcccccccccccHHHcccccccEEEccccccccccccHcHHHHcccccccEEEcccccccccccHHHccccccEEEEEccccccccccHHHHcccccccEEEcccccccccccHHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEEccccccccccHHHcccccHEEEEEccccccccccHHHcccccccEEEcccccccccccHHHHcccccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHHHHcccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHccccccEEEEcccccccccccccccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHHcccccEEEEcccccccccccHHHcccccccEEEccccccccccccccccHHHHHHcccccccccccccccccccccccEEEHHHccccccccHHHcccccEEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHHccHHHcccccEEEccccccccccccccccccccccccccccccHHEEEEEEEc
MKGYCFAMESTSFIKLSLISSVILMVVLNQMHGYKACLKTERAALSEIKsffipfmdtqyedpvlatwvddggmssdccnwkgvrcnatTGRVIQLLLNDTSkfieysknytygdMVLSLnvslfhpfeelqsldlsnnsfegvyenqaydtlgsLKRLKILNlgynyfddSIFLYLNALTSLTTLILRenniqgsrtkqglsklknlealdlssnfingslesqgicelkNLFVLNleknniedhlpnclnnmtRLKVLDISfnqlsgsfpsiISNLTSLEYLALfdnnfegtfplsslanhsKLEVLLLSTRNNMLQVQTENFLPTFQlkvlrlpncslnvippfllhqfdlkyldlshndldgafptwalqnntKLEVLLLTNnsftgnlqlpddkhdflhhldissnnftgklpqDMGIILQKLLYMDmsnnhfegNIASSIAEMKELRFLDLSKNNFSGELSAALLTSCFSLLWlglsdnnfygrifpgymnltQLQYLYLENNKFSGKIEEGLLKSKKLVELRMSSnmlsghiphwmGNLSYLEVLLMSKnffegnipvqLLNHRRLQLFSVSENYLSGFMTTSFNISSVEHLYLQknslsgpipialfrssnlltldlrdngfsgviphqinecSNLRFLLLRgnnlegqipnqicqltglgmmdlshnkfngsipscftnitlwsvgnldryrleHLTFVERLDVNSIGIYYSSmldmgqlsseergpftFDYLVEVEFVTKnryevyngsnldyMVGLDLSCnkltgeipseigelqeipvlnmshnflsesipesfsnlKMIESLDlshnrlsgqippkltelnfLSNFNVSynnlsglipdkgqfatfdessyrgnlhlcgptinkscngveeipatdsnreegddsAIDMVSLFWSFCA
MKGYCFAMESTSFIKLSLISSVILMVVLNQMHGYKACLKTERAALSEIKSFFIPFMDTQYEDPVLATWVDDGGMSSDCCNWKGVRCNATTGRVIQLLLNDTSKFIEYSKNYTYGDMVLSLNVSLFHPFEELQSLDLSNNSFEGVYENQAYDTLGSLKRLKILNLGYNYFDDSIFLYLNALTSLTTLILRenniqgsrtkqglsKLKNLEALDLSSNFINGSLESQGICELKNLFVLNLEKNNIEDHLPNCLNNMTRLKVLDISFNQLSGSFPSIISNLTSLEYLALFDNNFEGTFPLSSLANHSKLEVLLLSTRNNMLQVQTENFLPTFQLKVLRLPNCSLNVIPPFLLHQFDLKYLDLSHNDLDGAFPTWALQNNTKLEVLLLTNNSFTGNLQLPDDKHDFLHHLDIssnnftgklpQDMGIILQKLLYMDMSNNHFEGNIASSIAEMKELRFLDLSKNNFSGELSAALLTSCFSLLWLGLSDNNFYGRIFPGYMNLTQLQYLYLENNKFSGKIEEGLLKSKKLVELRMSSNMLSGHIPHWMGNLSYLEVLLMSKNFFEGNIPVQLLNHRRLQLFSVSENYLSGFMTTSFNISSVEHLYLQKNSLSGPIPIALFRSSNLLTLDLRDNGFSGVIPHQINECSNLRFLLLRGNNLEGQIPNQICQLTGLGMMDLSHNKFNGSIPSCFTNITLWSVGNLDRYRLEHLTFVERLDVNSIGIYYSSMLDMGQLSSEERGPFTFDYLVEVEFVTKNRYEVYNGSNLDYMVGLDLSCNKLTGEIPSEIGELQEIPVLNMSHNFLSESIPESFSNLKMIESLDLSHNRLSGQIPPKLTELNFLSNFNVSYNNLSGLIPDKGQFATFDESSYRGNLHLCGPTINKSCNGVEEIPatdsnreegddsAIDMVSLFWSFCA
MKGYCFAMESTSFIKLSLISSVILMVVLNQMHGYKACLKTERAALSEIKSFFIPFMDTQYEDPVLATWVDDGGMSSDCCNWKGVRCNATTGRVIQLLLNDTSKFIEYSKNYTYGDMVLSLNVSLFHPFEELQSLDLSNNSFEGVYENQAYDTLGSLKRLKILNLGYNYFDDSIFLYLNALTSLTTLILRENNIQGSRTKQGLSKLKNLEALDLSSNFINGSLESQGICELKNLFVLNLEKNNIEDHLPNCLNNMTRLKVLDISFNQLSGSFPSIISNLTSLEYLALFDNNFEGTFPLSSLANHSKLEVLLLSTRNNMLQVQTENFLPTFQLKVLRLPNCSLNVIPPFLLHQFDLKYLDLSHNDLDGAFPTWALQNNTKLEVLLLTNNSFTGNLQLPDDKHDFLHHLDISSNNFTGKLPQDMGIILQKLLYMDMSNNHFEGNIASSIAEMKELRFLDLSKNNFSGELSAALLTSCFSLLWLGLSDNNFYGRIFPGYMNLTQLQYLYLENNKFSGKIEEGLLKSKKLVELRMSSNMLSGHIPHWMGNLSYLEVLLMSKNFFEGNIPVQLLNHRRLQLFSVSENYLSGFMTTSFNISSVEHLYLQKNSLSGPIPIALFRSSNLLTLDLRDNGFSGVIPHQINECSnlrflllrgnnlEGQIPNQICQLTGLGMMDLSHNKFNGSIPSCFTNITLWSVGNLDRYRLEHLTFVERLDVNSIGIYYSSMLDMGQLSSEERGPFTFDYLVEVEFVTKNRYEVYNGSNLDYMVGLDLSCNKLTGEIPSEIGELQEIPVLNMSHNFLSESIPESFSNLKMIESLDLSHNRLSGQIPPKLTELNFLSNFNVSYNNLSGLIPDKGQFATFDESSYRGNLHLCGPTINKSCNGVEEIPATDSNREEGDDSAIDMVSLFWSFCA
***YCFAMESTSFIKLSLISSVILMVVLNQMHGYKACLKTERAALSEIKSFFIPFMDTQYEDPVLATWVDDGGMSSDCCNWKGVRCNATTGRVIQLLLNDTSKFIEYSKNYTYGDMVLSLNVSLFHPFEELQSLDLSNNSFEGVYENQAYDTLGSLKRLKILNLGYNYFDDSIFLYLNALTSLTTLILRENNIQ**********LKNLEALDLSSNFINGSLESQGICELKNLFVLNLEKNNIEDHLPNCLNNMTRLKVLDISFNQLSGSFPSIISNLTSLEYLALFDNNFEGTFPLSSLANHSKLEVLLLSTRNNMLQVQTENFLPTFQLKVLRLPNCSLNVIPPFLLHQFDLKYLDLSHNDLDGAFPTWALQNNTKLEVLLLTNNSFTGNLQLPDDKHDFLHHLDISSNNFTGKLPQDMGIILQKLLYMDMSNNHFEGNIASSIAEMKELRFLDLSKNNFSGELSAALLTSCFSLLWLGLSDNNFYGRIFPGYMNLTQLQYLYLENNKFSGKIEEGLLKSKKLVELRMSSNMLSGHIPHWMGNLSYLEVLLMSKNFFEGNIPVQLLNHRRLQLFSVSENYLSGFMTTSFNISSVEHLYLQKNSLSGPIPIALFRSSNLLTLDLRDNGFSGVIPHQINECSNLRFLLLRGNNLEGQIPNQICQLTGLGMMDLSHNKFNGSIPSCFTNITLWSVGNLDRYRLEHLTFVERLDVNSIGIYYSSMLDMGQLSSEERGPFTFDYLVEVEFVTKNRYEVYNGSNLDYMVGLDLSCNKLTGEIPSEIGELQEIPVLNMSHNFLSE*******NLKMIESLDL****LSGQIPPKLTELNFLSNFNVSYNNLSGLIPDKGQFATFDESSYRGNLHLCGPTINKSCNG******************IDMVSLFWSFC*
********ESTSFIKLSLISSVILMVVLNQMHGYKACLKTERAALSEIKSFFIPFMDTQYEDPVLATWVDDGGMSSDCCNWKGVRCNATTGRVIQLLLNDTSKFIEYSKNYTYGDMVLSLNVSLFHPFEELQSLDLSNNSFEGVYENQAYDTLGSLKRLKILNLGYNYFDDSIFLYLNALTSLTTLILRENNIQGSRTKQGLSKLKNLEALDLSSNFINGSLESQGICELKNLFVLNLEKNNIEDHLPNCLNNMTRLKVLDISFNQLSGSFPSIISNLTSLEYLALFDNNFEGTFPLSSLANHSKLEVLLLSTRNNMLQVQTENFLPTFQLKVLRLPNCSLNVIPPFLLHQFDLKYLDLSHNDLDGAFPTWALQNNTKLEVLLLTNNSFTGNLQLPDDKHDFLHHLDISSNNFTGKLPQDMGIILQKLLYMDMSNNHFEGNIASSIAEMKELRFLDLSKNNFSGELSAALLTSCFSLLWLGLSDNNFYGRIFPGYMNLTQLQYLYLENNKFSGKIEEGLLKSKKLVELRMSSNMLSGHIPHWMGNLSYLEVLLMSKNFFEGNIPVQLLNHRRLQLFSVSENYLSGFMTTSFNISSVEHLYLQKNSLSGPIPIALFRSSNLLTLDLRDNGFSGVIPHQINECSNLRFLLLRGNNLEGQIPNQICQLTGLGMMDLSHNKFNGSIPSCFTNITLWSVGNLDRYRLEHLTFVERLDVNSIGIYYSSMLDMGQLSSEERGPFTFDYLVEVEFVTKNRYEVYNGSNLDYMVGLDLSCNKLTGEIPSEIGELQEIPVLNMSHNFLSESIPESFSNLKMIESLDLSHNRLSGQIPPKLTELNFLSNFNVSYNNLSGLIPDKGQFATFDESSYRGNLHLCGP****************************MVSLFWSFCA
MKGYCFAMESTSFIKLSLISSVILMVVLNQMHGYKACLKTERAALSEIKSFFIPFMDTQYEDPVLATWVDDGGMSSDCCNWKGVRCNATTGRVIQLLLNDTSKFIEYSKNYTYGDMVLSLNVSLFHPFEELQSLDLSNNSFEGVYENQAYDTLGSLKRLKILNLGYNYFDDSIFLYLNALTSLTTLILRENNIQGSRTKQGLSKLKNLEALDLSSNFINGSLESQGICELKNLFVLNLEKNNIEDHLPNCLNNMTRLKVLDISFNQLSGSFPSIISNLTSLEYLALFDNNFEGTFPLSSLANHSKLEVLLLSTRNNMLQVQTENFLPTFQLKVLRLPNCSLNVIPPFLLHQFDLKYLDLSHNDLDGAFPTWALQNNTKLEVLLLTNNSFTGNLQLPDDKHDFLHHLDISSNNFTGKLPQDMGIILQKLLYMDMSNNHFEGNIASSIAEMKELRFLDLSKNNFSGELSAALLTSCFSLLWLGLSDNNFYGRIFPGYMNLTQLQYLYLENNKFSGKIEEGLLKSKKLVELRMSSNMLSGHIPHWMGNLSYLEVLLMSKNFFEGNIPVQLLNHRRLQLFSVSENYLSGFMTTSFNISSVEHLYLQKNSLSGPIPIALFRSSNLLTLDLRDNGFSGVIPHQINECSNLRFLLLRGNNLEGQIPNQICQLTGLGMMDLSHNKFNGSIPSCFTNITLWSVGNLDRYRLEHLTFVERLDVNSIGIYYSSMLDMGQLSSEERGPFTFDYLVEVEFVTKNRYEVYNGSNLDYMVGLDLSCNKLTGEIPSEIGELQEIPVLNMSHNFLSESIPESFSNLKMIESLDLSHNRLSGQIPPKLTELNFLSNFNVSYNNLSGLIPDKGQFATFDESSYRGNLHLCGPTINKSCNGVEEIPATDSNREEGDDSAIDMVSLFWSFCA
*KGYCFAMESTSFIKLSLISSVILMVVLNQMHGYKACLKTERAALSEIKSFFIPFMDTQYEDPVLATWVDDGGMSSDCCNWKGVRCNATTGRVIQLLLNDTSKFIEYSKNYTYGDMVLSLNVSLFHPFEELQSLDLSNNSFEGVYENQAYDTLGSLKRLKILNLGYNYFDDSIFLYLNALTSLTTLILRENNIQGSRTKQGLSKLKNLEALDLSSNFINGSLESQGICELKNLFVLNLEKNNIEDHLPNCLNNMTRLKVLDISFNQLSGSFPSIISNLTSLEYLALFDNNFEGTFPLSSLANHSKLEVLLLSTRNNMLQVQTENFLPTFQLKVLRLPNCSLNVIPPFLLHQFDLKYLDLSHNDLDGAFPTWALQNNTKLEVLLLTNNSFTGNLQLPDDKHDFLHHLDISSNNFTGKLPQDMGIILQKLLYMDMSNNHFEGNIASSIAEMKELRFLDLSKNNFSGELSAALLTSCFSLLWLGLSDNNFYGRIFPGYMNLTQLQYLYLENNKFSGKIEEGLLKSKKLVELRMSSNMLSGHIPHWMGNLSYLEVLLMSKNFFEGNIPVQLLNHRRLQLFSVSENYLSGFMTTSFNISSVEHLYLQKNSLSGPIPIALFRSSNLLTLDLRDNGFSGVIPHQINECSNLRFLLLRGNNLEGQIPNQICQLTGLGMMDLSHNKFNGSIPSCFTNITLWSVGNLDRYRLEHLTFVERLDVNSIGIYYSSMLDMGQLSSEERGPFTFDYLVEVEFVTKNRYEVYNGSNLDYMVGLDLSCNKLTGEIPSEIGELQEIPVLNMSHNFLSESIPESFSNLKMIESLDLSHNRLSGQIPPKLTELNFLSNFNVSYNNLSGLIPDKGQFATFDESSYRGNLHLCGPTINKSC*****************DSAIDMVSLFWSFCA
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGYCFAMESTSFIKLSLISSVILMVVLNQMHGYKACLKTERAALSEIKSFFIPFMDTQYEDPVLATWVDDGGMSSDCCNWKGVRCNATTGRVIQLLLNDTSKFIEYSKNYTYGDMVLSLNVSLFHPFEELQSLDLSNNSFEGVYENQAYDTLGSLKRLKILNLGYNYFDDSIFLYLNALTSLTTLILRENNIQGSRTKQGLSKLKNLEALDLSSNFINGSLESQGICELKNLFVLNLEKNNIEDHLPNCLNNMTRLKVLDISFNQLSGSFPSIISNLTSLEYLALFDNNFEGTFPLSSLANHSKLEVLLLSTRNNMLQVQTENFLPTFQLKVLRLPNCSLNVIPPFLLHQFDLKYLDLSHNDLDGAFPTWALQNNTKLEVLLLTNNSFTGNLQLPDDKHDFLHHLDISSNNFTGKLPQDMGIILQKLLYMDMSNNHFEGNIASSIAEMKELRFLDLSKNNFSGELSAALLTSCFSLLWLGLSDNNFYGRIFPGYMNLTQLQYLYLENNKFSGKIEEGLLKSKKLVELRMSSNMLSGHIPHWMGNLSYLEVLLMSKNFFEGNIPVQLLNHRRLQLFSVSENYLSGFMTTSFNISSVEHLYLQKNSLSGPIPIALFRSSNLLTLDLRDNGFSGVIPHQINECSNLRFLLLRGNNLEGQIPNQICQLTGLGMMDLSHNKFNGSIPSCFTNITLWSVGNLDRYRLEHLTFVERLDVNSIGIYYSSMLDMGQLSSEERGPFTFDYLVEVEFVTKNRYEVYNGSNLDYMVGLDLSCNKLTGEIPSEIGELQEIPVLNMSHNFLSESIPESFSNLKMIESLDLSHNRLSGQIPPKLTELNFLSNFNVSYNNLSGLIPDKGQFATFDESSYRGNLHLCGPTINKSCNGVEEIPATDSNREEGDDSAIDMVSLFWSFCA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query911 2.2.26 [Sep-21-2011]
C0LGQ5 1249 LRR receptor-like serine/ no no 0.868 0.633 0.294 9e-73
Q9C9H7847 Receptor-like protein 12 no no 0.798 0.858 0.309 1e-72
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.754 0.569 0.319 2e-71
Q8L899 1207 Systemin receptor SR160 O N/A no 0.754 0.569 0.318 3e-71
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.825 0.600 0.290 1e-68
O22476 1196 Protein BRASSINOSTEROID I no no 0.667 0.508 0.313 2e-64
Q9FL28 1173 LRR receptor-like serine/ no no 0.767 0.595 0.286 2e-62
Q9SHI2 1101 Leucine-rich repeat recep no no 0.691 0.572 0.314 1e-60
Q9LJF3 1164 Receptor-like protein kin no no 0.691 0.541 0.307 1e-57
Q9LYN8 1192 Leucine-rich repeat recep no no 0.769 0.588 0.293 1e-57
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function desciption
 Score =  275 bits (704), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 272/924 (29%), Positives = 425/924 (45%), Gaps = 133/924 (14%)

Query: 33  GYKACLKTERAALSEIKSFFIPFMDTQYEDPVLATWVDDGGMSSDCCNWKGVRCNATTG- 91
           G    +  +   L E+K   +   + Q +DP L  W  D   + + C+W GV C+  TG 
Sbjct: 18  GQPGIINNDLQTLLEVKKSLV--TNPQEDDP-LRQWNSD---NINYCSWTGVTCD-NTGL 70

Query: 92  -RVIQLLLNDTSKFIEYSKNYTYGDMVLSLNVS---LFHPFE-------ELQSLDLSNNS 140
            RVI L L         S  +   D ++ L++S   L  P          L+SL L +N 
Sbjct: 71  FRVIALNLTGLGLTGSISPWFGRFDNLIHLDLSSNNLVGPIPTALSNLTSLESLFLFSNQ 130

Query: 141 FEGVYENQAYDTLGSLKRLKILNLGYNYFDDSIFLYLNALTSLTTLILRENNIQGSRTKQ 200
             G   +Q    LGSL  ++ L +G N     I   L  L +L  L L    + G    Q
Sbjct: 131 LTGEIPSQ----LGSLVNIRSLRIGDNELVGDIPETLGNLVNLQMLALASCRLTGPIPSQ 186

Query: 201 GLSKLKNLEALDLSSNFINGSLESQ-GICELKNLFVLNLEKNNIEDHLPNCLNNMTRLKV 259
            L +L  +++L L  N++ G + ++ G C   +L V    +N +   +P  L  +  L++
Sbjct: 187 -LGRLVRVQSLILQDNYLEGPIPAELGNC--SDLTVFTAAENMLNGTIPAELGRLENLEI 243

Query: 260 LDISFNQLSGSFPSIISNLTSLEYLALFDNNFEGTFPLSSLANHSKLEVLLLSTRNNMLQ 319
           L+++ N L+G  PS +  ++ L+YL+L  N  +G  P  SLA+   L+ L LS  NN+  
Sbjct: 244 LNLANNSLTGEIPSQLGEMSQLQYLSLMANQLQGLIP-KSLADLGNLQTLDLSA-NNLTG 301

Query: 320 VQTENFLPTFQLKVLRLPNCSLNVIPPFLLHQFDLKYLDLSHNDLDGAFPTWALQNNTKL 379
              E F    QL  L L N                       N L G+ P     NNT L
Sbjct: 302 EIPEEFWNMSQLLDLVLAN-----------------------NHLSGSLPKSICSNNTNL 338

Query: 380 EVLLLTNNSFTGNLQLPDDKHDFLHHLDISSNNFTGKLPQDM-----------------G 422
           E L+L+    +G + +   K   L  LD+S+N+  G +P+ +                 G
Sbjct: 339 EQLVLSGTQLSGEIPVELSKCQSLKQLDLSNNSLAGSIPEALFELVELTDLYLHNNTLEG 398

Query: 423 II------LQKLLYMDMSNNHFEGNIASSIAEMKELRFLDLSKNNFSGELSAALLTSCFS 476
            +      L  L ++ + +N+ EG +   I+ +++L  L L +N FSGE+   +  +C S
Sbjct: 399 TLSPSISNLTNLQWLVLYHNNLEGKLPKEISALRKLEVLFLYENRFSGEIPQEI-GNCTS 457

Query: 477 LLWLGLSDNNFYGRIFPGYMNLTQLQYLYLENNKFSGKIEEGLLKSKKLVELRMSSNMLS 536
           L  + +  N+F G I P    L +L  L+L  N+  G +   L    +L  L ++ N LS
Sbjct: 458 LKMIDMFGNHFEGEIPPSIGRLKELNLLHLRQNELVGGLPASLGNCHQLNILDLADNQLS 517

Query: 537 GHIPHWMGNLSYLEVLLMSKNFFEGNIPVQLLNHRRLQLFSVSENYLSGFMTT------- 589
           G IP   G L  LE L++  N  +GN+P  L++ R L   ++S N L+G +         
Sbjct: 518 GSIPSSFGFLKGLEQLMLYNNSLQGNLPDSLISLRNLTRINLSHNRLNGTIHPLCGSSSY 577

Query: 590 -SFNIS----------------SVEHLYLQKNSLSGPIPIALFRSSNLLTLDLRDNGFSG 632
            SF+++                +++ L L KN L+G IP  L +   L  LD+  N  +G
Sbjct: 578 LSFDVTNNGFEDEIPLELGNSQNLDRLRLGKNQLTGKIPWTLGKIRELSLLDMSSNALTG 637

Query: 633 VIPHQINECSNLRFLLLRGNNLEGQIPNQICQLTGLGMMDLSHNKFNGSIPSCFTNITLW 692
            IP Q+  C  L  + L  N L G IP  + +L+ LG + LS N+F  S+P+   N T  
Sbjct: 638 TIPLQLVLCKKLTHIDLNNNFLSGPIPPWLGKLSQLGELKLSSNQFVESLPTELFNCTKL 697

Query: 693 SVGNLDRYRLEHLTFVERLDVNSIGIYYSSMLDMGQLSSEERGPFTFDYLVEVEFVTKNR 752
            V +LD   L      E   + ++G      LD  Q S     P     L ++       
Sbjct: 698 LVLSLDGNSLNGSIPQE---IGNLGALNVLNLDKNQFSGSL--PQAMGKLSKL------- 745

Query: 753 YEVYNGSNLDYMVGLDLSCNKLTGEIPSEIGELQEI-PVLNMSHNFLSESIPESFSNLKM 811
           YE            L LS N LTGEIP EIG+LQ++   L++S+N  +  IP +   L  
Sbjct: 746 YE------------LRLSRNSLTGEIPVEIGQLQDLQSALDLSYNNFTGDIPSTIGTLSK 793

Query: 812 IESLDLSHNRLSGQIPPKLTELNFLSNFNVSYNNLSGLIPDKGQFATFDESSYRGNLHLC 871
           +E+LDLSHN+L+G++P  + ++  L   NVS+NNL G +  K QF+ +   S+ GN  LC
Sbjct: 794 LETLDLSHNQLTGEVPGSVGDMKSLGYLNVSFNNLGGKL--KKQFSRWPADSFLGNTGLC 851

Query: 872 GPTINKSCNGVEEIPATDSNREEG 895
           G  +++ CN V       +N+++G
Sbjct: 852 GSPLSR-CNRVR-----SNNKQQG 869




Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query911
12324907910 putative disease resistance protein; 468 0.936 0.937 0.446 0.0
297842171966 leucine-rich repeat family protein [Arab 0.953 0.899 0.436 0.0
15221162965 receptor like protein 15 [Arabidopsis th 0.954 0.901 0.428 0.0
3583456931011 Receptor-like protein kinase [Medicago t 0.930 0.838 0.417 1e-179
357468861 1016 Receptor-like protein kinase [Medicago t 0.930 0.834 0.417 1e-179
12323813951 disease resistance protein, putative; 63 0.957 0.916 0.439 1e-177
359482745 1026 PREDICTED: leucine-rich repeat receptor 0.957 0.849 0.416 1e-177
334183409932 receptor like protein 9 [Arabidopsis tha 0.934 0.913 0.422 1e-175
240254367976 receptor like protein 14 [Arabidopsis th 0.944 0.881 0.421 1e-175
358345471933 Receptor kinase [Medicago truncatula] gi 0.907 0.886 0.438 1e-175
>gi|12324907|gb|AAG52409.1|AC020579_11 putative disease resistance protein; 46848-50365 [Arabidopsis thaliana] Back     alignment and taxonomy information
 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/902 (44%), Positives = 570/902 (63%), Gaps = 49/902 (5%)

Query: 28  LNQMHGYKACLKTERAALSEIKSFFIPFMDTQYEDPVLATWVDDGGMSSDCCNWKGVRCN 87
           + Q+HGYK+C+  E+ AL E++   I   +++    VL TW +D   +SDCC WKGV CN
Sbjct: 1   MGQLHGYKSCIDEEKIALFELRKHMISRTESE---SVLPTWTND--TTSDCCRWKGVACN 55

Query: 88  ATTGRVIQLLLNDTSKFIEYSKNYTYGDMVLS----LNVSLFHPFEELQSLDLSNNSFEG 143
             +GRV ++               ++G + L     LN+SL HPFE+++SL+LS++   G
Sbjct: 56  RVSGRVTEI---------------SFGGLSLKDNSLLNLSLLHPFEDVRSLNLSSSRCSG 100

Query: 144 VYEN-QAYDTLGSLKRLKILNLGYNYFDDSIFLYLNALTSLTTLILRENNIQGSRTKQGL 202
           ++++ + Y +L  L++L+IL+L  N F++SIF +L+A TSLTTL LR NN+ GS   + L
Sbjct: 101 LFDDVEGYKSLRKLRKLEILDLASNKFNNSIFHFLSAATSLTTLFLRSNNMDGSFPAKEL 160

Query: 203 SKLKNLEALDLSSNFINGSLESQGICELKNLFVLNLEKNNIEDHLPNCLNNMTRLKVLDI 262
             L NLE LDLS N  NGS+  QGICEL N+  L+L +N +  HLP+CL ++T L+VLD+
Sbjct: 161 RDLTNLELLDLSRNRFNGSIPIQGICELNNMQELDLSQNKLVGHLPSCLTSLTGLRVLDL 220

Query: 263 SFNQLSGSFPSIISNLTSLEYLALFDNNFEGTFPLSSLANHSKLEVLLLSTRNNMLQVQT 322
           S N+L+G+ PS + +L SLEYL+LFDN+FEG+F   SLAN S L VL L ++++ LQV +
Sbjct: 221 SSNKLTGTVPSSLGSLQSLEYLSLFDNDFEGSFSFGSLANLSNLMVLKLCSKSSSLQVLS 280

Query: 323 E-NFLPTFQLKVLRLPNCSLNVIPPFLLHQFDLKYLDLSHNDLDGAFPTWALQNNTKLEV 381
           E ++ P FQL V+ L +C++  +P FLLHQ DL+++DLS N++ G  P+W L NNTKL+V
Sbjct: 281 ESSWKPKFQLSVIALRSCNMEKVPHFLLHQKDLRHVDLSDNNISGKLPSWLLANNTKLKV 340

Query: 382 LLLTNNSFTGNLQLPDDKHDFLHHLDISSNNFTGKLPQDMGIILQKLLYMDMSNNHFEGN 441
           LLL NN FT + Q+P   H+ L  LD+S+N+F    P+++G I   L Y++ S N+F+ N
Sbjct: 341 LLLQNNLFT-SFQIPKSAHNLL-FLDVSANDFNHLFPENIGWIFPHLRYLNTSKNNFQEN 398

Query: 442 IASSIAEMKELRFLDLSKNNFSGELSAALLTSCFSLLWLGLSDNNFYGRIFPGYMNLTQL 501
           + SS+  M  ++++DLS+N+F G L  + +  C+S+  L LS N   G IFP   N T +
Sbjct: 399 LPSSLGNMNGIQYMDLSRNSFHGNLPRSFVNGCYSMAILKLSHNKLSGEIFPESTNFTNI 458

Query: 502 QYLYLENNKFSGKIEEGLLKSKKLVELRMSSNMLSGHIPHWMGNLSYLEVLLMSKNFFEG 561
             L+++NN F+GKI +GL     L  L MS+N L+G IP W+G L  L  LL+S NF +G
Sbjct: 459 LGLFMDNNLFTGKIGQGLRSLINLELLDMSNNNLTGVIPSWIGELPSLTALLISDNFLKG 518

Query: 562 NIPVQLLNHRRLQLFSVSENYLSGFMTTSFNISSVEHLYLQKNSLSGPIPIALFRSSNLL 621
           +IP+ L N   LQL  +S N LSG +    +  +   L LQ N LSG IP  L   +N+ 
Sbjct: 519 DIPMSLFNKSSLQLLDLSANSLSGVIPPQHDSRNGVVLLLQDNKLSGTIPDTLL--ANVE 576

Query: 622 TLDLRDNGFSGVIPHQINECSNLRFLLLRGNNLEGQIPNQICQLTGLGMMDLSHNKFNGS 681
            LDLR+N FSG IP  IN   N+  LLLRGNN  GQIP+Q+C L+ + ++DLS+N+ NG+
Sbjct: 577 ILDLRNNRFSGKIPEFIN-IQNISILLLRGNNFTGQIPHQLCGLSNIQLLDLSNNRLNGT 635

Query: 682 IPSCFTNITLWSVGNLDRYRLEH-LTFVERL--------DVNS---IGIYYSSMLDMGQL 729
           IPSC +N +         Y  +  ++F   +        D +S    GIY+ S+L +  L
Sbjct: 636 IPSCLSNTSFGFGKECTSYDYDFGISFPSDVFNGFSLHQDFSSNKNGGIYFKSLLTLDPL 695

Query: 730 SSEERGPFTFDYLVEVEFVTKNRYEVYNGSNLDYMVGLDLSCNKLTGEIPSEIGELQEIP 789
           S + +         ++EF TK+RY+ Y G NL  + G+DLS N+L+GEIP E G L E+ 
Sbjct: 696 SMDYKAATQ----TKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVEFGGLLELR 751

Query: 790 VLNMSHNFLSESIPESFSNLKMIESLDLSHNRLSGQIPPKLTELNFLSNFNVSYNNLSGL 849
            LN+SHN LS  IP+S S+++ +ES DLS NRL G+IP +LTEL  LS F VS+NNLSG+
Sbjct: 752 ALNLSHNNLSGVIPKSISSMEKMESFDLSFNRLQGRIPSQLTELTSLSVFKVSHNNLSGV 811

Query: 850 IPDKGQFATFDESSYRGNLHLCGPTINKSCNGVEEIPATDSNREEGDDSAIDMVSLFWSF 909
           IP   QF TFD  SY GN  LCG   N+SCN      A   N  E D+S IDMVS + SF
Sbjct: 812 IPQGRQFNTFDAESYFGNRLLCGQPTNRSCNNNSYEEA--DNGVEADESIIDMVSFYLSF 869

Query: 910 CA 911
            A
Sbjct: 870 AA 871




Source: Arabidopsis thaliana

Species: Arabidopsis thaliana

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297842171|ref|XP_002888967.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297334808|gb|EFH65226.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15221162|ref|NP_177559.1| receptor like protein 15 [Arabidopsis thaliana] gi|12323812|gb|AAG51871.1|AC079678_1 disease resistance protein, putative; 1096-4664 [Arabidopsis thaliana] gi|332197443|gb|AEE35564.1| receptor like protein 15 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|358345693|ref|XP_003636910.1| Receptor-like protein kinase [Medicago truncatula] gi|355502845|gb|AES84048.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|357468861|ref|XP_003604715.1| Receptor-like protein kinase [Medicago truncatula] gi|355505770|gb|AES86912.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|12323813|gb|AAG51872.1|AC079678_2 disease resistance protein, putative; 6346-10057 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|359482745|ref|XP_003632825.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|334183409|ref|NP_176115.2| receptor like protein 9 [Arabidopsis thaliana] gi|332195389|gb|AEE33510.1| receptor like protein 9 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|240254367|ref|NP_177558.4| receptor like protein 14 [Arabidopsis thaliana] gi|332197442|gb|AEE35563.1| receptor like protein 14 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|358345471|ref|XP_003636801.1| Receptor kinase [Medicago truncatula] gi|355502736|gb|AES83939.1| Receptor kinase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query911
TAIR|locus:2019662965 RLP15 "AT1G74190" [Arabidopsis 0.841 0.794 0.431 2.4e-154
TAIR|locus:20373131000 RLP13 "AT1G74170" [Arabidopsis 0.837 0.763 0.438 1.4e-151
TAIR|locus:2101943891 RLP45 "AT3G53240" [Arabidopsis 0.897 0.918 0.413 2e-150
TAIR|locus:2037308976 RLP14 "AT1G74180" [Arabidopsis 0.845 0.788 0.435 5.4e-150
TAIR|locus:20250121083 RLP1 "AT1G07390" [Arabidopsis 0.850 0.715 0.430 8.8e-150
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.948 0.924 0.393 8e-140
TAIR|locus:2155909908 RLP56 "AT5G49290" [Arabidopsis 0.852 0.855 0.387 1.1e-124
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.920 0.671 0.291 2.7e-77
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.884 0.643 0.304 8.7e-75
TAIR|locus:2144392957 RLP53 "receptor like protein 5 0.888 0.845 0.296 1.8e-71
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1505 (534.8 bits), Expect = 2.4e-154, P = 2.4e-154
 Identities = 349/809 (43%), Positives = 484/809 (59%)

Query:   130 ELQSLDLSNNSFEGVYENQAYDTLGSLKRLKILNLGYNYFDDSI-FLYLNALTSLTTLIL 188
             +L+ LDL++N F     N  +  L +   L  L L  N  D S     L  LT+L  L L
Sbjct:   133 KLEILDLASNKFN----NSIFHFLSAATSLTTLFLRSNNMDGSFPAKELRDLTNLELLDL 188

Query:   189 RENNIQGSRTKQGLSKLKNLEALDLSSNFINGSLESQG-------------ICELKNLFV 235
               N   GS   Q LS L+ L+ALDLS N  +GS+E QG             ICEL N+  
Sbjct:   189 SRNRFNGSIPIQELSSLRKLKALDLSGNEFSGSMELQGKFCTDLLFSIQSGICELNNMQE 248

Query:   236 LNLEKNNIEDHLPNCLNNMTRLKVLDISFNQLSGSFPSIISNLTSLEYLALFDNNFEGTF 295
             L+L +N +  HLP+CL ++T L+VLD+S N+L+G+ PS + +L SLEYL+LFDN+FEG+F
Sbjct:   249 LDLSQNKLVGHLPSCLTSLTGLRVLDLSSNKLTGTVPSSLGSLQSLEYLSLFDNDFEGSF 308

Query:   296 PLSSLANHSKLEVLLLSTRNNMLQVQTEN-FLPTFQLKVLRLPNCSLNVIPPFLLHQFDL 354
                SLAN S L VL L ++++ LQV +E+ + P FQL V+ L +C++  +P FLLHQ DL
Sbjct:   309 SFGSLANLSNLMVLKLCSKSSSLQVLSESSWKPKFQLSVIALRSCNMEKVPHFLLHQKDL 368

Query:   355 KYLDLSHNDLDGAFPTWALQNNTKLEVLLLTNNSFTGNLQLPDDKHDFLHHLDISSNNFT 414
             +++DLS N++ G  P+W L NNTKL+VLLL NN FT + Q+P   H+ L  LD+S+N+F 
Sbjct:   369 RHVDLSDNNISGKLPSWLLANNTKLKVLLLQNNLFT-SFQIPKSAHNLLF-LDVSANDFN 426

Query:   415 GKLPQDMGIILQKLLYMDMSNNHFEGNIASSIAEMKELRFLDLSKNNFSGELSAALLTSC 474
                P+++G I   L Y++ S N+F+ N+ SS+  M  ++++DLS+N+F G L  + +  C
Sbjct:   427 HLFPENIGWIFPHLRYLNTSKNNFQENLPSSLGNMNGIQYMDLSRNSFHGNLPRSFVNGC 486

Query:   475 FSLLWLGLSDNNFYGRIFPGYMNLTQLQYLYLENNKFSGKIEEGLLKSKKLVELRMSSNM 534
             +S+  L LS N   G IFP   N T +  L+++NN F+GKI +GL     L  L MS+N 
Sbjct:   487 YSMAILKLSHNKLSGEIFPESTNFTNILGLFMDNNLFTGKIGQGLRSLINLELLDMSNNN 546

Query:   535 LSGHIPHWMGNLSYLEVLLMSKNFFEGNIPVQLLNHRRLQLFSVSENYLSGFMTTSFNIS 594
             L+G IP W+G L  L  LL+S NF +G+IP+ L N   LQL  +S N LSG +    +  
Sbjct:   547 LTGVIPSWIGELPSLTALLISDNFLKGDIPMSLFNKSSLQLLDLSANSLSGVIPPQHDSR 606

Query:   595 SVEHLYLQKNSLSGPIPIALFRSSNLLTLDLRDNGFSGVIPHQINECSXXXXXXXXXXXX 654
             +   L LQ N LSG IP  L   +N+  LDLR+N FSG IP  IN               
Sbjct:   607 NGVVLLLQDNKLSGTIPDTLL--ANVEILDLRNNRFSGKIPEFIN-IQNISILLLRGNNF 663

Query:   655 EGQIPNQICQLTGLGMMDLSHNKFNGSIPSCFTNITLWSVGNLDRYRLEH-LTFVERL-- 711
              GQIP+Q+C L+ + ++DLS+N+ NG+IPSC +N +         Y  +  ++F   +  
Sbjct:   664 TGQIPHQLCGLSNIQLLDLSNNRLNGTIPSCLSNTSFGFGKECTSYDYDFGISFPSDVFN 723

Query:   712 ------DVNSI---GIYYSSMLDMGQLSSEERGPFTFDYLVEVEFVTKNRYEVYNGSNLD 762
                   D +S    GIY+ S+L +  LS + +         ++EF TK+RY+ Y G NL 
Sbjct:   724 GFSLHQDFSSNKNGGIYFKSLLTLDPLSMDYKAATQ----TKIEFATKHRYDAYMGGNLK 779

Query:   763 YMVGLDLSCNKLTGEIPSEIGELQEIPVLNMSHNFLSESIPESFSNLKMIESLDLSHNRL 822
              + G+DLS N+L+GEIP E G L E+  LN+SHN LS  IP+S S+++ +ES DLS NRL
Sbjct:   780 LLFGMDLSENELSGEIPVEFGGLLELRALNLSHNNLSGVIPKSISSMEKMESFDLSFNRL 839

Query:   823 SGQIPPKLTELNFLSNFNVSYNNLSGLIPDKGQFATFDESSYRGNLHLCGPTINKSCNGV 882
              G+IP +LTEL  LS F VS+NNLSG+IP   QF TFD  SY GN  LCG   N+SCN  
Sbjct:   840 QGRIPSQLTELTSLSVFKVSHNNLSGVIPQGRQFNTFDAESYFGNRLLCGQPTNRSCNN- 898

Query:   883 EEIPATDSNREEGDDSAIDMVSLFWSFCA 911
                   D N  E D+S IDMVS + SF A
Sbjct:   899 NSYEEAD-NGVEADESIIDMVSFYLSFAA 926


GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh2_kg.2__1688__AT1G74190.1
annotation not avaliable (966 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query911
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-64
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-55
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-10
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 9e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-07
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 5e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-05
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 8e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.002
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  233 bits (596), Expect = 4e-64
 Identities = 191/606 (31%), Positives = 282/606 (46%), Gaps = 98/606 (16%)

Query: 302 NHSKLEVLLLSTRNNMLQVQTENFLPTFQLKVLRLPNCSLNVIPPFLLHQF-----DLKY 356
           N S++  + LS +N   ++        F+L  ++  N S N +   +          L+Y
Sbjct: 67  NSSRVVSIDLSGKNISGKIS----SAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRY 122

Query: 357 LDLSHNDLDGAFPTWALQNNTKLEVLLLTNNSFTGNLQLPDDKHDF--LHHLDISSNNFT 414
           L+LS+N+  G+ P  ++ N   LE L L+NN  +G  ++P+D   F  L  LD+  N   
Sbjct: 123 LNLSNNNFTGSIPRGSIPN---LETLDLSNNMLSG--EIPNDIGSFSSLKVLDLGGNVLV 177

Query: 415 GKLPQDMGIILQKLLYMDMSNNHFEGNIASSIAEMKELRFLDLSKNNFSGELSAAL--LT 472
           GK+P  +   L  L ++ +++N   G I   + +MK L+++ L  NN SGE+   +  LT
Sbjct: 178 GKIPNSLTN-LTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLT 236

Query: 473 SCFSLLWLGLSDNNFYGRIFPGYMNLTQLQYLYLENNKFSGKIEEGLLKSKKLVELRMSS 532
           S   L  L L  NN  G I     NL  LQYL+L  NK SG I   +   +KL+ L +S 
Sbjct: 237 S---LNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSD 293

Query: 533 NMLSGHIPHWMGNLSYLEVLLMSKNFFEGNIPVQLLNHRRLQLFSVSENYLSGFMTTSFN 592
           N LSG IP  +  L  LE+L +  N F G IPV L +  RLQ+                 
Sbjct: 294 NSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQV----------------- 336

Query: 593 ISSVEHLYLQKNSLSGPIPIALFRSSNLLTLDLRDNGFSGVIPHQINECSNLRFLLLRGN 652
                 L L  N  SG IP  L + +NL  LDL  N  +G IP  +    NL  L+L  N
Sbjct: 337 ------LQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSN 390

Query: 653 NLEGQIPNQICQLTGLGMMDLSHNKFNGSIPSCFTNITLWSVGNLDRYRLEHLTFVERLD 712
           +LEG+IP  +     L  + L  N F+G +PS FT + L             + F++  +
Sbjct: 391 SLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPL-------------VYFLDISN 437

Query: 713 VNSIGIYYSSMLDMGQLSSEERGPFTFDYLVEVEFVTKNRY--EVYNGSNLDYMVGLDLS 770
            N  G   S   DM  L              ++  + +N++   + +      +  LDLS
Sbjct: 438 NNLQGRINSRKWDMPSL--------------QMLSLARNKFFGGLPDSFGSKRLENLDLS 483

Query: 771 CNKLTGEIPSEIGELQEIPVLNMSHNFLSESIPESFSNLKMIESLDLSHNRLSGQIPPKL 830
            N+ +G +P ++G L E+  L +S N LS  IP+  S+ K + SLDLSHN+LSGQIP   
Sbjct: 484 RNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASF 543

Query: 831 TELNFLSNFNVSYNNLSGLIPDK------------------------GQFATFDESSYRG 866
           +E+  LS  ++S N LSG IP                          G F   + S+  G
Sbjct: 544 SEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAG 603

Query: 867 NLHLCG 872
           N+ LCG
Sbjct: 604 NIDLCG 609


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 911
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG4237498 consensus Extracellular matrix protein slit, conta 99.92
KOG4237498 consensus Extracellular matrix protein slit, conta 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
PLN03150623 hypothetical protein; Provisional 99.47
PLN03150623 hypothetical protein; Provisional 99.44
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.41
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.28
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.28
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.2
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.97
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.96
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.95
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.95
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.95
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.88
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.87
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.84
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.8
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.73
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.73
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.7
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.69
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.62
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.51
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.48
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.38
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.35
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.3
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.17
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.06
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.0
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.97
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.93
PRK15386426 type III secretion protein GogB; Provisional 97.9
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.84
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.8
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.73
KOG4341483 consensus F-box protein containing LRR [General fu 97.72
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.67
KOG4341483 consensus F-box protein containing LRR [General fu 97.55
PRK15386426 type III secretion protein GogB; Provisional 97.53
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.47
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.28
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.27
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.26
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.21
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.18
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.68
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.28
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.06
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.0
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.92
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.73
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.55
KOG4308478 consensus LRR-containing protein [Function unknown 92.06
KOG4308478 consensus LRR-containing protein [Function unknown 91.02
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.84
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.82
KOG0473 326 consensus Leucine-rich repeat protein [Function un 88.14
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.38
smart0037026 LRR Leucine-rich repeats, outliers. 86.38
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 83.4
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 83.13
smart0037026 LRR Leucine-rich repeats, outliers. 83.13
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=6.9e-72  Score=701.21  Aligned_cols=584  Identities=34%  Similarity=0.523  Sum_probs=420.1

Q ss_pred             hHHHHHHHHHhhhcCCCCcCCCCCCCCcCCCCCCCCCCCCCccccceeecCCCCcEEEEecCCCCcccccccccccCCcc
Q 043567           38 LKTERAALSEIKSFFIPFMDTQYEDPVLATWVDDGGMSSDCCNWKGVRCNATTGRVIQLLLNDTSKFIEYSKNYTYGDMV  117 (911)
Q Consensus        38 ~~~~~~all~~k~~~~~~~~~~~~~~~l~~W~~~~~~~~~~C~w~gv~C~~~~~~v~~l~L~~~~~~~~~~~~~~~~~~~  117 (911)
                      .++|++||++||+++.      +|.+.+++|...    .+||.|.||+|+. .++|+.++|++..+              
T Consensus        27 ~~~~~~~l~~~~~~~~------~~~~~~~~w~~~----~~~c~w~gv~c~~-~~~v~~L~L~~~~i--------------   81 (968)
T PLN00113         27 HAEELELLLSFKSSIN------DPLKYLSNWNSS----ADVCLWQGITCNN-SSRVVSIDLSGKNI--------------   81 (968)
T ss_pred             CHHHHHHHHHHHHhCC------CCcccCCCCCCC----CCCCcCcceecCC-CCcEEEEEecCCCc--------------
Confidence            4689999999999984      456678999754    7899999999985 56888877766543              


Q ss_pred             cccccccccCCCCCCEEeCCCCCCCcccCcccccccCCCCCCcEEeCCCCCCCccchhhhcCCCCCCEEEcCCcccCCcc
Q 043567          118 LSLNVSLFHPFEELQSLDLSNNSFEGVYENQAYDTLGSLKRLKILNLGYNYFDDSIFLYLNALTSLTTLILRENNIQGSR  197 (911)
Q Consensus       118 ~~~~~s~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~  197 (911)
                                              ++.++    ..+..+++|++|++++|.+.+.+|.                      
T Consensus        82 ------------------------~~~~~----~~~~~l~~L~~L~Ls~n~~~~~ip~----------------------  111 (968)
T PLN00113         82 ------------------------SGKIS----SAIFRLPYIQTINLSNNQLSGPIPD----------------------  111 (968)
T ss_pred             ------------------------cccCC----hHHhCCCCCCEEECCCCccCCcCCh----------------------
Confidence                                    22222    3344455555555555554444433                      


Q ss_pred             ChhhhcCCCCCCEEeCCCCCCCCccCcccccCCCCCCEEeccCCcCCCCCCcccCCCCCCcEEEccCCcCCccCcccccC
Q 043567          198 TKQGLSKLKNLEALDLSSNFINGSLESQGICELKNLFVLNLEKNNIEDHLPNCLNNMTRLKVLDISFNQLSGSFPSIISN  277 (911)
Q Consensus       198 ~~~~l~~l~~L~~L~Ls~n~l~~~i~~~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~  277 (911)
                        ..+.++++|++|+|++|.+++.+|.   +.+++|++|+|++|.+++.+|..++++++|++|++++|.+.+.+|..+++
T Consensus       112 --~~~~~l~~L~~L~Ls~n~l~~~~p~---~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~  186 (968)
T PLN00113        112 --DIFTTSSSLRYLNLSNNNFTGSIPR---GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTN  186 (968)
T ss_pred             --HHhccCCCCCEEECcCCccccccCc---cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhh
Confidence              3333444555555555554444442   23455555555555555555555556666666666666655555555556


Q ss_pred             CCCCCeeeccCCcCCCccChhhhcccccccEEEecCCCccccccccCcCCCCCceEEECCCCCCCCCChhhhccCCCCEE
Q 043567          278 LTSLEYLALFDNNFEGTFPLSSLANHSKLEVLLLSTRNNMLQVQTENFLPTFQLKVLRLPNCSLNVIPPFLLHQFDLKYL  357 (911)
Q Consensus       278 l~~L~~L~L~~n~l~~~~p~~~l~~l~~L~~L~L~~~~~~~~~~~~~~~~~~~L~~L~L~~n~l~~ip~~l~~~~~L~~L  357 (911)
                      +++|++|++++|.+.+.+|. .+                                                ..+.+|++|
T Consensus       187 l~~L~~L~L~~n~l~~~~p~-~l------------------------------------------------~~l~~L~~L  217 (968)
T PLN00113        187 LTSLEFLTLASNQLVGQIPR-EL------------------------------------------------GQMKSLKWI  217 (968)
T ss_pred             CcCCCeeeccCCCCcCcCCh-HH------------------------------------------------cCcCCccEE
Confidence            66666666655555544331 11                                                122233334


Q ss_pred             ECCCCCCCCCCchhhhhcCCcccEEEccCCccccccCCCCCCCCCccEEEccCCcCCcCCChhHHHhccCCcEEEcccCc
Q 043567          358 DLSHNDLDGAFPTWALQNNTKLEVLLLTNNSFTGNLQLPDDKHDFLHHLDISSNNFTGKLPQDMGIILQKLLYMDMSNNH  437 (911)
Q Consensus       358 ~Ls~n~l~~~~p~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~ls~n~l~~~ip~~~~~~l~~L~~L~Ls~n~  437 (911)
                      ++++|.+++.+|..+.                         .+++|++|++++|.+++.+|..+.. +++|++|++++|.
T Consensus       218 ~L~~n~l~~~~p~~l~-------------------------~l~~L~~L~L~~n~l~~~~p~~l~~-l~~L~~L~L~~n~  271 (968)
T PLN00113        218 YLGYNNLSGEIPYEIG-------------------------GLTSLNHLDLVYNNLTGPIPSSLGN-LKNLQYLFLYQNK  271 (968)
T ss_pred             ECcCCccCCcCChhHh-------------------------cCCCCCEEECcCceeccccChhHhC-CCCCCEEECcCCe
Confidence            4444444444443221                         2334555555666665555555543 5555555555555


Q ss_pred             cccccchhhhcCCCCcEEeccCcccCCcccHHHHhcccccceeeccCcccccccCCCCCCCCCCCEEEccCccccccccc
Q 043567          438 FEGNIASSIAEMKELRFLDLSKNNFSGELSAALLTSCFSLLWLGLSDNNFYGRIFPGYMNLTQLQYLYLENNKFSGKIEE  517 (911)
Q Consensus       438 l~~~~p~~l~~l~~L~~L~Ls~n~l~g~i~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~  517 (911)
                      +++.+|..+.++++|++|++++|.+.+.                         +|..+.++++|+.|++++|.+++.+|.
T Consensus       272 l~~~~p~~l~~l~~L~~L~Ls~n~l~~~-------------------------~p~~~~~l~~L~~L~l~~n~~~~~~~~  326 (968)
T PLN00113        272 LSGPIPPSIFSLQKLISLDLSDNSLSGE-------------------------IPELVIQLQNLEILHLFSNNFTGKIPV  326 (968)
T ss_pred             eeccCchhHhhccCcCEEECcCCeeccC-------------------------CChhHcCCCCCcEEECCCCccCCcCCh
Confidence            5555555555555555555555555544                         444455566667777777777666676


Q ss_pred             cccCCCCCcEEECcCCcCcccCCcCccCcCCCcEEEccCcccccccchhhccCCCCcEEEccCcccccccCccc-ccccc
Q 043567          518 GLLKSKKLVELRMSSNMLSGHIPHWMGNLSYLEVLLMSKNFFEGNIPVQLLNHRRLQLFSVSENYLSGFMTTSF-NISSV  596 (911)
Q Consensus       518 ~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~ls~n~l~~~~~~~~-~~~~L  596 (911)
                      .+..+++|++|++++|++++.+|..++.+++|+.|++++|++++.+|..++.+++|+.+++++|.+.+.+|..+ .+++|
T Consensus       327 ~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L  406 (968)
T PLN00113        327 ALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSL  406 (968)
T ss_pred             hHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCC
Confidence            67777777777777777777777777777777777777777777777777777777777777777777777666 67788


Q ss_pred             cEEEcccCcccccccccccCCCCCCEEeCCCCcccccCchhhhcCCCccEEEccCCcccccCChhhhcCCCCCeEEcCCC
Q 043567          597 EHLYLQKNSLSGPIPIALFRSSNLLTLDLRDNGFSGVIPHQINECSNLRFLLLRGNNLEGQIPNQICQLTGLGMMDLSHN  676 (911)
Q Consensus       597 ~~L~Ls~n~l~~~~p~~l~~~~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~ip~~l~~l~~L~~L~Ls~N  676 (911)
                      +.|++++|++++.+|..+..++.|+.|++++|.+++.+|..+..+++|++|++++|++.+.+|..+ ..++|+.|++++|
T Consensus       407 ~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n  485 (968)
T PLN00113        407 RRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRN  485 (968)
T ss_pred             CEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCC
Confidence            888888888888888888899999999999999999999888899999999999999999888765 4588999999999


Q ss_pred             cCCCCCCcccccccccccCCccccccccchhhhhccccccccccccccccCCCCCCCCCCcccccceeeeeeeccceeec
Q 043567          677 KFNGSIPSCFTNITLWSVGNLDRYRLEHLTFVERLDVNSIGIYYSSMLDMGQLSSEERGPFTFDYLVEVEFVTKNRYEVY  756 (911)
Q Consensus       677 ~l~g~ip~~~~~l~~~~~~~~~~~~~~~l~~l~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~  756 (911)
                      +++|.+|..+.++                                                                   
T Consensus       486 ~l~~~~~~~~~~l-------------------------------------------------------------------  498 (968)
T PLN00113        486 QFSGAVPRKLGSL-------------------------------------------------------------------  498 (968)
T ss_pred             ccCCccChhhhhh-------------------------------------------------------------------
Confidence            9999888766543                                                                   


Q ss_pred             cCCcCccccEEEcccCcccccCCccccCCCCCCEEECCCCcCCccccccccccCCCCEEeccCCcCcccCCCCCCCCCCC
Q 043567          757 NGSNLDYMVGLDLSCNKLTGEIPSEIGELQEIPVLNMSHNFLSESIPESFSNLKMIESLDLSHNRLSGQIPPKLTELNFL  836 (911)
Q Consensus       757 ~~~~l~~L~~LdLs~N~l~g~ip~~i~~l~~L~~L~Ls~N~l~g~ip~~l~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L  836 (911)
                           +.|+.|++++|+++|.+|+.++++++|++|+|++|.++|.+|..++++++|+.|||++|+++|.+|..+..+++|
T Consensus       499 -----~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L  573 (968)
T PLN00113        499 -----SELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESL  573 (968)
T ss_pred             -----hccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCccc
Confidence                 357789999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CeEeccCCcCeecCCCCCCCCccCccccCCCCCCCCCc
Q 043567          837 SNFNVSYNNLSGLIPDKGQFATFDESSYRGNLHLCGPT  874 (911)
Q Consensus       837 ~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gn~~lcg~~  874 (911)
                      +++++++|+++|.+|..++|.+|.+.+|.||+++||.+
T Consensus       574 ~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        574 VQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             CEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            99999999999999999999999999999999999865



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query911
3rgx_A768 Structural Insight Into Brassinosteroid Perception 7e-64
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 9e-64
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-12
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 1e-07
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 1e-04
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 2e-07
2z7x_B520 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 7e-07
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 4e-06
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 5e-06
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 2e-05
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 2e-05
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 3e-05
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 3e-05
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 4e-05
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 4e-05
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 4e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 7e-05
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 8e-05
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 9e-05
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 1e-04
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 1e-04
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 3e-04
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 8e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 242 bits (617), Expect = 7e-64, Method: Compositional matrix adjust. Identities = 223/727 (30%), Positives = 345/727 (47%), Gaps = 110/727 (15%) Query: 188 LRENNIQGSRTKQGLSKLKNLEALDLSSNFING---SLESQGICELKNLFVLNLEKNNIE 244 L ++I GS + G +L +LDLS N ++G +L S G C L LN+ N ++ Sbjct: 84 LSNSHINGSVS--GFKCSASLTSLDLSRNSLSGPVTTLTSLGSCS--GLKFLNVSSNTLD 139 Query: 245 DHLPNCLNN---MTRLKVLDISFNQLSGSFPSIISNLTS-----LEYLALFDNNFEGTFP 296 P ++ + L+VLD+S N +SG+ +++ + S L++LA+ N G Sbjct: 140 --FPGKVSGGLKLNSLEVLDLSANSISGA--NVVGWVLSDGCGELKHLAISGNKISGDVD 195 Query: 297 LSSLANHSKLEVLLLSTRNNMLQVQTENFLPTFQLKVLRLPNCSLNVIPPFLLHQFDLKY 356 +S N LE L +S+ N F + L +CS L++ Sbjct: 196 VSRCVN---LEFLDVSSNN-------------FSTGIPFLGDCSA------------LQH 227 Query: 357 LDLSHNDLDGAFPTWALQNNTKLEVLLLTNNSFTGNLQLPDDKHDFLHHLDISSNNFTGK 416 LD+S N L G F + A+ T+L++L +++N F G +P L +L ++ N FTG+ Sbjct: 228 LDISGNKLSGDF-SRAISTCTELKLLNISSNQFVG--PIPPLPLKSLQYLSLAENKFTGE 284 Query: 417 LPQDMGIILQKLLYMDMSNNHFEGNIAS-------------------------SIAEMKE 451 +P + L +D+S NHF G + ++ +M+ Sbjct: 285 IPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRG 344 Query: 452 LRFLDLSKNNFSGELSAALLTSCFSLLWLGLSDNNFYGRIFPGYMNLTQ-----LQYLYL 506 L+ LDLS N FSGEL +L SLL L LS NNF G I P NL Q LQ LYL Sbjct: 345 LKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILP---NLCQNPKNTLQELYL 401 Query: 507 ENNKFSGKIEEGLLKSKKLVELRMSSNMLSGHIPHWMGNLSYLEVLLMSKNFFEGNIPVQ 566 +NN F+GKI L +LV L +S N LSG IP +G+LS L L + N EG IP + Sbjct: 402 QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE 461 Query: 567 LLNHRRLQLFSVSENYLSGFMTTSF-NISSVEHLYLQKNSLSGPIPIALFRSSNLLTLDL 625 L+ + L+ + N L+G + + N +++ + L N L+G IP + R NL L L Sbjct: 462 LMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKL 521 Query: 626 RDNGFSGVIPHQINECSXXXXXXXXXXXXEGQIPNQICQLTGLGMMDLSHNKFNGSIPSC 685 +N FSG IP ++ +C L +DL+ N FNG+IP+ Sbjct: 522 SNNSFSGNIPAELGDCRS------------------------LIWLDLNTNLFNGTIPAA 557 Query: 686 FTNITLWSVGNLDRYRLEHLTFVERLDVNSIGIYYSSMLDMGQLSSEERGPFTFDYLVEV 745 + N + +++ + ++L+ + SE+ + + Sbjct: 558 MFKQSGKIAANFIAGK--RYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNI 615 Query: 746 EFVTKNRYEVYNGSNLDYMVGLDLSCNKLTGEIPSEIGELQEIPVLNMSHNFLSESIPES 805 + N M+ LD+S N L+G IP EIG + + +LN+ HN +S SIP+ Sbjct: 616 TSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDE 675 Query: 806 FSNLKMIESLDLSHNRLSGQIPPKLTELNFLSNFNVSYNNLSGLIPDKGQFATFDESSYR 865 +L+ + LDLS N+L G+IP ++ L L+ ++S NNLSG IP+ GQF TF + + Sbjct: 676 VGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFL 735 Query: 866 GNLHLCG 872 N LCG Sbjct: 736 NNPGLCG 742
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|2Z7X|B Chain B, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 520 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query911
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 0.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-81
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-80
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-75
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-71
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-56
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-41
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-23
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-18
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-74
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-74
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-67
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-49
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-36
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-69
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-60
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-55
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-54
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-47
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-45
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-37
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-33
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-67
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-63
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-62
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-55
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-55
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-46
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-39
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-65
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-62
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-49
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-47
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-32
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-30
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-62
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-53
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-49
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-44
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-39
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-31
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-56
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-55
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-34
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-50
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-49
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-29
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-28
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-20
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-46
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-44
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-41
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-28
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-46
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-41
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-42
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-39
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-35
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-25
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-35
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-35
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-20
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 8e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-35
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-32
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-31
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-18
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-14
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-34
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-31
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-34
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-29
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-27
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-25
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-19
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-17
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-30
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-20
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-29
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-28
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-22
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-26
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-26
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-21
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-28
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-28
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-27
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-27
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-26
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-11
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-25
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-19
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-19
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 6e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-23
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-16
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-24
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-06
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-24
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-23
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-23
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-19
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-17
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-12
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-23
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-22
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-17
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-23
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-23
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-05
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-21
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-21
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-21
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-20
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 8e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-20
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-19
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-18
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-18
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-18
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-18
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-18
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-17
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-16
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 8e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-14
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-12
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-09
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 6e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 8e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-11
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 1e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 4e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 7e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  567 bits (1463), Expect = 0.0
 Identities = 230/869 (26%), Positives = 354/869 (40%), Gaps = 118/869 (13%)

Query: 36  ACLKTERAALSEIKSFFIPFMDTQYEDPVLATWVDDGGMSSDCCNWKGVRCNATTGRVIQ 95
             L  E   L   K              +L  W      + + C + GV C     +V  
Sbjct: 8   QSLYREIHQLISFKDVLPD-------KNLLPDWSS----NKNPCTFDGVTCR--DDKVT- 53

Query: 96  LLLNDTSKFIEYSKNYTYGDMVLSLNVSLFHPFEELQSLDLSNNSFEGVYENQAYDTLGS 155
                                                S+DLS+      + +    +L S
Sbjct: 54  -------------------------------------SIDLSSKPLNVGF-SAVSSSLLS 75

Query: 156 LKRLKILNLGYNYFDDSIFLYLNALTSLTTLILRENNIQGS-RTKQGLSKLKNLEALDLS 214
           L  L+ L L  ++ + S+        SLT+L L  N++ G   T   L     L+ L++S
Sbjct: 76  LTGLESLFLSNSHINGSVSG-FKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVS 134

Query: 215 SNFINGSLESQGICELKNLFVLNLEKNNIEDHLPNCL---NNMTRLKVLDISFNQLSGSF 271
           SN ++   +  G  +L +L VL+L  N+I           +    LK L IS N++SG  
Sbjct: 135 SNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDV 194

Query: 272 PSIISNLTSLEYLALFDNNFEGTFPLSSLANHSKLEVLLLSTRNNMLQVQTENFLPTFQL 331
              +S   +LE+L +  NNF    P   L + S L+                        
Sbjct: 195 D--VSRCVNLEFLDVSSNNFSTGIP--FLGDCSALQ------------------------ 226

Query: 332 KVLRLPNCSLNVIPPFLLHQFDLKYLDLSHNDLDGAFPTWALQNNTKLEVLLLTNNSFTG 391
                                   +LD+S N L G F    +   T+L++L +++N F G
Sbjct: 227 ------------------------HLDISGNKLSGDFSRA-ISTCTELKLLNISSNQFVG 261

Query: 392 NLQLPDDKHDFLHHLDISSNNFTGKLPQDMGIILQKLLYMDMSNNHFEGNIASSIAEMKE 451
              +P      L +L ++ N FTG++P  +      L  +D+S NHF G +         
Sbjct: 262 --PIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSL 319

Query: 452 LRFLDLSKNNFSGELSAALLTSCFSLLWLGLSDNNFYGRIFPGYMNLT-QLQYLYLENNK 510
           L  L LS NNFSGEL    L     L  L LS N F G +     NL+  L  L L +N 
Sbjct: 320 LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 379

Query: 511 FSGKI--EEGLLKSKKLVELRMSSNMLSGHIPHWMGNLSYLEVLLMSKNFFEGNIPVQLL 568
           FSG I           L EL + +N  +G IP  + N S L  L +S N+  G IP  L 
Sbjct: 380 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 439

Query: 569 NHRRLQLFSVSENYLSGFMTTSF-NISSVEHLYLQKNSLSGPIPIALFRSSNLLTLDLRD 627
           +  +L+   +  N L G +      + ++E L L  N L+G IP  L   +NL  + L +
Sbjct: 440 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSN 499

Query: 628 NGFSGVIPHQINECSNLRFLLLRGNNLEGQIPNQICQLTGLGMMDLSHNKFNGSIPSCFT 687
           N  +G IP  I    NL  L L  N+  G IP ++     L  +DL+ N FNG+IP+   
Sbjct: 500 NRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMF 559

Query: 688 NITLWSVGNLDRYRLEHLTFVERLDVNSIGIYYSSMLDMGQLSSEERGPFTFDYLVEVEF 747
             +     N    +     +++   +        ++L+   + SE+    +      +  
Sbjct: 560 KQSGKIAANFIAGKR--YVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITS 617

Query: 748 VTKNRYEVYNGSNLDYMVGLDLSCNKLTGEIPSEIGELQEIPVLNMSHNFLSESIPESFS 807
                +      N   M+ LD+S N L+G IP EIG +  + +LN+ HN +S SIP+   
Sbjct: 618 RVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVG 677

Query: 808 NLKMIESLDLSHNRLSGQIPPKLTELNFLSNFNVSYNNLSGLIPDKGQFATFDESSYRGN 867
           +L+ +  LDLS N+L G+IP  ++ L  L+  ++S NNLSG IP+ GQF TF  + +  N
Sbjct: 678 DLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNN 737

Query: 868 LHLCGPTINKSCNGVEEIPATDSNREEGD 896
             LCG  + +      +  A         
Sbjct: 738 PGLCGYPLPRCDPSNADGYAHHQRSHHHH 766


>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query911
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.74
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.74
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.73
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.7
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.7
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.65
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.57
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.55
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.54
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.52
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.52
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.47
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.47
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.46
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.42
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.41
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.38
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.38
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.36
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.28
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.28
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.27
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.22
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.19
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.15
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.14
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.11
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.94
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.84
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.77
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.74
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.7
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.41
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.3
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.2
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.65
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.51
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.19
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.64
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.56
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.49
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.6e-95  Score=891.19  Aligned_cols=718  Identities=32%  Similarity=0.477  Sum_probs=562.7

Q ss_pred             cCCCCChHHHHHHHHHhhhcCCCCcCCCCCCCCcCCCCCCCCCCCCCccccceeecCCCCcEEEEecCCCCccccccccc
Q 043567           32 HGYKACLKTERAALSEIKSFFIPFMDTQYEDPVLATWVDDGGMSSDCCNWKGVRCNATTGRVIQLLLNDTSKFIEYSKNY  111 (911)
Q Consensus        32 ~~~~~c~~~~~~all~~k~~~~~~~~~~~~~~~l~~W~~~~~~~~~~C~w~gv~C~~~~~~v~~l~L~~~~~~~~~~~~~  111 (911)
                      +++..+.++||+|||+||+++.      ||. .+++|+.+    ++||+|+||+|+  +|||+++||++..+  .     
T Consensus         4 ~~~~~~~~~~~~all~~k~~~~------~~~-~l~~W~~~----~~~C~w~gv~C~--~~~v~~L~L~~~~l--~-----   63 (768)
T 3rgz_A            4 ASPSQSLYREIHQLISFKDVLP------DKN-LLPDWSSN----KNPCTFDGVTCR--DDKVTSIDLSSKPL--N-----   63 (768)
T ss_dssp             ----CCHHHHHHHHHHHHTTCS------CTT-SSTTCCTT----SCGGGSTTEEEE--TTEEEEEECTTSCC--C-----
T ss_pred             CccccCCHHHHHHHHHHHhhCC------Ccc-cccCCCCC----CCCcCCcceEEC--CCcEEEEECCCCCc--C-----
Confidence            3444568899999999999994      566 89999854    799999999998  68999999998875  1     


Q ss_pred             ccCCcccccccccccCCCCCCEEeCCCCCCCcccCcccccccCCCCCCcEEeCCCCCCCccchh--hhcCCCCCCEEEcC
Q 043567          112 TYGDMVLSLNVSLFHPFEELQSLDLSNNSFEGVYENQAYDTLGSLKRLKILNLGYNYFDDSIFL--YLNALTSLTTLILR  189 (911)
Q Consensus       112 ~~~~~~~~~~~s~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~--~l~~l~~L~~L~Ls  189 (911)
                        |. +..+. ..+..+++|+.++++.+.+.. .+    ..++++++|++|||++|.+.+.+|.  .++++++|++|+|+
T Consensus        64 --g~-~~~l~-~~l~~L~~L~~l~~~~~~~~~-l~----~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls  134 (768)
T 3rgz_A           64 --VG-FSAVS-SSLLSLTGLESLFLSNSHING-SV----SGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVS  134 (768)
T ss_dssp             --EE-HHHHH-HHTTTCTTCCEEECTTSCEEE-CC----CCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECC
T ss_pred             --Cc-cCccC-hhHhccCcccccCCcCCCcCC-Cc----hhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECc
Confidence              11 00121 356778888888888876643 22    5789999999999999999988888  89999999999999


Q ss_pred             CcccCCccChhhhcCCCCCCEEeCCCCCCCCccCccc--ccCCCCCCEEeccCCcCCCCCCcccCCCCCCcEEEccCCcC
Q 043567          190 ENNIQGSRTKQGLSKLKNLEALDLSSNFINGSLESQG--ICELKNLFVLNLEKNNIEDHLPNCLNNMTRLKVLDISFNQL  267 (911)
Q Consensus       190 ~n~l~~~~~~~~l~~l~~L~~L~Ls~n~l~~~i~~~~--~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~l  267 (911)
                      +|.+.+.++...+.++++|++||+++|.+++..+...  +.++++|++|++++|.+++..|  +..+++|++|++++|.+
T Consensus       135 ~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~--~~~l~~L~~L~Ls~n~l  212 (768)
T 3rgz_A          135 SNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD--VSRCVNLEFLDVSSNNF  212 (768)
T ss_dssp             SSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCB--CTTCTTCCEEECCSSCC
T ss_pred             CCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCC--cccCCcCCEEECcCCcC
Confidence            9999887775555889999999999999986555421  6888999999999999887655  37888999999999998


Q ss_pred             CccCcccccCCCCCCeeeccCCcCCCccChhhhcccccccEEEecCCCccccccccCcCCCCCceEEECCCCCCCCCChh
Q 043567          268 SGSFPSIISNLTSLEYLALFDNNFEGTFPLSSLANHSKLEVLLLSTRNNMLQVQTENFLPTFQLKVLRLPNCSLNVIPPF  347 (911)
Q Consensus       268 ~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~l~~l~~L~~L~L~~~~~~~~~~~~~~~~~~~L~~L~L~~n~l~~ip~~  347 (911)
                      ++.+|. ++++++|++|++++|.+++.+| ..+.++++|+                                        
T Consensus       213 ~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~-~~l~~l~~L~----------------------------------------  250 (768)
T 3rgz_A          213 STGIPF-LGDCSALQHLDISGNKLSGDFS-RAISTCTELK----------------------------------------  250 (768)
T ss_dssp             CSCCCB-CTTCCSCCEEECCSSCCCSCHH-HHTTTCSSCC----------------------------------------
T ss_pred             CCCCcc-cccCCCCCEEECcCCcCCCccc-HHHhcCCCCC----------------------------------------
Confidence            887776 8888999999999988887666 3444444444                                        


Q ss_pred             hhccCCCCEEECCCCCCCCCCchhhhhcCCcccEEEccCCccccccCCCCCC-CCCccEEEccCCcCCcCCChhHHHhcc
Q 043567          348 LLHQFDLKYLDLSHNDLDGAFPTWALQNNTKLEVLLLTNNSFTGNLQLPDDK-HDFLHHLDISSNNFTGKLPQDMGIILQ  426 (911)
Q Consensus       348 l~~~~~L~~L~Ls~n~l~~~~p~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~-~~~L~~L~ls~n~l~~~ip~~~~~~l~  426 (911)
                              +|++++|.+++.+|..   .+++|++|++++|.+++..+..... +++|++|++++|.+++.+|..+.. ++
T Consensus       251 --------~L~Ls~n~l~~~~~~~---~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~-l~  318 (768)
T 3rgz_A          251 --------LLNISSNQFVGPIPPL---PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGS-CS  318 (768)
T ss_dssp             --------EEECCSSCCEESCCCC---CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGG-CT
T ss_pred             --------EEECCCCcccCccCcc---ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhc-CC
Confidence                    4444444444444432   4455555555555555443333322 366777777777777777777754 78


Q ss_pred             CCcEEEcccCccccccchh-hhcCCCCcEEeccCcccCCcccHHHHhccc-ccceeeccCcccccccCCCCCC--CCCCC
Q 043567          427 KLLYMDMSNNHFEGNIASS-IAEMKELRFLDLSKNNFSGELSAALLTSCF-SLLWLGLSDNNFYGRIFPGYMN--LTQLQ  502 (911)
Q Consensus       427 ~L~~L~Ls~n~l~~~~p~~-l~~l~~L~~L~Ls~n~l~g~i~~~~~~~~~-~L~~L~L~~n~l~~~~~~~~~~--l~~L~  502 (911)
                      +|++|++++|.++|.+|.. +..+++|++|++++|+++|.+|..+. .++ +|+.|++++|.+++.+++.+..  +++|+
T Consensus       319 ~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~-~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~  397 (768)
T 3rgz_A          319 LLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT-NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQ  397 (768)
T ss_dssp             TCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHH-HHTTTCSEEECCSSEEEEECCTTTTCSTTCCCC
T ss_pred             CccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHH-hhhcCCcEEEccCCCcCCCcChhhhhcccCCcc
Confidence            8888888888888777765 77888888888888888877777654 444 8888888888888888877766  78899


Q ss_pred             EEEccCccccccccccccCCCCCcEEECcCCcCcccCCcCccCcCCCcEEEccCcccccccchhhccCCCCcEEEccCcc
Q 043567          503 YLYLENNKFSGKIEEGLLKSKKLVELRMSSNMLSGHIPHWMGNLSYLEVLLMSKNFFEGNIPVQLLNHRRLQLFSVSENY  582 (911)
Q Consensus       503 ~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~ls~n~  582 (911)
                      +|++++|++++.+|..+..+++|++|++++|++++.+|..++.+++|+.|++++|.+++.+|..+..+++|++|++++|+
T Consensus       398 ~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~  477 (768)
T 3rgz_A          398 ELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND  477 (768)
T ss_dssp             EEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSC
T ss_pred             EEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCc
Confidence            99999999988888888889999999999999988888889999999999999999998899889899999999999999


Q ss_pred             cccccCccc-ccccccEEEcccCcccccccccccCCCCCCEEeCCCCcccccCchhhhcCCCccEEEccCCcccccCChh
Q 043567          583 LSGFMTTSF-NISSVEHLYLQKNSLSGPIPIALFRSSNLLTLDLRDNGFSGVIPHQINECSNLRFLLLRGNNLEGQIPNQ  661 (911)
Q Consensus       583 l~~~~~~~~-~~~~L~~L~Ls~n~l~~~~p~~l~~~~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~ip~~  661 (911)
                      +++.+|..+ ++++|++|++++|++++.+|..++.+++|++|++++|+++|.+|..++.+++|++|++++|+++|.+|..
T Consensus       478 l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~  557 (768)
T 3rgz_A          478 LTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAA  557 (768)
T ss_dssp             CCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGG
T ss_pred             ccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChH
Confidence            998888877 8889999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             hhcCCCCCeEEcCCC---------c-------------CCCCCCcccccccccccCCccccccccchhhhhccccccccc
Q 043567          662 ICQLTGLGMMDLSHN---------K-------------FNGSIPSCFTNITLWSVGNLDRYRLEHLTFVERLDVNSIGIY  719 (911)
Q Consensus       662 l~~l~~L~~L~Ls~N---------~-------------l~g~ip~~~~~l~~~~~~~~~~~~~~~l~~l~~l~~~~~~~~  719 (911)
                      +.....+..+++..+         .             +.|.+|..+..+..                ...+++....  
T Consensus       558 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~----------------~~~~~l~~~~--  619 (768)
T 3rgz_A          558 MFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLST----------------RNPCNITSRV--  619 (768)
T ss_dssp             GGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGG----------------TCCSCTTSCE--
T ss_pred             Hhcccchhhhhccccccccccccccccccccccccccccccccchhhhcccc----------------ccccccccce--
Confidence            888776655544431         1             11222222211110                0000000000  


Q ss_pred             cccccccCCCCCCCCCCcccccceeeeeeeccceeeccCCcCccccEEEcccCcccccCCccccCCCCCCEEECCCCcCC
Q 043567          720 YSSMLDMGQLSSEERGPFTFDYLVEVEFVTKNRYEVYNGSNLDYMVGLDLSCNKLTGEIPSEIGELQEIPVLNMSHNFLS  799 (911)
Q Consensus       720 ~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~LdLs~N~l~g~ip~~i~~l~~L~~L~Ls~N~l~  799 (911)
                                                 +  .+.. ......++.|+.||||+|+++|.||.+|+++++|+.|||++|+++
T Consensus       620 ---------------------------~--~g~~-~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~  669 (768)
T 3rgz_A          620 ---------------------------Y--GGHT-SPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDIS  669 (768)
T ss_dssp             ---------------------------E--EEEC-CCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCC
T ss_pred             ---------------------------e--cccC-chhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccC
Confidence                                       0  0000 001134678999999999999999999999999999999999999


Q ss_pred             ccccccccccCCCCEEeccCCcCcccCCCCCCCCCCCCeEeccCCcCeecCCCCCCCCccCccccCCCCCCCCCccCCCC
Q 043567          800 ESIPESFSNLKMIESLDLSHNRLSGQIPPKLTELNFLSNFNVSYNNLSGLIPDKGQFATFDESSYRGNLHLCGPTINKSC  879 (911)
Q Consensus       800 g~ip~~l~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gn~~lcg~~l~~~c  879 (911)
                      |.||+.++++++|++||||+|+++|.||..++++++|++||||+|+++|+||+++||.+|...+|.|||+|||+|+. +|
T Consensus       670 g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C  748 (768)
T 3rgz_A          670 GSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RC  748 (768)
T ss_dssp             SCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC-CC
T ss_pred             CCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc-CC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999987 89


Q ss_pred             CCCCC
Q 043567          880 NGVEE  884 (911)
Q Consensus       880 ~~~~~  884 (911)
                      ....+
T Consensus       749 ~~~~~  753 (768)
T 3rgz_A          749 DPSNA  753 (768)
T ss_dssp             CSCC-
T ss_pred             CCCcc
Confidence            76544



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 911
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-17
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-09
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-13
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-12
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-06
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 9e-07
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 9e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 9e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 7e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 8e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 6e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 7e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 9e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 83.9 bits (206), Expect = 1e-17
 Identities = 77/410 (18%), Positives = 137/410 (33%), Gaps = 61/410 (14%)

Query: 449 MKELRFLDLSKNNFSGELSAALLTSCFSLLWLGLSDNNFYGRIFPGYMNLTQLQYLYLEN 508
           + E     L K N +  +S   L     +  L         +   G   L  L  +   N
Sbjct: 21  LAEKMKTVLGKTNVTDTVSQTDLDQ---VTTLQADRLGI--KSIDGVEYLNNLTQINFSN 75

Query: 509 NKFSGKIEEGLLKSKKLVELRMSSNMLSGHIPHWMGNLSYLEVLLMSKNFFEGNIPVQLL 568
           N+ +       L   KLV++ M++N ++   P           L  ++      +     
Sbjct: 76  NQLTDITPLKNL--TKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTN 133

Query: 569 NHRRLQLFSVSENYLSGFMTTSFNISSVEHLYLQKNSLSGPIPIAL-------------- 614
            +R     +   +  +    TS    S  +       L+    +                
Sbjct: 134 LNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVL 193

Query: 615 FRSSNLLTLDLRDNGFSGVIPHQINECSNLRFLLLRGNNLEGQIPNQICQLTGLGMMDLS 674
            + +NL +L   +N  S + P  I   +NL  L L GN L+      +  LT L  +DL+
Sbjct: 194 AKLTNLESLIATNNQISDITPLGI--LTNLDELSLNGNQLKD--IGTLASLTNLTDLDLA 249

Query: 675 HNKFNGSIPSCFTNITLWSVGNLDRYRLEHLTFVERLDVNSIGIYYSSMLDMGQLSSEER 734
           +N+ +   P                  L  LT +  L + +  I   S L          
Sbjct: 250 NNQISNLAP------------------LSGLTKLTELKLGANQISNISPL---------- 281

Query: 735 GPFTFDYLVEVEFVTKNRYEVYNGSNLDYMVGLDLSCNKLTGEIPSEIGELQEIPVLNMS 794
                  L  +E       ++   SNL  +  L L  N ++   P  +  L ++  L  +
Sbjct: 282 --AGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISP--VSSLTKLQRLFFA 337

Query: 795 HNFLSESIPESFSNLKMIESLDLSHNRLSGQIPPKLTELNFLSNFNVSYN 844
           +N +S+    S +NL  I  L   HN++S   P  L  L  ++   ++  
Sbjct: 338 NNKVSD--VSSLANLTNINWLSAGHNQISDLTP--LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query911
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.84
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.75
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.69
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.66
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.64
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.63
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.62
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.55
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.4
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.4
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.39
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.39
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.38
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.38
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.2
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.13
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.02
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.01
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.26
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.91
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.72
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.51
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.08
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.81
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=5.1e-37  Score=331.23  Aligned_cols=295  Identities=24%  Similarity=0.359  Sum_probs=205.3

Q ss_pred             CChHHHHHHHHHhhhcCCCCcCCCCCCCCcCCCCCCCCCCCCCcc--ccceeecCCC--CcEEEEecCCCCccccccccc
Q 043567           36 ACLKTERAALSEIKSFFIPFMDTQYEDPVLATWVDDGGMSSDCCN--WKGVRCNATT--GRVIQLLLNDTSKFIEYSKNY  111 (911)
Q Consensus        36 ~c~~~~~~all~~k~~~~~~~~~~~~~~~l~~W~~~~~~~~~~C~--w~gv~C~~~~--~~v~~l~L~~~~~~~~~~~~~  111 (911)
                      -|+++||+||++||+++.      +| ..+++|..+    +|||.  |+||+|+..+  +||+.+||++..+  .     
T Consensus         2 ~c~~~e~~aLl~~k~~~~------~~-~~l~sW~~~----~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l--~-----   63 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLG------NP-TTLSSWLPT----TDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNL--P-----   63 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTT------CC-GGGTTCCTT----SCTTTTCSTTEEECCSSSCCCEEEEEEECCCC--S-----
T ss_pred             CCCHHHHHHHHHHHHHCC------CC-CcCCCCCCC----CCCCCCcCCCeEEeCCCCcEEEEEEECCCCCC--C-----
Confidence            499999999999999995      33 469999865    79994  9999998744  4899999988765  1     


Q ss_pred             ccCCcccccccccccCCCCCCEEeCCC-CCCCcccCcccccccCCCCCCcEEeCCCCCCCccchhhhcCCCCCCEEEcCC
Q 043567          112 TYGDMVLSLNVSLFHPFEELQSLDLSN-NSFEGVYENQAYDTLGSLKRLKILNLGYNYFDDSIFLYLNALTSLTTLILRE  190 (911)
Q Consensus       112 ~~~~~~~~~~~s~~~~l~~L~~L~Ls~-n~l~~~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~  190 (911)
                        |.  ..+ +..+..+++|++|||++ |.++|.+|    ..++++++|++|+|++|++.+..+..+..+.+|+++++++
T Consensus        64 --g~--~~l-p~~l~~L~~L~~L~Ls~~N~l~g~iP----~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~  134 (313)
T d1ogqa_          64 --KP--YPI-PSSLANLPYLNFLYIGGINNLVGPIP----PAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSY  134 (313)
T ss_dssp             --SC--EEC-CGGGGGCTTCSEEEEEEETTEESCCC----GGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCS
T ss_pred             --CC--CCC-ChHHhcCccccccccccccccccccc----cccccccccchhhhccccccccccccccchhhhccccccc
Confidence              11  111 13566777777777775 66776666    5677777777777777777777777777777777777777


Q ss_pred             cccCCccChhhhcCCCCCCEEeCCCCCCCCccCcccccCCCCC-CEEeccCCcCCCCCCcccCCCCCCcEEEccCCcCCc
Q 043567          191 NNIQGSRTKQGLSKLKNLEALDLSSNFINGSLESQGICELKNL-FVLNLEKNNIEDHLPNCLNNMTRLKVLDISFNQLSG  269 (911)
Q Consensus       191 n~l~~~~~~~~l~~l~~L~~L~Ls~n~l~~~i~~~~~~~l~~L-~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~  269 (911)
                      |.+.+.+| ..+.++++|+++++++|.+.|.+|.. +..+..+ +.+++++|++++..|..+..+..+ .++++.+...+
T Consensus       135 N~~~~~~p-~~l~~l~~L~~l~l~~n~l~~~ip~~-~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~  211 (313)
T d1ogqa_         135 NALSGTLP-PSISSLPNLVGITFDGNRISGAIPDS-YGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEG  211 (313)
T ss_dssp             SEEESCCC-GGGGGCTTCCEEECCSSCCEEECCGG-GGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEE
T ss_pred             ccccccCc-hhhccCcccceeeccccccccccccc-cccccccccccccccccccccccccccccccc-ccccccccccc
Confidence            77666665 45677777777777777777666653 5555554 667777777777666666665443 57777777776


Q ss_pred             cCcccccCCCCCCeeeccCCcCCCccChhhhcccccccEEEecCCCccccccccCcCCCCCceEEECCCCCCC-CCChhh
Q 043567          270 SFPSIISNLTSLEYLALFDNNFEGTFPLSSLANHSKLEVLLLSTRNNMLQVQTENFLPTFQLKVLRLPNCSLN-VIPPFL  348 (911)
Q Consensus       270 ~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~l~~l~~L~~L~L~~~~~~~~~~~~~~~~~~~L~~L~L~~n~l~-~ip~~l  348 (911)
                      .+|..+..+++++.+++++|.+.+.+|  .+                         ...++|+.|++++|++. .+|+++
T Consensus       212 ~~~~~~~~~~~l~~l~~~~~~l~~~~~--~~-------------------------~~~~~L~~L~Ls~N~l~g~iP~~l  264 (313)
T d1ogqa_         212 DASVLFGSDKNTQKIHLAKNSLAFDLG--KV-------------------------GLSKNLNGLDLRNNRIYGTLPQGL  264 (313)
T ss_dssp             CCGGGCCTTSCCSEEECCSSEECCBGG--GC-------------------------CCCTTCCEEECCSSCCEECCCGGG
T ss_pred             ccccccccccccccccccccccccccc--cc-------------------------ccccccccccCccCeecccCChHH
Confidence            677777777777777777776665444  22                         23345556666677774 677777


Q ss_pred             hccCCCCEEECCCCCCCCCCchhhhhcCCcccEEEccCCcc
Q 043567          349 LHQFDLKYLDLSHNDLDGAFPTWALQNNTKLEVLLLTNNSF  389 (911)
Q Consensus       349 ~~~~~L~~L~Ls~n~l~~~~p~~~~~~l~~L~~L~L~~n~l  389 (911)
                      .++++|++|+|++|+++|.+|..  .++++|+.+++++|+.
T Consensus       265 ~~L~~L~~L~Ls~N~l~g~iP~~--~~L~~L~~l~l~~N~~  303 (313)
T d1ogqa_         265 TQLKFLHSLNVSFNNLCGEIPQG--GNLQRFDVSAYANNKC  303 (313)
T ss_dssp             GGCTTCCEEECCSSEEEEECCCS--TTGGGSCGGGTCSSSE
T ss_pred             hCCCCCCEEECcCCcccccCCCc--ccCCCCCHHHhCCCcc
Confidence            77778888888888887777752  4667777777777763



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure