Citrus Sinensis ID: 043585

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------
MNPIENEGGVSVKELFEGHGQITGLFLNNLSPMSLKGAVELGRADIIHSHGKPTKTSNPFRFMQEDYDLTPISTLLIKDKSYCLSPLVSGILDPDNIFLLHFISKLFKGNDVSVWETVRGMKHWEIMSQNPRLSQRFNQAMVNDSEMATFIVKDCCRTLIERLGSMVDVGGGNVLDLPHAVANTPQTENLKYVADDMFQFIPPADAYFFMLFFHAFGGEDSLKILKKCREAIAGNGQRGKVLIMDIVINEKEDEDQRTDKEWKTLFLDAGFTCCKITTMFGLKSLIK
cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcccccccccccccccccccccccEEEccccccccHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEcccHHHHHccccccccccccccccccccccccHHHHHHcccccHHHHHHHHHHHHHHHcccccccEEEEEEEEEccccccccccHHHHHHHHHHccccccEEEEEcccccccc
cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccccccHHHHHHHHHHHHcccHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHccccHHHHccccHHHHHHHHHHHHccHHHHHHHHHHHHccccccccEEEEcccccEcEcccccccccccccEEEEEccccccccccccEEcccccccccHHHHHHHHHHHHHHccccccccEEEEEEEEEEcccccccccHHHHHHHHHHccccccEEEEEcccEEEcc
mnpieneggvsVKELFEGHgqitglflnnlspmslKGAVELGRAdiihshgkptktsnpfrfmqedydltpistllikdksyclsplvsgildpdnIFLLHFISKLFKGNDVSVWETVRGMKHweimsqnprlsQRFNQAMVNDSEMATFIVKDCCRTLIERLGSmvdvgggnvldlphavantpqtenLKYVADDmfqfippadaYFFMLFFHAFGGEDSLKILKKCREAIAGNGQRGKVLIMDIVInekededqrtDKEWKTLFLDAGFTCCKITTMFGLKSLIK
mnpienegGVSVKELFEGHGQITGLFLNNLSPMSLKGAVELGRADIIHshgkptktsnpfrFMQEDYDLTPISTLLIKDKSYCLSPLVSGILDPDNIFLLHFISKLFKGNDVSVWETVRGMKHWEIMSQNPRLSQRFNQAMVNDSEMATFIVKDCCRTLIERLGSMVDVGGGNVLDLPHAVANTPQTENLKYVADDMFQFIPPADAYFFMLFFHAFGGEDSLKILKKCREaiagngqrgkvlIMDIVInekededqrtdKEWKTLFLDAGFTCCKITTMFGLKSLIK
MNPIENEGGVSVKELFEGHGQITGLFLNNLSPMSLKGAVELGRADIIHSHGKPTKTSNPFRFMQEDYDLTPISTLLIKDKSYCLSPLVSGILDPDNIFLLHFISKLFKGNDVSVWETVRGMKHWEIMSQNPRLSQRFNQAMVNDSEMATFIVKDCCRTLIERLGSMVDVGGGNVLDLPHAVANTPQTENLKYVADDMFQFIPPADAYFFMLFFHAFGGEDSLKILKKCREAIAGNGQRGKVLIMDIVINEKEDEDQRTDKEWKTLFLDAGFTCCKITTMFGLKSLIK
***********VKELFEGHGQITGLFLNNLSPMSLKGAVELGRADIIHS*********PFRFMQEDYDLTPISTLLIKDKSYCLSPLVSGILDPDNIFLLHFISKLFKGNDVSVWETVRGMKHWEIMSQNPRLSQRFNQAMVNDSEMATFIVKDCCRTLIERLGSMVDVGGGNVLDLPHAVANTPQTENLKYVADDMFQFIPPADAYFFMLFFHAFGGEDSLKILKKCREAIAGNGQRGKVLIMDIVINE********DKEWKTLFLDAGFTCCKITTMFGLKS***
*****************GHGQITGLFLNNLSPMSLKGAVELGRADIIHSHGKPTKTSNPFRFMQEDYDLTPISTLLIKDKSYCLSPLVSGILDPDNIFLLHFISKLFKGNDVSVWETVRGMKHWEIMSQNPRLSQRFNQAMVNDSEMATFIVKDCCRTLIERLGSMVDVGGGNVLDLPHAVANTPQTENLKYVADDMFQFIPPADAYFFMLFFHAFGGEDSLKILKKCREAIAGNGQRGKVLIMDIVINEKEDEDQRTDKEWKTLFLDAGFTCCKITTMFGLKSLIK
********GVSVKELFEGHGQITGLFLNNLSPMSLKGAVELGRADIIHSHGKPTKTSNPFRFMQEDYDLTPISTLLIKDKSYCLSPLVSGILDPDNIFLLHFISKLFKGNDVSVWETVRGMKHWEIMSQNPRLSQRFNQAMVNDSEMATFIVKDCCRTLIERLGSMVDVGGGNVLDLPHAVANTPQTENLKYVADDMFQFIPPADAYFFMLFFHAFGGEDSLKILKKCREAIAGNGQRGKVLIMDIVINEKEDEDQRTDKEWKTLFLDAGFTCCKITTMFGLKSLIK
***********VKELFEGHGQITGLFLNNLSPMSLKGAVELGRADIIHSHGKPTKTSNPFRFMQEDYDLTPISTLLIKDKSYCLSPLVSGILDPDNIFLLHFISKLFKGNDVSVWETVRGMKHWEIMSQNPRLSQRFNQAMVNDSEMATFIVKDCCRTLIERLGSMVDVGGGNVLDLPHAVANTPQTENLKYVADDMFQFIPPADAYFFMLFFHAFGGEDSLKILKKCREAIAGNGQRGKVLIMDIVINEKEDEDQRTDKEWKTLFLDAGFTCCKITTMFGLKSLIK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPIENEGGVSVKELFEGHGQITGLFLNNLSPMSLKGAVELGRADIIHSHGKPTKTSNPFRFMQEDYDLTPISTLLIKDKSYCLSPLVSGILDPDNIFLLHFISKLFKGNDVSVWETVRGMKHWEIMSQNPRLSQRFNQAMVNDSEMATFIVKDCCRTLIERLGSMVDVGGGNVLDLPHAVANTPQTENLKYVADDMFQFIPPADAYFFMLFFHAFGGEDSLKILKKCREAIAGNGQRGKVLIMDIVINEKEDEDQRTDKEWKTLFLDAGFTCCKITTMFGLKSLIK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query287 2.2.26 [Sep-21-2011]
O22309352 Isoflavone-7-O-methyltran N/A no 0.968 0.789 0.328 9e-45
B6VJS4357 Trans-resveratrol di-O-me no no 0.972 0.781 0.332 1e-44
Q84KK5357 Isoflavone 7-O-methyltran N/A no 0.968 0.778 0.326 1e-44
O22308352 Isoflavone-7-O-methyltran N/A no 0.968 0.789 0.325 3e-44
O24529352 Isoflavone-7-O-methyltran N/A no 0.968 0.789 0.322 1e-43
Q84KK4365 Isoflavone 4'-O-methyltra N/A no 0.951 0.747 0.333 2e-41
C6TAY1358 Flavonoid 4'-O-methyltran no no 0.986 0.790 0.311 2e-39
O24305360 6a-hydroxymaackiain methy N/A no 0.968 0.772 0.321 4e-39
Q6VMW0366 8-hydroxyquercetin 8-O-me N/A no 0.975 0.765 0.321 4e-39
Q93WU3356 Chavicol O-methyltransfer N/A no 0.972 0.783 0.295 3e-37
>sp|O22309|7OMT9_MEDSA Isoflavone-7-O-methyltransferase 9 OS=Medicago sativa PE=2 SV=1 Back     alignment and function desciption
 Score =  180 bits (457), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 113/344 (32%), Positives = 162/344 (47%), Gaps = 66/344 (19%)

Query: 9   GVSVKELFEGHGQITGLFLNNLSPMSLKGAVELGRADIIHSHGKPTKTSNPFRFMQ---- 64
           G    E+F+    +       +  MSLK AV +   +IIH+HGKP   SN    +Q    
Sbjct: 7   GRKPSEIFKAQALLYKHIYAFIDSMSLKWAVGMNIPNIIHNHGKPISLSNLVSILQVPSS 66

Query: 65  -------------------------EDYDLTPISTLLIKDKSYCLSPLVSGILDPDNIFL 99
                                    E Y LT  S LL++    CL+P+V  +LDP     
Sbjct: 67  KIGNVRRLMRYLAHNGFFEIITKEEESYALTVASELLVRGSDLCLAPMVECVLDPTLSGS 126

Query: 100 LHFISKLFKGNDVSVWETVRGMKHWEIMSQNPRLSQRFNQAMVNDSEMATFIVKDCCRTL 159
            H + K     D++++    G   W+ + +NP  +  FN AM +DS++    ++DC   +
Sbjct: 127 YHELKKWIYEEDLTLFGVTLGSGFWDFLDKNPEYNTSFNDAMASDSKLINLALRDC-DFV 185

Query: 160 IERLGSMVDVGGGN-----------------VLDLPHAVANTPQTENLKYVADDMFQFIP 202
            + L S+VDVGGG                  V D P  V N   + NL YV  DMF  IP
Sbjct: 186 FDGLESIVDVGGGTGTTAKIICETFPKLKCIVFDRPQVVENLSGSNNLTYVGGDMFTSIP 245

Query: 203 PADAYFFMLFFHAFGGEDSLKILKKCREAIAGNGQRGKVLIMDIVINEKEDEDQ------ 256
            ADA       H +  +D L+ILKKC+EA+  +G+RGKV I+D+VINEK+DE+Q      
Sbjct: 246 NADAVLLKYILHNWTDKDCLRILKKCKEAVTNDGKRGKVTIIDMVINEKKDENQVTQIKL 305

Query: 257 -------------RTDKEWKTLFLDAGFTCCKITTMFGLKSLIK 287
                        R ++EWK LF++AGF   KI+ + G  SLI+
Sbjct: 306 LMDVNMACLNGKERNEEEWKKLFIEAGFQHYKISPLTGFLSLIE 349
Transfers a methyl group to 7-hydroxyls of the isoflavones daidzein, genistein and 6,7,4'-trihydroxyisoflavone. Can also methylate (+)6a-hydroxymaackiain with lower efficiency.
Medicago sativa (taxid: 3879)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 5EC: 0
>sp|B6VJS4|ROMT_VITVI Trans-resveratrol di-O-methyltransferase OS=Vitis vinifera GN=ROMT PE=1 SV=2 Back     alignment and function description
>sp|Q84KK5|D7OMT_GLYEC Isoflavone 7-O-methyltransferase OS=Glycyrrhiza echinata GN=D7OMT PE=1 SV=1 Back     alignment and function description
>sp|O22308|7OMT6_MEDSA Isoflavone-7-O-methyltransferase 6 OS=Medicago sativa PE=2 SV=1 Back     alignment and function description
>sp|O24529|7OMT8_MEDSA Isoflavone-7-O-methyltransferase 8 OS=Medicago sativa PE=1 SV=1 Back     alignment and function description
>sp|Q84KK4|I4OMT_LOTJA Isoflavone 4'-O-methyltransferase OS=Lotus japonicus GN=HI4'OMT PE=1 SV=1 Back     alignment and function description
>sp|C6TAY1|SOMT2_SOYBN Flavonoid 4'-O-methyltransferase OS=Glycine max PE=1 SV=1 Back     alignment and function description
>sp|O24305|M3OM1_PEA 6a-hydroxymaackiain methyltransferase 1 OS=Pisum sativum GN=HMM1 PE=1 SV=1 Back     alignment and function description
>sp|Q6VMW0|Q8OMT_MENPI 8-hydroxyquercetin 8-O-methyltransferase OS=Mentha piperita GN=OMT2 PE=1 SV=1 Back     alignment and function description
>sp|Q93WU3|CVMT1_OCIBA Chavicol O-methyltransferase OS=Ocimum basilicum GN=CVOMT1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query287
224116348372 flavonoid o-methyltransferase related [P 0.982 0.758 0.378 1e-57
224077038359 flavonoid o-methyltransferase related [P 0.986 0.788 0.380 9e-57
255562994359 o-methyltransferase, putative [Ricinus c 0.951 0.760 0.374 8e-55
255563164355 o-methyltransferase, putative [Ricinus c 0.951 0.769 0.364 4e-53
225443568361 PREDICTED: isoflavone-7-O-methyltransfer 0.986 0.783 0.378 8e-53
359483934358 PREDICTED: isoflavone-7-O-methyltransfer 0.989 0.793 0.371 3e-52
225443574358 PREDICTED: isoflavone-7-O-methyltransfer 0.989 0.793 0.368 9e-52
225443570354 PREDICTED: isoflavone-7-O-methyltransfer 0.968 0.785 0.365 4e-51
356576577354 PREDICTED: isoflavone 7-O-methyltransfer 0.951 0.771 0.377 5e-51
147788173354 hypothetical protein VITISV_009881 [Viti 0.968 0.785 0.363 2e-50
>gi|224116348|ref|XP_002331960.1| flavonoid o-methyltransferase related [Populus trichocarpa] gi|222874737|gb|EEF11868.1| flavonoid o-methyltransferase related [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  229 bits (583), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 136/359 (37%), Positives = 193/359 (53%), Gaps = 77/359 (21%)

Query: 1   MNPIENEGGVSVKELFEGHGQITGLFLNNLSPMSLKGAVELGRADIIHSHGKP------- 53
           ++PI+ +      ELF+    + G   N L+ MSL  A +LG  DIIH+HG+P       
Sbjct: 16  IDPIQEQ---KATELFQAQTHLYGQMFNYLNSMSLVCAAQLGIPDIIHNHGRPITLPELV 72

Query: 54  -------TKTSNPFRFMQ---------------------EDYDLTPISTLLIKDKSYCLS 85
                   K+S  +R M+                     E Y LTP S LL+KD + CLS
Sbjct: 73  SALHIPPNKSSCIYRLMRMLVHSGFFATTKAVIGQGGGGEAYVLTPPSQLLVKDNTNCLS 132

Query: 86  PLVSGILDPDNIFLLHFISKLFKGNDVSVWETVRGMKHWEIMSQNPRLSQRFNQAMVNDS 145
           P +S +++P  +   H +   F+G++ + ++   GM  WE  +QNP L+  FN AM  DS
Sbjct: 133 PFMS-LINPAFVTPWHSLGDWFRGSEPTAFQQAYGMAFWEYNNQNPELNGLFNAAMACDS 191

Query: 146 EMATFIVKDCCRTLIERLGSMVDVGGGN-----------------VLDLPHAVANTPQTE 188
           +M   +++DC + + E L SMVDVGGG                  VL++P  +AN   TE
Sbjct: 192 QMMNLVIRDC-KPIFEGLDSMVDVGGGTGSLARIISETFPHMNCTVLEIPQVIANLEGTE 250

Query: 189 NLKYVADDMFQFIPPADAYFFMLFFHAFGGEDSLKILKKCREAIAGNGQRGKVLIMDIVI 248
           NLKYV  DMFQ IP ADA    L FH +  ED +KILKKC+EAI+   + GKV+I+D+VI
Sbjct: 251 NLKYVGGDMFQHIPSADAVLLKLIFHGWSDEDCVKILKKCKEAISSKEKGGKVIIVDVVI 310

Query: 249 NEKEDE--------------------DQRTDKEWKTLFLDAGFTCCKITTMFGLKSLIK 287
           NEK+DE                     +R+ +EW+ LFL+AGF+  KIT++FGL+SLI+
Sbjct: 311 NEKKDEHELTETKLLFDMLMMVVAAGKERSVEEWERLFLEAGFSHYKITSLFGLRSLIE 369

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224077038|ref|XP_002305103.1| flavonoid o-methyltransferase related [Populus trichocarpa] gi|222848067|gb|EEE85614.1| flavonoid o-methyltransferase related [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255562994|ref|XP_002522501.1| o-methyltransferase, putative [Ricinus communis] gi|223538192|gb|EEF39801.1| o-methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255563164|ref|XP_002522586.1| o-methyltransferase, putative [Ricinus communis] gi|223538277|gb|EEF39886.1| o-methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225443568|ref|XP_002278092.1| PREDICTED: isoflavone-7-O-methyltransferase 9 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483934|ref|XP_003633039.1| PREDICTED: isoflavone-7-O-methyltransferase 9 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225443574|ref|XP_002278208.1| PREDICTED: isoflavone-7-O-methyltransferase 9 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225443570|ref|XP_002278127.1| PREDICTED: isoflavone-7-O-methyltransferase 9 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356576577|ref|XP_003556407.1| PREDICTED: isoflavone 7-O-methyltransferase-like [Glycine max] Back     alignment and taxonomy information
>gi|147788173|emb|CAN75970.1| hypothetical protein VITISV_009881 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query287
UNIPROTKB|Q84KK5357 D7OMT "Isoflavone 7-O-methyltr 0.717 0.577 0.328 9.2e-36
UNIPROTKB|Q6VMW0366 OMT2 "8-hydroxyquercetin 8-O-m 0.320 0.251 0.406 2.5e-33
UNIPROTKB|B0EXJ8355 16OMT "Tabersonine 16-O-methyl 0.275 0.222 0.475 4.7e-33
UNIPROTKB|Q84KK4365 HI4'OMT "Isoflavone 4'-O-methy 0.456 0.358 0.371 5.4e-25
UNIPROTKB|A8QW53374 OMT3 "5-pentadecatrienyl resor 0.282 0.216 0.373 5.6e-24
UNIPROTKB|Q84KK6367 HI4'OMT "Isoflavone 4'-O-methy 0.456 0.356 0.378 2.2e-22
UNIPROTKB|Q8GSN1348 Q8GSN1 "Myricetin O-methyltran 0.675 0.557 0.265 1.6e-18
TAIR|locus:2132806382 AT4G35160 [Arabidopsis thalian 0.365 0.274 0.379 2e-16
TAIR|locus:2132801325 AT4G35150 [Arabidopsis thalian 0.337 0.298 0.394 1.2e-13
TAIR|locus:2015223381 AT1G63140 [Arabidopsis thalian 0.508 0.383 0.263 1.6e-09
UNIPROTKB|Q84KK5 D7OMT "Isoflavone 7-O-methyltransferase" [Glycyrrhiza echinata (taxid:46348)] Back     alignment and assigned GO terms
 Score = 328 (120.5 bits), Expect = 9.2e-36, Sum P(2) = 9.2e-36
 Identities = 74/225 (32%), Positives = 117/225 (52%)

Query:    65 EDYDLTPISTLLIKDKSYCLSPLVSGILDPDNIFLLHFISKLFKGNDVSVWETVRGMKHW 124
             E Y LT  S LL+K    CL+P+V  +LDP      H + K     D++++    G   W
Sbjct:    97 EAYALTAASELLVKGSELCLAPMVECVLDPTLSGSYHQLKKWIYEEDLTLFGVSLGSHFW 156

Query:   125 EIMSQNPRLSQRFNQAMVNDSEMATFIVKDC------CRTLIE---RLGSMVDVGGGN-- 173
             E +++NP  ++ FN AM +DS+M    ++DC        ++++    +G+   +      
Sbjct:   157 EFLNENPEYNKSFNDAMASDSQMINLALRDCNSGFEGVESIVDVGGGIGTTAKIICDTFP 216

Query:   174 -----VLDLPHAVANTPQTENLKYVADDMFQFIPPADAYFFMLFFHAFGGEDSLKILKKC 228
                  V D P  V N   T NL YV  DMFQ +P ADA       H +   D  +IL+KC
Sbjct:   217 NLKCIVFDRPKVVENLSGTNNLSYVGGDMFQSVPKADAVLLKWILHNWTDNDCRRILEKC 276

Query:   229 REAIAGNGQRGKVLIMDIVINEKEDEDQRTDKEWKTLFLDAGFTC 273
             +EA++ +G++GKV+I+++VINE +DE + T  +   L +D    C
Sbjct:   277 KEAVSSDGEKGKVIIIEMVINENQDEHEITGTK---LLMDVNMAC 318
GO:0009717 "isoflavonoid biosynthetic process" evidence=IDA
GO:0033800 "isoflavone 7-O-methyltransferase activity" evidence=IDA
UNIPROTKB|Q6VMW0 OMT2 "8-hydroxyquercetin 8-O-methyltransferase" [Mentha x piperita (taxid:34256)] Back     alignment and assigned GO terms
UNIPROTKB|B0EXJ8 16OMT "Tabersonine 16-O-methyltransferase" [Catharanthus roseus (taxid:4058)] Back     alignment and assigned GO terms
UNIPROTKB|Q84KK4 HI4'OMT "Isoflavone 4'-O-methyltransferase" [Lotus japonicus (taxid:34305)] Back     alignment and assigned GO terms
UNIPROTKB|A8QW53 OMT3 "5-pentadecatrienyl resorcinol O-methyltransferase" [Sorghum bicolor (taxid:4558)] Back     alignment and assigned GO terms
UNIPROTKB|Q84KK6 HI4'OMT "Isoflavone 4'-O-methyltransferase" [Glycyrrhiza echinata (taxid:46348)] Back     alignment and assigned GO terms
UNIPROTKB|Q8GSN1 Q8GSN1 "Myricetin O-methyltransferase" [Catharanthus roseus (taxid:4058)] Back     alignment and assigned GO terms
TAIR|locus:2132806 AT4G35160 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132801 AT4G35150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015223 AT1G63140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
FOMT8
flavonoid o-methyltransferase related (372 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query287
pfam00891239 pfam00891, Methyltransf_2, O-methyltransferase 2e-35
pfam0810050 pfam08100, Dimerisation, Dimerisation domain 9e-05
>gnl|CDD|216177 pfam00891, Methyltransf_2, O-methyltransferase Back     alignment and domain information 
 Score =  126 bits (320), Expect = 2e-35
 Identities = 70/241 (29%), Positives = 110/241 (45%), Gaps = 42/241 (17%)

Query: 64  QEDYDLTPISTLLIKDKS-YCLSPLVSGILDPDNIFLLHFISKLFKGNDVSVWETVRGMK 122
            EDY LTP S LL+K +    L+PL+    DP  +     +    +      +E   GM 
Sbjct: 4   GEDYGLTPASKLLVKGEDSPSLAPLLLMYADPTLLESWAHLKDAVR-EGGPPFERAFGMP 62

Query: 123 HWEIMSQNPRLSQRFNQAMVNDSEMATFIVKDCCRTLIERLGSMVDVGGGN--------- 173
            +E +  +P  ++ FN+AM   S +    + +        L S+VDVGGG          
Sbjct: 63  FFEYLGADPEFNRVFNRAMAAHSRLVMKKILET-AFDFSGLSSLVDVGGGTGALAAAIVR 121

Query: 174 --------VLDLPHAVANTPQTENLKYVADDMFQFIPPADAYFFMLFFHAFGGEDSLKIL 225
                   V DLPH +A+ P  + +++V  D F+ +P ADA       H +  ED +KIL
Sbjct: 122 AYPHIKGIVFDLPHVIADAPSADRVEFVGGDFFESVPEADAILLKWVLHDWSDEDCVKIL 181

Query: 226 KKCREAIAGNGQRGKVLIMDIVINEKEDED-------------------QRTDKEWKTLF 266
           K+C EA+      GKV+++++V+ E  D+D                   +RT+KEW+ L 
Sbjct: 182 KRCYEALPPG---GKVIVVEMVLPEDPDDDLETEVLLLDLNMLVLNGGKERTEKEWRKLL 238

Query: 267 L 267
            
Sbjct: 239 S 239

This family includes a range of O-methyltransferases. These enzymes utilise S-adenosyl methionine. Length = 239
>gnl|CDD|219719 pfam08100, Dimerisation, Dimerisation domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 287
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 100.0
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 100.0
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 99.98
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 99.38
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.36
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.32
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.31
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.3
PLN02233261 ubiquinone biosynthesis methyltransferase 99.27
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 99.24
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.21
PLN02490340 MPBQ/MSBQ methyltransferase 99.18
PLN02244340 tocopherol O-methyltransferase 99.18
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 99.16
PLN02336475 phosphoethanolamine N-methyltransferase 99.15
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 99.15
PRK11207197 tellurite resistance protein TehB; Provisional 99.13
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 99.11
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.09
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.09
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 99.07
PRK06922677 hypothetical protein; Provisional 99.07
TIGR00452314 methyltransferase, putative. Known examples to dat 99.06
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 99.04
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 99.03
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 98.97
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 98.94
PLN02336 475 phosphoethanolamine N-methyltransferase 98.93
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.92
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 98.91
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.9
PLN02232160 ubiquinone biosynthesis methyltransferase 98.87
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 98.85
PRK06202232 hypothetical protein; Provisional 98.84
PRK08317241 hypothetical protein; Provisional 98.82
PRK12335287 tellurite resistance protein TehB; Provisional 98.8
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 98.8
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 98.78
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 98.77
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 98.74
TIGR03438301 probable methyltransferase. This model represents 98.72
PLN03075296 nicotianamine synthase; Provisional 98.69
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 98.68
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 98.65
PRK10258251 biotin biosynthesis protein BioC; Provisional 98.64
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 98.62
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 98.6
PRK04266226 fibrillarin; Provisional 98.59
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 98.58
PRK05785226 hypothetical protein; Provisional 98.57
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 98.56
PLN02585315 magnesium protoporphyrin IX methyltransferase 98.55
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 98.54
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 98.54
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 98.53
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 98.51
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 98.5
PTZ00146293 fibrillarin; Provisional 98.48
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.47
PRK13255218 thiopurine S-methyltransferase; Reviewed 98.46
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 98.46
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.43
KOG1270282 consensus Methyltransferases [Coenzyme transport a 98.41
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 98.39
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 98.38
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 98.35
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 98.34
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 98.33
COG4106257 Tam Trans-aconitate methyltransferase [General fun 98.31
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 98.28
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 98.22
PRK14968188 putative methyltransferase; Provisional 98.18
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 98.18
PRK13256226 thiopurine S-methyltransferase; Reviewed 98.15
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 98.08
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 98.08
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 98.04
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 98.01
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 98.01
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 97.96
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 97.88
PRK14967223 putative methyltransferase; Provisional 97.87
KOG4300252 consensus Predicted methyltransferase [General fun 97.86
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 97.85
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 97.84
KOG2361264 consensus Predicted methyltransferase [General fun 97.84
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 97.83
PHA03411279 putative methyltransferase; Provisional 97.83
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 97.83
KOG3045325 consensus Predicted RNA methylase involved in rRNA 97.82
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 97.81
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 97.79
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 97.77
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 97.76
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 97.76
KOG2899288 consensus Predicted methyltransferase [General fun 97.72
KOG1271227 consensus Methyltransferases [General function pre 97.7
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 97.7
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 97.68
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 97.68
PRK03612521 spermidine synthase; Provisional 97.68
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 97.67
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 97.66
PRK04457262 spermidine synthase; Provisional 97.65
PRK01581374 speE spermidine synthase; Validated 97.64
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 97.63
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 97.62
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 97.56
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 97.55
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 97.47
TIGR00536284 hemK_fam HemK family putative methylases. The gene 97.47
PRK07402196 precorrin-6B methylase; Provisional 97.44
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 97.43
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 97.43
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 97.42
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 97.41
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 97.41
KOG1975 389 consensus mRNA cap methyltransferase [RNA processi 97.39
PRK00811283 spermidine synthase; Provisional 97.37
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 97.37
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 97.36
PRK10611287 chemotaxis methyltransferase CheR; Provisional 97.35
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 97.34
TIGR00438188 rrmJ cell division protein FtsJ. 97.33
COG4976287 Predicted methyltransferase (contains TPR repeat) 97.33
PLN02366308 spermidine synthase 97.3
COG4123248 Predicted O-methyltransferase [General function pr 97.27
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 97.24
PF03291 331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 97.21
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 97.19
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 97.18
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 97.11
PF0810051 Dimerisation: Dimerisation domain; InterPro: IPR01 96.95
PRK14904445 16S rRNA methyltransferase B; Provisional 96.86
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 96.85
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 96.81
TIGR00027260 mthyl_TIGR00027 methyltransferase, putative, TIGR0 96.81
COG3315297 O-Methyltransferase involved in polyketide biosynt 96.69
KOG1331 293 consensus Predicted methyltransferase [General fun 96.66
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 96.54
COG4798238 Predicted methyltransferase [General function pred 96.54
COG2890280 HemK Methylase of polypeptide chain release factor 96.43
PRK10901427 16S rRNA methyltransferase B; Provisional 96.42
KOG3010261 consensus Methyltransferase [General function pred 96.4
PRK14901434 16S rRNA methyltransferase B; Provisional 96.4
PLN02672 1082 methionine S-methyltransferase 96.37
PRK14902444 16S rRNA methyltransferase B; Provisional 96.35
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 96.34
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 96.3
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 96.16
PLN02476278 O-methyltransferase 96.07
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 95.97
PRK14903431 16S rRNA methyltransferase B; Provisional 95.88
PHA03412241 putative methyltransferase; Provisional 95.88
smart00650169 rADc Ribosomal RNA adenine dimethylases. 95.86
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 95.84
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 95.82
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 95.8
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 95.66
PLN02823336 spermine synthase 95.56
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 95.49
COG0421282 SpeE Spermidine synthase [Amino acid transport and 95.43
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 95.42
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 95.41
PF05185 448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 95.34
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 95.27
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 95.21
KOG1500 517 consensus Protein arginine N-methyltransferase CAR 94.95
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 94.86
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 94.8
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 94.8
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 94.69
PRK00536262 speE spermidine synthase; Provisional 94.5
KOG3987288 consensus Uncharacterized conserved protein DREV/C 94.44
COG4627185 Uncharacterized protein conserved in bacteria [Fun 94.42
COG2263198 Predicted RNA methylase [Translation, ribosomal st 94.38
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 94.38
COG4301321 Uncharacterized conserved protein [Function unknow 94.21
COG3897218 Predicted methyltransferase [General function pred 94.05
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 94.04
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 93.91
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 93.79
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 93.7
COG2521287 Predicted archaeal methyltransferase [General func 93.66
COG4122219 Predicted O-methyltransferase [General function pr 93.49
KOG3201201 consensus Uncharacterized conserved protein [Funct 93.46
COG5459 484 Predicted rRNA methylase [Translation, ribosomal s 93.32
PLN02589247 caffeoyl-CoA O-methyltransferase 93.31
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 93.09
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 92.77
PF06859110 Bin3: Bicoid-interacting protein 3 (Bin3); InterPr 92.65
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 92.6
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 92.58
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 92.53
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 92.19
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 91.53
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 91.23
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 90.69
COG4262508 Predicted spermidine synthase with an N-terminal m 90.64
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 89.94
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 89.4
KOG1499 346 consensus Protein arginine N-methyltransferase PRM 88.24
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 87.69
KOG2798369 consensus Putative trehalase [Carbohydrate transpo 85.39
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 85.04
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 84.73
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 84.53
PF11899380 DUF3419: Protein of unknown function (DUF3419); In 83.99
COG4076252 Predicted RNA methylase [General function predicti 83.77
PRK04148134 hypothetical protein; Provisional 83.37
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 81.19
PF05430124 Methyltransf_30: S-adenosyl-L-methionine-dependent 80.85
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=2.2e-41  Score=303.44  Aligned_cols=265  Identities=28%  Similarity=0.399  Sum_probs=237.9

Q ss_pred             hHHHHHHHHHhhhhHHHHHHHHHHhChhhHhhhCCCCC-------------CCChhhhhhh-------------h--ccc
Q 043585           17 EGHGQITGLFLNNLSPMSLKGAVELGRADIIHSHGKPT-------------KTSNPFRFMQ-------------E--DYD   68 (287)
Q Consensus        17 ~~~~~l~~~~~g~~~~~~L~~a~~lglfd~L~~~~~~~-------------~~~~l~rlLr-------------~--~y~   68 (287)
                      ....++++++.++..+++|++|+||||||+|.+.+.+.             +|..+.|+||             +  .|+
T Consensus         5 ~~~l~~~~l~~~~~~~~~lk~A~eL~v~d~l~~~~~p~~ia~~l~~~~~~~~p~ll~r~lr~L~s~~i~k~~~~~~~~Y~   84 (342)
T KOG3178|consen    5 EASLRAMRLANGFALPMVLKAACELGVFDILANAGSPSEIASLLPTPKNPEAPVLLDRILRLLVSYSILKCRLVGGEVYS   84 (342)
T ss_pred             HHHHHHHHHHhhhhhHHHHHHHHHcChHHHHHhCCCHHHHHHhccCCCCCCChhHHHHHHHHHHHhhhceeeeecceeee
Confidence            44667999999999999999999999999999987321             6778999998             4  699


Q ss_pred             cchhhhHhh-cCCCCChHhhHhhcCCcchHHHHHHHHHhHhcCCCcccccccCCChhhhhccCchHHHHHHHHHHhcccc
Q 043585           69 LTPISTLLI-KDKSYCLSPLVSGILDPDNIFLLHFISKLFKGNDVSVWETVRGMKHWEIMSQNPRLSQRFNQAMVNDSEM  147 (287)
Q Consensus        69 lt~~s~~L~-~~~~~~~~~~~~~~~~~~~~~~~~~L~~~lr~g~~~~~~~~~g~~~~e~~~~~~~~~~~f~~aM~~~s~~  147 (287)
                      ++++++++. ..+..+++.++...+++..++.|..|.++++.|+ .+|..++|+..|+|...++.....|+++|...+..
T Consensus        85 ~~~~~~~~l~~~~~~S~a~~~~~~~~~v~~~~w~~l~dai~eg~-~~~~~~~G~~l~~~~~~~~~~~~~~~~sm~~l~~~  163 (342)
T KOG3178|consen   85 ATPVCKYFLKDSGGGSLAPLVLLNTSKVIMNTWQFLKDAILEGG-DAFATAHGMMLGGYGGADERFSKDFNGSMSFLSTL  163 (342)
T ss_pred             ccchhhhheecCCCCchhHHHHHhcccchhhhHHHHHHHHHhcc-cCCccccchhhhhhcccccccHHHHHHHHHHHHHH
Confidence            999999654 4444689999988888899999999999999998 69999999889999999999999999999999988


Q ss_pred             hhhH-hhhcccccccCcceEEEecCcc-----------------cccchhhhhcCCCC-CCceeeeccCcccCCCCCeEE
Q 043585          148 ATFI-VKDCCRTLIERLGSMVDVGGGN-----------------VLDLPHAVANTPQT-ENLKYVADDMFQFIPPADAYF  208 (287)
Q Consensus       148 ~~~~-~~~~~~~~~~~~~~vlDvGgG~-----------------v~Dlp~vi~~a~~~-~Ri~~~~gd~~~~~p~~D~~~  208 (287)
                      ..+. ++.+ . .|++...+||||||.                 .||+|.|++.++.. +.|+.+.||+|+..|.+|+||
T Consensus       164 ~~~~il~~~-~-Gf~~v~~avDvGgGiG~v~k~ll~~fp~ik~infdlp~v~~~a~~~~~gV~~v~gdmfq~~P~~daI~  241 (342)
T KOG3178|consen  164 VMKKILEVY-T-GFKGVNVAVDVGGGIGRVLKNLLSKYPHIKGINFDLPFVLAAAPYLAPGVEHVAGDMFQDTPKGDAIW  241 (342)
T ss_pred             HHHhhhhhh-c-ccccCceEEEcCCcHhHHHHHHHHhCCCCceeecCHHHHHhhhhhhcCCcceecccccccCCCcCeEE
Confidence            7766 7777 5 588999999999999                 79999999999875 889999999999999999999


Q ss_pred             eccccccCChHHHHHHHHHHHHHhcCCCCCcEEEEEeeccCCC-CCC---------------------CCCCHHHHHHHH
Q 043585          209 FMLFFHAFGGEDSLKILKKCREAIAGNGQRGKVLIMDIVINEK-EDE---------------------DQRTDKEWKTLF  266 (287)
Q Consensus       209 l~~vlh~~~d~~~~~iL~~~~~al~~~~~~g~lli~e~~~~~~-~~~---------------------~~rt~~e~~~ll  266 (287)
                      ++||||||+|++|++||+||+++|+|   +|+|+|+|.+.++. ...                     ++|+.+||+.++
T Consensus       242 mkWiLhdwtDedcvkiLknC~~sL~~---~GkIiv~E~V~p~e~~~dd~~s~v~~~~d~lm~~~~~~Gkert~~e~q~l~  318 (342)
T KOG3178|consen  242 MKWILHDWTDEDCVKILKNCKKSLPP---GGKIIVVENVTPEEDKFDDIDSSVTRDMDLLMLTQTSGGKERTLKEFQALL  318 (342)
T ss_pred             EEeecccCChHHHHHHHHHHHHhCCC---CCEEEEEeccCCCCCCccccccceeehhHHHHHHHhccceeccHHHHHhcc
Confidence            99999999999999999999999999   99999999999862 211                     899999999999


Q ss_pred             HhCCCcEEEEEecCCccceeC
Q 043585          267 LDAGFTCCKITTMFGLKSLIK  287 (287)
Q Consensus       267 ~~aGf~~~~~~~~~~~~s~ie  287 (287)
                      .++||.+..+...+...++||
T Consensus       319 ~~~gF~~~~~~~~~~~~~~Ie  339 (342)
T KOG3178|consen  319 PEEGFPVCMVALTAYSYSVIE  339 (342)
T ss_pred             hhhcCceeEEEeccCccchhe
Confidence            999999999999988888887

>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PF08100 Dimerisation: Dimerisation domain; InterPro: IPR012967 This domain is found at the N terminus of a variety of plant O-methyltransferases Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR00027 mthyl_TIGR00027 methyltransferase, putative, TIGR00027 family Back     alignment and domain information
>COG3315 O-Methyltransferase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1331 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown] Back     alignment and domain information
>COG4627 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>COG4301 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3201 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>KOG2798 consensus Putative trehalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PF11899 DUF3419: Protein of unknown function (DUF3419); InterPro: IPR021829 This family of proteins are functionally uncharacterised Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>PF05430 Methyltransf_30: S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR008471 This entry contains several uncharacterised bacterial proteins with no known function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query287
2qyo_A357 Crystal Structure Of Isoflavone O-Methyltransferase 3e-47
1fp2_A352 Crystal Structure Analysis Of Isoflavone O-Methyltr 8e-45
1fpx_A352 Crystal Structure Analysis Of Selenomethionine Subs 1e-41
1zg3_A358 Crystal Structure Of The Isoflavanone 4'-O-Methyltr 9e-37
1zga_A357 Crystal Structure Of Isoflavanone 4'-o-methyltransf 1e-36
1zgj_A354 Crystal Structure Of Isoflavanone 4'-O-Methyltransf 1e-36
1kyw_A365 Crystal Structure Analysis Of Caffeic Acid5-Hydroxy 1e-15
1fp1_D372 Crystal Structure Analysis Of Chalcone O-Methyltran 2e-13
3p9c_A364 Crystal Structure Of Perennial Ryegrass Lpomt1 Boun 1e-12
3reo_A368 Monolignol O-Methyltransferase (Momt) Length = 368 7e-12
1fpq_A372 Crystal Structure Analysis Of Selenomethionine Subs 7e-11
3lst_A348 Crystal Structure Of Calo1, Methyltransferase In Ca 7e-07
>pdb|2QYO|A Chain A, Crystal Structure Of Isoflavone O-Methyltransferase Homolog In Complex With Biochanin A And Sah Length = 357 Back     alignment and structure 
Iteration: 1

 Score =  185 bits (469), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 116/344 (33%), Positives = 167/344 (48%), Gaps = 71/344 (20%)
Query: 14  ELFEGHGQITGLFLNNLSPMSLKGAVELGRADIIHSHGKP--------------TKTSNP 59
           E+F+    +       +  MSLK ++E+   +IIH+HGKP              TK  N 
Sbjct: 12  EIFKAQALLYKNMYAFVDSMSLKWSIEMNIPNIIHNHGKPITLSNLVSILQIPSTKVDNV 71
Query: 60  FRFM--------------------QEDYDLTPISTLLIKDKSYCLSPLVSGILDPDNIFL 99
            R M                    +E Y LT  S LL+K    CL+P+V  +LDP     
Sbjct: 72  QRLMRYLAHNGFFEIITNQELENEEEAYALTVASELLVKGTELCLAPMVECVLDPTLSTS 131
Query: 100 LHFISKLFKGNDVSVWETVRGMKHWEIMSQNPRLSQRFNQAMVNDSEMATFIVKDCCRTL 159
            H + K     D++++    G   WE +++NP  +  +N A+ +DS+M    +KDC   +
Sbjct: 132 FHNLKKWVYEEDLTLFAVNLGCDLWEFLNKNPEYNTLYNDALASDSKMINLAMKDC-NLV 190
Query: 160 IERLGSMVDVGGGN-----------------VLDLPHAVANTPQTENLKYVADDMFQFIP 202
            E L S+VDVGGGN                 V D P  V N   + NL YV  DMF  +P
Sbjct: 191 FEGLESIVDVGGGNGTTGKIICETFPKLTCVVFDRPKVVENLCGSNNLTYVGGDMFISVP 250
Query: 203 PADAYFFMLFFHAFGGEDSLKILKKCREAIAGNGQRGKVLIMDIVINEKEDEDQ------ 256
            ADA       H +  +D +KILKKC+EA+  +G+RGKV+++D+VINEK+DE+Q      
Sbjct: 251 KADAVLLKAVLHDWTDKDCIKILKKCKEAVTSDGKRGKVIVIDMVINEKKDENQLTQIKL 310
Query: 257 -------------RTDKEWKTLFLDAGFTCCKITTMFGLKSLIK 287
                        R ++EWK LF++AGF   KI+   GL SLI+
Sbjct: 311 LMNVTISCVNGKERNEEEWKKLFIEAGFQDYKISPFTGLMSLIE 354
>pdb|1FP2|A Chain A, Crystal Structure Analysis Of Isoflavone O-Methyltransferase Length = 352 Back     alignment and structure
>pdb|1FPX|A Chain A, Crystal Structure Analysis Of Selenomethionine Substituted Isoflavone O-Methyltransferase Length = 352 Back     alignment and structure
>pdb|1ZG3|A Chain A, Crystal Structure Of The Isoflavanone 4'-O-Methyltransferase Complexed With Sah And 2,7,4'-Trihydroxyisoflavanone Length = 358 Back     alignment and structure
>pdb|1ZGA|A Chain A, Crystal Structure Of Isoflavanone 4'-o-methyltransferase Complexed With (+)-6a-hydroxymaackiain Length = 357 Back     alignment and structure
>pdb|1ZGJ|A Chain A, Crystal Structure Of Isoflavanone 4'-O-Methyltransferase Complexed With (+)-Pisatin Length = 354 Back     alignment and structure
>pdb|1KYW|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde Length = 365 Back     alignment and structure
>pdb|1FP1|D Chain D, Crystal Structure Analysis Of Chalcone O-Methyltransferase Length = 372 Back     alignment and structure
>pdb|3P9C|A Chain A, Crystal Structure Of Perennial Ryegrass Lpomt1 Bound To Sah Length = 364 Back     alignment and structure
>pdb|3REO|A Chain A, Monolignol O-Methyltransferase (Momt) Length = 368 Back     alignment and structure
>pdb|1FPQ|A Chain A, Crystal Structure Analysis Of Selenomethionine Substituted Chalcone O- Methyltransferase Length = 372 Back     alignment and structure
>pdb|3LST|A Chain A, Crystal Structure Of Calo1, Methyltransferase In Calicheamicin Biosynthesis, Sah Bound Form Length = 348 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query287
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 2e-75
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 1e-70
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 3e-64
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 7e-63
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 2e-62
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 4e-59
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 1e-58
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 3e-56
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 2e-55
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 3e-53
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 3e-53
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 1e-48
2r3s_A335 Uncharacterized protein; methyltransferase domain, 8e-40
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 5e-35
3dp7_A363 SAM-dependent methyltransferase; structural genomi 1e-33
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Length = 352 Back     alignment and structure
 Score =  233 bits (595), Expect = 2e-75
 Identities = 112/351 (31%), Positives = 163/351 (46%), Gaps = 68/351 (19%)

Query: 1   MNPIENEGGVSVKELFEGHGQITGLFLNNLSPMSLKGAVELGRADIIHSHGK-------- 52
           M    N  G    E+F+    +       +  MSLK AVE+   +II +HGK        
Sbjct: 1   MASSIN--GRKPSEIFKAQALLYKHIYAFIDSMSLKWAVEMNIPNIIQNHGKPISLSNLV 58

Query: 53  ------PTKTSNPFRFM---------------QEDYDLTPISTLLIKDKSYCLSPLVSGI 91
                  +K  N  R M               +E Y LT  S LL++    CL+P+V  +
Sbjct: 59  SILQVPSSKIGNVRRLMRYLAHNGFFEIITKEEESYALTVASELLVRGSDLCLAPMVECV 118

Query: 92  LDPDNIFLLHFISKLFKGNDVSVWETVRGMKHWEIMSQNPRLSQRFNQAMVNDSEMATFI 151
           LDP      H + K     D++++    G   W+ + +NP  +  FN AM +DS++    
Sbjct: 119 LDPTLSGSYHELKKWIYEEDLTLFGVTLGSGFWDFLDKNPEYNTSFNDAMASDSKLINLA 178

Query: 152 VKDCCRTLIERLGSMVDVGGGN-----------------VLDLPHAVANTPQTENLKYVA 194
           ++DC     + L S+VDVGGG                  V D P  V N   + NL YV 
Sbjct: 179 LRDCDFVF-DGLESIVDVGGGTGTTAKIICETFPKLKCIVFDRPQVVENLSGSNNLTYVG 237

Query: 195 DDMFQFIPPADAYFFMLFFHAFGGEDSLKILKKCREAIAGNGQRGKVLIMDIVINEKEDE 254
            DMF  IP ADA       H +  +D L+ILKKC+EA+  +G+RGKV I+D+VI++K+DE
Sbjct: 238 GDMFTSIPNADAVLLKYILHNWTDKDCLRILKKCKEAVTNDGKRGKVTIIDMVIDKKKDE 297

Query: 255 D-------------------QRTDKEWKTLFLDAGFTCCKITTMFGLKSLI 286
           +                   +R ++EWK LF++AGF   KI+ + G  SLI
Sbjct: 298 NQVTQIKLLMDVNMACLNGKERNEEEWKKLFIEAGFQHYKISPLTGFLSLI 348
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Length = 358 Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Length = 348 Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Length = 372 Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 1kyz_A* 1kyw_A* Length = 368 Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Length = 369 Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Length = 364 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Length = 332 Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Length = 334 Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Length = 360 Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Length = 374 Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Length = 359 Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Length = 335 Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Length = 352 Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Length = 363 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Length = 241 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query287
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 100.0
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 100.0
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 100.0
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 100.0
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 100.0
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 100.0
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 100.0
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 100.0
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 100.0
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 100.0
3dp7_A363 SAM-dependent methyltransferase; structural genomi 100.0
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 100.0
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 100.0
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 100.0
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 100.0
2r3s_A335 Uncharacterized protein; methyltransferase domain, 100.0
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.56
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.49
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.39
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.39
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.39
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.38
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.37
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.37
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.37
3lcc_A235 Putative methyl chloride transferase; halide methy 99.35
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.35
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.35
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.33
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.32
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.31
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 99.31
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.3
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 99.3
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.29
3ocj_A305 Putative exported protein; structural genomics, PS 99.29
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 99.29
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.29
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 99.28
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.27
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 99.27
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.27
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 99.26
3f4k_A257 Putative methyltransferase; structural genomics, P 99.25
2p7i_A250 Hypothetical protein; putative methyltransferase, 99.25
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.25
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.23
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 99.23
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.23
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.19
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.19
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 99.19
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.18
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.16
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 99.15
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.15
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 99.13
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.12
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.11
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 99.11
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 99.11
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.11
3ege_A261 Putative methyltransferase from antibiotic biosyn 99.11
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 99.11
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.1
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 99.07
1vlm_A219 SAM-dependent methyltransferase; possible histamin 99.07
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.06
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 99.05
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.04
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.04
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 99.02
3cc8_A230 Putative methyltransferase; structural genomics, j 99.02
3gu3_A284 Methyltransferase; alpha-beta protein, structural 99.01
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 99.01
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.0
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.98
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 98.95
2kw5_A202 SLR1183 protein; structural genomics, northeast st 98.94
1wzn_A252 SAM-dependent methyltransferase; structural genomi 98.93
2i62_A265 Nicotinamide N-methyltransferase; structural genom 98.93
3m70_A286 Tellurite resistance protein TEHB homolog; structu 98.9
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 98.89
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 98.88
4hg2_A257 Methyltransferase type 11; structural genomics, PS 98.87
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 98.85
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 98.83
3giw_A277 Protein of unknown function DUF574; rossmann-fold 98.83
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 98.82
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 98.8
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 98.78
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 98.76
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 98.72
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 98.69
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 98.69
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 98.67
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 98.59
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 98.55
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 98.54
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 98.54
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 98.53
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.52
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 98.51
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 98.51
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 98.49
1yb2_A275 Hypothetical protein TA0852; structural genomics, 98.49
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 98.46
3m33_A226 Uncharacterized protein; structural genomics, PSI- 98.45
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 98.45
2b3t_A276 Protein methyltransferase HEMK; translation termin 98.45
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 98.44
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 98.43
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 98.43
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 98.43
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 98.42
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 98.41
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 98.4
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 98.39
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 98.38
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 98.38
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 98.38
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 98.38
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 98.34
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 98.33
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 98.32
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 98.31
2qm3_A373 Predicted methyltransferase; putative methyltransf 98.3
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 98.3
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 98.28
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 98.27
3lpm_A259 Putative methyltransferase; structural genomics, p 98.27
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 98.27
2h00_A254 Methyltransferase 10 domain containing protein; st 98.24
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 98.24
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 98.24
2frn_A278 Hypothetical protein PH0793; structural genomics, 98.22
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.2
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 98.19
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 98.18
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 98.16
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 98.16
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 98.16
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 98.15
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.15
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 98.15
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 98.1
1jsx_A207 Glucose-inhibited division protein B; methyltransf 98.1
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 98.08
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 98.07
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 98.07
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 98.06
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 98.05
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 98.02
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 98.01
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 98.0
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 97.98
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 97.97
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 97.96
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 97.94
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 97.92
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 97.92
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 97.92
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 97.92
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 97.9
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 97.9
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 97.9
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 97.9
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 97.88
3duw_A223 OMT, O-methyltransferase, putative; alternating of 97.87
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 97.86
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 97.82
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 97.8
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 97.79
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 97.79
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 97.78
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 97.77
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 97.75
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 97.75
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 97.71
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 97.69
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 97.69
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 97.67
2b25_A336 Hypothetical protein; structural genomics, methyl 97.65
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 97.65
1ws6_A171 Methyltransferase; structural genomics, riken stru 97.65
2i7c_A283 Spermidine synthase; transferase, structural genom 97.64
2avd_A229 Catechol-O-methyltransferase; structural genomics, 97.64
3k6r_A278 Putative transferase PH0793; structural genomics, 97.64
3gjy_A317 Spermidine synthase; APC62791, structural genomics 97.63
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 97.62
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 97.62
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 97.61
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 97.61
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 97.59
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 97.58
3sso_A419 Methyltransferase; macrolide, natural product, ros 97.57
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 97.56
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 97.56
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 97.55
2pt6_A321 Spermidine synthase; transferase, structural genom 97.54
2esr_A177 Methyltransferase; structural genomics, hypothetic 97.53
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 97.52
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 97.5
1ne2_A200 Hypothetical protein TA1320; structural genomics, 97.5
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 97.49
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 97.48
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 97.47
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 97.46
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 97.45
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 97.45
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 97.44
2fpo_A202 Methylase YHHF; structural genomics, putative meth 97.41
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 97.41
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 97.41
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 97.4
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 97.39
1rjd_A334 PPM1P, carboxy methyl transferase for protein phos 97.38
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 97.37
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 97.36
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 97.35
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 97.32
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 97.31
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 97.29
2o07_A304 Spermidine synthase; structural genomics, structur 97.28
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 97.28
2cmg_A262 Spermidine synthase; transferase, putrescine amino 97.27
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 97.26
1xj5_A334 Spermidine synthase 1; structural genomics, protei 97.24
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 97.21
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 97.16
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 97.15
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 97.06
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 97.01
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 97.0
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 96.97
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 96.94
3iei_A334 Leucine carboxyl methyltransferase 1; LCMT-1, S-ad 96.92
2uyo_A310 Hypothetical protein ML2640; putative methyltransf 96.87
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 96.87
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 96.85
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 96.84
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 96.82
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 96.8
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 96.76
1m6e_X359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 96.67
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 96.64
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 96.62
2efj_A384 3,7-dimethylxanthine methyltransferase; SAM-depend 96.57
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 96.5
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 96.33
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 96.27
2b78_A385 Hypothetical protein SMU.776; structure genomics, 96.26
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 96.25
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 96.19
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 95.98
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 95.86
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 95.8
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 95.78
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 95.76
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 95.04
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 94.74
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 94.25
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 93.74
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 93.68
3fut_A271 Dimethyladenosine transferase; methyltransferase, 93.33
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 93.33
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 93.06
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 92.8
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 92.76
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 92.74
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 91.9
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 91.62
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 90.29
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 90.27
2px2_A269 Genome polyprotein [contains: capsid protein C (co 88.78
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 88.04
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 87.22
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 86.94
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 86.55
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 85.45
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 82.76
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 81.81
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 81.07
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 81.02
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 80.41
3ll7_A 410 Putative methyltransferase; methytransferase, stru 80.14
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
Probab=100.00  E-value=4e-49  Score=364.32  Aligned_cols=263  Identities=17%  Similarity=0.250  Sum_probs=236.7

Q ss_pred             hHHHHHHHHHhhhhHHHHHHHHHHhChhhHhhhCCCCC-----------CCChhhhhhh----------------hcccc
Q 043585           17 EGHGQITGLFLNNLSPMSLKGAVELGRADIIHSHGKPT-----------KTSNPFRFMQ----------------EDYDL   69 (287)
Q Consensus        17 ~~~~~l~~~~~g~~~~~~L~~a~~lglfd~L~~~~~~~-----------~~~~l~rlLr----------------~~y~l   69 (287)
                      ++...|++++.||+.+++|++|++|||||+|.+++.++           +++.+.|+||                ++|++
T Consensus         7 ~~~~~L~~l~~Gf~~s~~L~aa~eLglfd~L~~~~~p~t~~eLA~~~g~~~~~l~rlLr~L~~~gll~~~~~~~~~~y~~   86 (353)
T 4a6d_A            7 QAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGTELLLDICVSLKLLKVETRGGKAFYRN   86 (353)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHSSSCBCHHHHHHHHTCCHHHHHHHHHHHHHTTSEEEEEETTEEEEEE
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHcCHHHHHhcCCCCCCHHHHHHhhCcCHHHHHHHHHHHHHCCCEEEeccCccceeeC
Confidence            56778999999999999999999999999999865433           7888999998                36999


Q ss_pred             chhhh-HhhcCCCCChHhhHhhcCCcchHHHHHHHHHhHhcCCCcccccccC---CChhhhhccCchHHHHHHHHHHhcc
Q 043585           70 TPIST-LLIKDKSYCLSPLVSGILDPDNIFLLHFISKLFKGNDVSVWETVRG---MKHWEIMSQNPRLSQRFNQAMVNDS  145 (287)
Q Consensus        70 t~~s~-~L~~~~~~~~~~~~~~~~~~~~~~~~~~L~~~lr~g~~~~~~~~~g---~~~~e~~~~~~~~~~~f~~aM~~~s  145 (287)
                      |++++ +|.+++|.++++++.+.. +..++.|.+|.+++++|+ ++|...+|   .++|+++.++|+....|+++|...+
T Consensus        87 t~~s~~~l~~~~~~~~~~~~~~~~-~~~~~~~~~L~~~vr~g~-~~~~~~~g~~~~~~~~~~~~~~~~~~~f~~aM~~~~  164 (353)
T 4a6d_A           87 TELSSDYLTTVSPTSQCSMLKYMG-RTSYRCWGHLADAVREGR-NQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVW  164 (353)
T ss_dssp             CHHHHHHHSTTSTTCCHHHHHHHH-HTHHHHHTTHHHHHHHTS-CCHHHHHSCCCSSHHHHHTSSHHHHHHHHHHHHTTH
T ss_pred             CHHHHHHhhcCCchHHHHHHHHhC-HHHHHHHHHHHHHHhcCC-ChhHHhcCCChHHHHHHHhhCHHHHHHHHHHHHHHH
Confidence            99998 788888889999998874 578899999999999998 68888887   4689999999999999999999988


Q ss_pred             cchhhH-hhhcccccccCcceEEEecCcc-----------------cccchhhhhcCCC------CCCceeeeccCcc-c
Q 043585          146 EMATFI-VKDCCRTLIERLGSMVDVGGGN-----------------VLDLPHAVANTPQ------TENLKYVADDMFQ-F  200 (287)
Q Consensus       146 ~~~~~~-~~~~~~~~~~~~~~vlDvGgG~-----------------v~Dlp~vi~~a~~------~~Ri~~~~gd~~~-~  200 (287)
                      ....+. ++.+   ++++..+|||||||+                 ++|+|+|++.+++      .+||++++||||+ +
T Consensus       165 ~~~~~~~~~~~---~~~~~~~v~DvGgG~G~~~~~l~~~~p~~~~~~~dlp~v~~~a~~~~~~~~~~rv~~~~gD~~~~~  241 (353)
T 4a6d_A          165 SVNGRSVLTAF---DLSVFPLMCDLGGGAGALAKECMSLYPGCKITVFDIPEVVWTAKQHFSFQEEEQIDFQEGDFFKDP  241 (353)
T ss_dssp             HHHHHHHHHSS---CGGGCSEEEEETCTTSHHHHHHHHHCSSCEEEEEECHHHHHHHHHHSCC--CCSEEEEESCTTTSC
T ss_pred             HHHHHHHHHhc---CcccCCeEEeeCCCCCHHHHHHHHhCCCceeEeccCHHHHHHHHHhhhhcccCceeeecCccccCC
Confidence            777777 8888   789999999999999                 8999999988763      6899999999998 4


Q ss_pred             CCCCCeEEeccccccCChHHHHHHHHHHHHHhcCCCCCcEEEEEeeccCCCCCC-----------------CCCCHHHHH
Q 043585          201 IPPADAYFFMLFFHAFGGEDSLKILKKCREAIAGNGQRGKVLIMDIVINEKEDE-----------------DQRTDKEWK  263 (287)
Q Consensus       201 ~p~~D~~~l~~vlh~~~d~~~~~iL~~~~~al~~~~~~g~lli~e~~~~~~~~~-----------------~~rt~~e~~  263 (287)
                      .|++|+|++++|||+|+|++|++||++++++|+|   ||+|+|+|.++++++..                 ++||.+||+
T Consensus       242 ~~~~D~~~~~~vlh~~~d~~~~~iL~~~~~al~p---gg~lli~e~~~~~~~~~~~~~~~~dl~ml~~~~g~ert~~e~~  318 (353)
T 4a6d_A          242 LPEADLYILARVLHDWADGKCSHLLERIYHTCKP---GGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYH  318 (353)
T ss_dssp             CCCCSEEEEESSGGGSCHHHHHHHHHHHHHHCCT---TCEEEEEECCCCTTSCCCHHHHHHHHHHHHSSSCCCCCHHHHH
T ss_pred             CCCceEEEeeeecccCCHHHHHHHHHHHHhhCCC---CCEEEEEEeeeCCCCCCCHHHHHHHHHHHHhCCCcCCCHHHHH
Confidence            6679999999999999999999999999999999   99999999999876542                 899999999


Q ss_pred             HHHHhCCCcEEEEEecCCccceeC
Q 043585          264 TLFLDAGFTCCKITTMFGLKSLIK  287 (287)
Q Consensus       264 ~ll~~aGf~~~~~~~~~~~~s~ie  287 (287)
                      +||++|||+.++++++++..++|+
T Consensus       319 ~ll~~AGf~~v~v~~~~~~~~~i~  342 (353)
T 4a6d_A          319 MLLSSAGFRDFQFKKTGAIYDAIL  342 (353)
T ss_dssp             HHHHHHTCEEEEEECCSSSCEEEE
T ss_pred             HHHHHCCCceEEEEEcCCceEEEE
Confidence            999999999999999988888875
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3iei_A Leucine carboxyl methyltransferase 1; LCMT-1, S-adenosyl-L-methionine; HET: SAH MES; 1.90A {Homo sapiens} PDB: 3p71_T* 3mnt_A* 3o7w_A* Back     alignment and structure
>2uyo_A Hypothetical protein ML2640; putative methyltransferase, transferas; 1.7A {Mycobacterium leprae} SCOP: c.66.1.57 PDB: 2ckd_A 2uyq_A* Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 287
d1fp2a2244 c.66.1.12 (A:109-352) Isoflavone O-methyltransfera 4e-47
d1fp1d2244 c.66.1.12 (D:129-372) Chalcone O-methyltransferase 8e-37
d1kyza2243 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferuli 1e-26
d1qzza2256 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase 2e-15
d1tw3a2253 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransf 7e-12
d1fp1d1110 a.4.5.29 (D:19-128) Chalcone O-methyltransferase { 1e-07
d1fp2a1101 a.4.5.29 (A:8-108) Isoflavone O-methyltransferase 2e-07
d1kyza1107 a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic 2e-06
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Plant O-methyltransferase, C-terminal domain
domain: Isoflavone O-methyltransferase
species: Alfalfa (Medicago sativa) [TaxId: 3879]

 Score =  156 bits (394), Expect = 4e-47
 Identities = 85/240 (35%), Positives = 125/240 (52%), Gaps = 37/240 (15%)

Query: 83  CLSPLVSGILDPDNIFLLHFISKLFKGNDVSVWETVRGMKHWEIMSQNPRLSQRFNQAMV 142
           CL+P+V  +LDP      H + K     D++++    G   W+ + +NP  +  FN AM 
Sbjct: 2   CLAPMVECVLDPTLSGSYHELKKWIYEEDLTLFGVTLGSGFWDFLDKNPEYNTSFNDAMA 61

Query: 143 NDSEMATFIVKDCCRTLIERLGSMVDVGGGN-----------------VLDLPHAVANTP 185
           +DS++    ++DC   + + L S+VDVGGG                  V D P  V N  
Sbjct: 62  SDSKLINLALRDCDF-VFDGLESIVDVGGGTGTTAKIICETFPKLKCIVFDRPQVVENLS 120

Query: 186 QTENLKYVADDMFQFIPPADAYFFMLFFHAFGGEDSLKILKKCREAIAGNGQRGKVLIMD 245
            + NL YV  DMF  IP ADA       H +  +D L+ILKKC+EA+  +G+RGKV I+D
Sbjct: 121 GSNNLTYVGGDMFTSIPNADAVLLKYILHNWTDKDCLRILKKCKEAVTNDGKRGKVTIID 180

Query: 246 IVINEKEDEDQ-------------------RTDKEWKTLFLDAGFTCCKITTMFGLKSLI 286
           +VI++K+DE+Q                   R ++EWK LF++AGF   KI+ + G  SLI
Sbjct: 181 MVIDKKKDENQVTQIKLLMDVNMACLNGKERNEEEWKKLFIEAGFQHYKISPLTGFLSLI 240
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 243 Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Length = 256 Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Length = 253 Back     information, alignment and structure
>d1fp1d1 a.4.5.29 (D:19-128) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 110 Back     information, alignment and structure
>d1fp2a1 a.4.5.29 (A:8-108) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 101 Back     information, alignment and structure
>d1kyza1 a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 107 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query287
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 100.0
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 100.0
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 100.0
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 100.0
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 100.0
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.54
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.52
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.51
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.49
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.47
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.39
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.38
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.33
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.23
d1fp2a1101 Isoflavone O-methyltransferase {Alfalfa (Medicago 99.22
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.18
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.16
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.12
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.11
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.08
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.0
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 98.99
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 98.98
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 98.96
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 98.93
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 98.9
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 98.89
d1kyza1107 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 98.89
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 98.87
d1tw3a185 Carminomycin 4-O-methyltransferase {Streptomyces p 98.82
d1fp1d1110 Chalcone O-methyltransferase {Alfalfa (Medicago sa 98.78
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 98.77
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 98.75
d1qzza192 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 98.67
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 98.56
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 98.56
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 98.45
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 98.42
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 98.36
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 98.33
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 98.29
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 98.29
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 98.2
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 98.11
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 98.07
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 98.03
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 98.02
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 97.93
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 97.9
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 97.85
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 97.7
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 97.68
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 97.68
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 97.66
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 97.57
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 97.55
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 97.54
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 97.37
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 97.36
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 96.96
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 96.95
d2uyoa1297 Putative methyltransferase ML2640 {Mycobacterium l 96.59
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 96.51
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 96.24
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 96.24
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 96.0
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 95.96
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 95.73
d2h00a1250 Methyltransferase 10 domain containing protein MET 95.65
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 95.44
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 95.37
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 95.33
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 95.2
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 95.14
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 95.14
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 95.12
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 95.02
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 94.91
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 94.89
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 94.36
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 94.36
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 94.2
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 92.92
d1m6ex_359 Salicylic acid carboxyl methyltransferase (SAMT) { 92.3
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 91.08
d1rjda_328 Leucine carboxy methyltransferase Ppm1 {Baker's ye 89.98
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 89.55
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 89.11
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 86.21
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 85.75
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 85.31
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 80.04
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Plant O-methyltransferase, C-terminal domain
domain: Chalcone O-methyltransferase
species: Alfalfa (Medicago sativa) [TaxId: 3879]

Probab=100.00  E-value=1.8e-44  Score=314.70  Aligned_cols=200  Identities=24%  Similarity=0.491  Sum_probs=174.5

Q ss_pred             ChHhhHhhcCCcchHHHHHHHHHhHhcCCCcccccccCCChhhhhccCchHHHHHHHHHHhcccchhhH-hhhccccccc
Q 043585           83 CLSPLVSGILDPDNIFLLHFISKLFKGNDVSVWETVRGMKHWEIMSQNPRLSQRFNQAMVNDSEMATFI-VKDCCRTLIE  161 (287)
Q Consensus        83 ~~~~~~~~~~~~~~~~~~~~L~~~lr~g~~~~~~~~~g~~~~e~~~~~~~~~~~f~~aM~~~s~~~~~~-~~~~~~~~~~  161 (287)
                      ++++++.++++|.+++.|.+|++++++|++++|+.+||.++|||+.+||+..+.|+++|...+....+. ++.+ + .|+
T Consensus         3 ~l~~~~~~~~~p~~~~~w~~l~~~v~~g~~~~f~~~~G~~~~e~l~~~p~~~~~F~~aM~~~s~~~~~~l~~~~-~-~f~   80 (244)
T d1fp1d2           3 YLASFTTFLCYPALLQVWMNFKEAVVDEDIDLFKNVHGVTKYEFMGKDKKMNQIFNKSMVDVCATEMKRMLEIY-T-GFE   80 (244)
T ss_dssp             CCTHHHHHHTCHHHHHHHTTHHHHHHSCC--------------CCSSCHHHHHHHHHHHHHHHHHHHHHHHHHC-C-TTT
T ss_pred             cHHHHHHHHhCHHHHHHHHHHHHHHhcCCCCHhHHhcCCCHHHHHhhCHHHHHHHHHHHHHHHHHHHHHHHHhc-c-ccc
Confidence            789999999999999999999999999887899999999999999999999999999999998887777 8888 4 379


Q ss_pred             CcceEEEecCcc-----------------cccchhhhhcCCCCCCceeeeccCcccCCCCCeEEeccccccCChHHHHHH
Q 043585          162 RLGSMVDVGGGN-----------------VLDLPHAVANTPQTENLKYVADDMFQFIPPADAYFFMLFFHAFGGEDSLKI  224 (287)
Q Consensus       162 ~~~~vlDvGgG~-----------------v~Dlp~vi~~a~~~~Ri~~~~gd~~~~~p~~D~~~l~~vlh~~~d~~~~~i  224 (287)
                      +..+|||||||+                 ++|+|+|++.+...+||++++||||+++|++|+|++++|||+|+|++|++|
T Consensus        81 ~~~~vlDiGGG~G~~~~~l~~~~P~l~~~v~Dlp~vi~~~~~~~ri~~~~gd~~~~~p~~D~~~l~~vLh~~~de~~~~i  160 (244)
T d1fp1d2          81 GISTLVDVGGGSGRNLELIISKYPLIKGINFDLPQVIENAPPLSGIEHVGGDMFASVPQGDAMILKAVCHNWSDEKCIEF  160 (244)
T ss_dssp             TCSEEEEETCTTSHHHHHHHHHCTTCEEEEEECHHHHTTCCCCTTEEEEECCTTTCCCCEEEEEEESSGGGSCHHHHHHH
T ss_pred             CCcEEEEecCCCcHHHHHHHHHCCCCeEEEecchhhhhccCCCCCeEEecCCcccccccceEEEEehhhhhCCHHHHHHH
Confidence            999999999999                 999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhcCCCCCcEEEEEeeccCCCCCC--------------------CCCCHHHHHHHHHhCCCcEEEEEec-CCcc
Q 043585          225 LKKCREAIAGNGQRGKVLIMDIVINEKEDE--------------------DQRTDKEWKTLFLDAGFTCCKITTM-FGLK  283 (287)
Q Consensus       225 L~~~~~al~~~~~~g~lli~e~~~~~~~~~--------------------~~rt~~e~~~ll~~aGf~~~~~~~~-~~~~  283 (287)
                      |++++++|+|   ||+|+|+|.++++.+..                    ++||.+||.+||++|||+.+++++. .+..
T Consensus       161 L~~~~~aL~p---gg~llI~e~v~~~~~~~~~~~~~~~~~d~~m~~~~~g~ert~~e~~~ll~~AGF~~v~v~~~~~~~~  237 (244)
T d1fp1d2         161 LSNCHKALSP---NGKVIIVEFILPEEPNTSEESKLVSTLDNLMFITVGGRERTEKQYEKLSKLSGFSKFQVACRAFNSL  237 (244)
T ss_dssp             HHHHHHHEEE---EEEEEEEEEEECSSCCSSHHHHHHHHHHHHHHHHHSCCCEEHHHHHHHHHHTTCSEEEEEEEETTTE
T ss_pred             HHHHHHHcCC---CcEEEEEEEEecCCCCCchHHHHHHHHHHHHHhhCCCcCCCHHHHHHHHHHcCCCceEEEecCCCCE
Confidence            9999999999   99999999999876643                    8899999999999999999999866 5789


Q ss_pred             ceeC
Q 043585          284 SLIK  287 (287)
Q Consensus       284 s~ie  287 (287)
                      ||||
T Consensus       238 ~viE  241 (244)
T d1fp1d2         238 GVME  241 (244)
T ss_dssp             EEEE
T ss_pred             EEEE
Confidence            9998
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1fp2a1 a.4.5.29 (A:8-108) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kyza1 a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tw3a1 a.4.5.29 (A:14-98) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1fp1d1 a.4.5.29 (D:19-128) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qzza1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2uyoa1 c.66.1.57 (A:14-310) Putative methyltransferase ML2640 {Mycobacterium leprae [TaxId: 1769]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rjda_ c.66.1.37 (A:) Leucine carboxy methyltransferase Ppm1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure