Citrus Sinensis ID: 043622

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MLLYLILLIALCIVATHLNNKIKNLPPNPFPALPIVGHLYLIFKNKPLHRTLSQLSSKHGPILLLNLGTRRVLLLSSPSAVEECFTKSDVVFANRPRILLGEHLGYNSTSLVWSPYGSHWRNLRKLLSHDILSNTSLQTLSCYIRKDE
cHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHccccEEEEcccccEEEEEcHHHHHHHHHHcccccccccccccccccccccccEEEccccHHHHHHHHHHHHHHccHHHHHHccHHHHccc
cHHHHHHHHHHHHHHHHcccccccccccccccccEEccHHHHccccccHHHHHHHHHHcccEEEEEcccEEEEEEccHHHHHHHHHccccHEcccccHHHHHHHccccccEEEccccHHHHHHHHHHHHHHHcHHHHHHcHHHHHHcc
MLLYLILLIALCIVATHLNnkiknlppnpfpalpivgHLYLIfknkplhrtlsqlsskhgpilLLNLGTRRVlllsspsaveecftksdvvfanrprillgehlgynstslvwspygshWRNLRKLLShdilsntslqtlscyirkde
MLLYLILLIALCIVATHLNNKIKNLPPNPFPALPIVGHLYLIFKNKPLHRTLSQLSSKHGPILLLNLGTRRVLLLSSPSAVEECFTKSDVVFANRPRILLGEHLGYNSTSLVWSPYGSHWRNLRKLLshdilsntslqtlscyirkde
MllylillialciVATHlnnkiknlppnpfpALPIVGHLYLIFKNKPLHRTLSQLSSKHGPIlllnlgtrrvlllSSPSAVEECFTKSDVVFANRPRILLGEHLGYNSTSLVWSPYGSHWRNLRKLLSHDILSNTSLQTLSCYIRKDE
*LLYLILLIALCIVATHLNNKIKNLPPNPFPALPIVGHLYLIFKNKPLHRTLSQLSSKHGPILLLNLGTRRVLLLSSPSAVEECFTKSDVVFANRPRILLGEHLGYNSTSLVWSPYGSHWRNLRKLLSHDILSNTSLQTLSCYI****
MLLYLILLIALCIV****************PALPIVGHLYLIFKNKPLHRTLSQLSSKHGPILLLNLGTRRVLLLSSPSAVEECFTKSDVVFANRPRILLGEHLGYNSTSLVWSPYGSHWRNLRKLLSHDILSNTSLQTLS**I****
MLLYLILLIALCIVATHLNNKIKNLPPNPFPALPIVGHLYLIFKNKPLHRTLSQLSSKHGPILLLNLGTRRVLLLSSPSAVEECFTKSDVVFANRPRILLGEHLGYNSTSLVWSPYGSHWRNLRKLLSHDILSNTSLQTLSCYIRKDE
MLLYLILLIALCIVATHLNNKIKNLPPNPFPALPIVGHLYLIFKNKPLHRTLSQLSSKHGPILLLNLGTRRVLLLSSPSAVEECFTKSDVVFANRPRILLGEHLGYNSTSLVWSPYGSHWRNLRKLLSHDILSNTSLQTLSCYI****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLYLILLIALCIVATHLNNKIKNLPPNPFPALPIVGHLYLIFKNKPLHRTLSQLSSKHGPILLLNLGTRRVLLLSSPSAVEECFTKSDVVFANRPRILLGEHLGYNSTSLVWSPYGSHWRNLRKLLSHDILSNTSLQTLSCYIRKDE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query148 2.2.26 [Sep-21-2011]
P93147 499 Isoflavone 2'-hydroxylase N/A no 0.952 0.282 0.469 6e-30
Q9FG65 502 Cytochrome P450 81D1 OS=A no no 0.979 0.288 0.458 2e-28
O65790 500 Cytochrome P450 81F1 OS=A no no 0.966 0.286 0.440 1e-26
Q9LSF8 515 Cytochrome P450 82G1 OS=A no no 0.817 0.234 0.442 5e-25
Q43068 544 Cytochrome P450 82A1 (Fra N/A no 0.824 0.224 0.406 3e-21
O49859 525 Cytochrome P450 82A4 OS=G no no 0.736 0.207 0.403 3e-21
Q9STK8 490 Cytochrome P450 71A25 OS= no no 0.972 0.293 0.337 3e-20
D5JBW8 488 Germacrene A oxidase OS=C N/A no 0.972 0.295 0.367 6e-20
P93531 500 Cytochrome P450 71D7 OS=S N/A no 0.858 0.254 0.353 6e-20
Q9SZ46 524 Cytochrome P450 82C4 OS=A no no 0.817 0.230 0.373 8e-20
>sp|P93147|C81E1_GLYEC Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 Back     alignment and function desciption
 Score =  129 bits (324), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 69/147 (46%), Positives = 97/147 (65%), Gaps = 6/147 (4%)

Query: 2   LLYLILLIALCIVATHLNNKIKNLPPNPFPALPIVGHLYLIFKNKPLHRTLSQLSSKHGP 61
           + YL L     IV      K KNLPP P P+LPI+G+L+ +   +PLHRT   LS K+G 
Sbjct: 11  VFYLALFFIFNIVIRA--RKFKNLPPGP-PSLPIIGNLHHL--KRPLHRTFKGLSEKYGH 65

Query: 62  ILLLNLGTRRVLLLSSPSAVEECFTKSDVVFANRPRILLGEHLGYNSTSLVWSPYGSHWR 121
           +  L  G+R V+++SS S  ++CFTK+DVV ANRPR L G+++ YN T+L  + YG HWR
Sbjct: 66  VFSLWFGSRLVVVVSSASEFQQCFTKNDVVLANRPRFLSGKYIFYNYTTLGSTSYGEHWR 125

Query: 122 NLRKLLSHDILSNTSLQTLSCYIRKDE 148
           NLR++ + D+LSN  + + S  IR+DE
Sbjct: 126 NLRRITALDVLSNHRINSFSG-IRRDE 151
Catalyzes the hydroxylation of isoflavones, daidzein and formononetin, to yield 2'-hydroxyisoflavones, 2'-hydroxydaidzein, and 2'-hydroxyformononetin, respectively.
Glycyrrhiza echinata (taxid: 46348)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: 8EC: 9
>sp|Q9FG65|C81D1_ARATH Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 Back     alignment and function description
>sp|O65790|C81F1_ARATH Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 Back     alignment and function description
>sp|Q9LSF8|C82G1_ARATH Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 Back     alignment and function description
>sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 Back     alignment and function description
>sp|O49859|C82A4_SOYBN Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=2 SV=1 Back     alignment and function description
>sp|Q9STK8|C71AP_ARATH Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 Back     alignment and function description
>sp|D5JBW8|GAO_CICIN Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 Back     alignment and function description
>sp|P93531|C71D7_SOLCH Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 Back     alignment and function description
>sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
224129922 499 cytochrome P450 [Populus trichocarpa] gi 0.979 0.290 0.614 4e-48
225458768 499 PREDICTED: isoflavone 2'-hydroxylase-lik 0.979 0.290 0.601 4e-46
302142236 445 unnamed protein product [Vitis vinifera] 0.979 0.325 0.601 7e-46
224136872 468 cytochrome P450 [Populus trichocarpa] gi 0.925 0.292 0.626 3e-45
332071110 509 cytochrome P450 [Panax notoginseng] 0.979 0.284 0.581 2e-44
224103363 501 cytochrome P450 [Populus trichocarpa] gi 0.871 0.257 0.636 2e-42
224067242 501 cytochrome P450 [Populus trichocarpa] gi 0.871 0.257 0.628 4e-42
225458770 498 PREDICTED: isoflavone 2'-hydroxylase [Vi 0.972 0.289 0.563 3e-40
302142235 476 unnamed protein product [Vitis vinifera] 0.972 0.302 0.563 4e-40
297743421 419 unnamed protein product [Vitis vinifera] 0.966 0.341 0.554 4e-40
>gi|224129922|ref|XP_002320704.1| cytochrome P450 [Populus trichocarpa] gi|222861477|gb|EEE99019.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  195 bits (496), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 123/148 (83%), Gaps = 3/148 (2%)

Query: 1   MLLYLILLIALCIVATHLNNKIKNLPPNPFPALPIVGHLYLIFKNKPLHRTLSQLSSKHG 60
           ++LY  +++AL I+ +H  +KI+N PP PFP+LPI+GHLYL+   KP++RTLS++SSKHG
Sbjct: 4   LILYFPVILALYIITSHFLDKIRNFPPGPFPSLPIIGHLYLL--KKPIYRTLSKISSKHG 61

Query: 61  PILLLNLGTRRVLLLSSPSAVEECFTKSDVVFANRPRILLGEHLGYNSTSLVWSPYGSHW 120
           P+LLL LG+RR+L++SSPS  EECFTK+DVVFANRPR+L+ +HL YNSTSLVW+PYG HW
Sbjct: 62  PVLLLQLGSRRLLVVSSPSIAEECFTKNDVVFANRPRLLIAKHLAYNSTSLVWAPYGDHW 121

Query: 121 RNLRKLLSHDILSNTSLQTLSCYIRKDE 148
           RNLR+++S ++LS   LQ LS  IR +E
Sbjct: 122 RNLRRIVSIEVLSAYRLQMLSA-IRLEE 148

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225458768|ref|XP_002285105.1| PREDICTED: isoflavone 2'-hydroxylase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302142236|emb|CBI19439.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224136872|ref|XP_002326966.1| cytochrome P450 [Populus trichocarpa] gi|222835281|gb|EEE73716.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|332071110|gb|AED99874.1| cytochrome P450 [Panax notoginseng] Back     alignment and taxonomy information
>gi|224103363|ref|XP_002334060.1| cytochrome P450 [Populus trichocarpa] gi|222869629|gb|EEF06760.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224067242|ref|XP_002302426.1| cytochrome P450 [Populus trichocarpa] gi|222844152|gb|EEE81699.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225458770|ref|XP_002283235.1| PREDICTED: isoflavone 2'-hydroxylase [Vitis vinifera] Back     alignment and taxonomy information
>gi|302142235|emb|CBI19438.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743421|emb|CBI36288.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
TAIR|locus:2114965 518 CYP81H1 ""cytochrome P450, fam 0.763 0.218 0.474 1.4e-23
TAIR|locus:2115075 492 CYP81D4 ""cytochrome P450, fam 0.770 0.231 0.462 2.4e-22
TAIR|locus:2115135 495 CYP81D5 ""cytochrome P450, fam 0.763 0.228 0.449 4.1e-22
TAIR|locus:2058619 515 CYP81D6 ""cytochrome P450, fam 0.763 0.219 0.449 7.8e-22
TAIR|locus:2058657 543 CYP81D7 ""cytochrome P450, fam 0.763 0.208 0.440 8.8e-21
TAIR|locus:2090275 515 CYP82G1 "cytochrome P450, fami 0.783 0.225 0.410 2.1e-20
TAIR|locus:2183597 502 CYP81D1 "cytochrome P450, fami 0.763 0.225 0.434 2.5e-20
TAIR|locus:2126342 497 CYP81D8 ""cytochrome P450, fam 0.770 0.229 0.436 4e-20
TAIR|locus:2142494 500 CYP81K1 ""cytochrome P450, fam 0.770 0.228 0.422 1.8e-19
TAIR|locus:2098418 509 CYP81D11 "cytochrome P450, fam 0.756 0.220 0.435 3.2e-19
TAIR|locus:2114965 CYP81H1 ""cytochrome P450, family 81, subfamily H, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 277 (102.6 bits), Expect = 1.4e-23, P = 1.4e-23
 Identities = 55/116 (47%), Positives = 75/116 (64%)

Query:    34 PIVGHLYLIFKNKPLHRTLSQLSSKHGPIXXXXXXXXXXXXXSSPSAVEECF-TKSDVVF 92
             PI+GHL+L+ K   LHRTLS LS   GP+             SSP+A EECF TK+D+V 
Sbjct:    39 PIIGHLHLL-KKPLLHRTLSHLSHSLGPVFSLRLGSRLAVIISSPTAAEECFLTKNDIVL 97

Query:    93 ANRPRILLGEHLGYNSTSLVWSPYGSHWRNLRKLLSHDILSNTSLQTLSCYIRKDE 148
             ANRPR ++G+++ Y+ TS+V +PYG HWRNLR++ + ++ S   L   S  IR DE
Sbjct:    98 ANRPRFIMGKYVAYDYTSMVTAPYGDHWRNLRRITALEVFSTNRLNA-SAEIRHDE 152
GO:0005506 "iron ion binding" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2115075 CYP81D4 ""cytochrome P450, family 81, subfamily D, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115135 CYP81D5 ""cytochrome P450, family 81, subfamily D, polypeptide 5"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058619 CYP81D6 ""cytochrome P450, family 81, subfamily D, polypeptide 6"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058657 CYP81D7 ""cytochrome P450, family 81, subfamily D, polypeptide 7"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090275 CYP82G1 "cytochrome P450, family 82, subfamily G, polypeptide 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2183597 CYP81D1 "cytochrome P450, family 81, subfamily D, polypeptide 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2126342 CYP81D8 ""cytochrome P450, family 81, subfamily D, polypeptide 8"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142494 CYP81K1 ""cytochrome P450, family 81, subfamily K, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098418 CYP81D11 "cytochrome P450, family 81, subfamily D, polypeptide 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
CYP81B7
cytochrome P450 (499 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 1e-23
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 2e-20
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 4e-20
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 1e-17
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 2e-15
pfam00067 461 pfam00067, p450, Cytochrome P450 5e-14
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 5e-13
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 7e-13
PLN03018 534 PLN03018, PLN03018, homomethionine N-hydroxylase 9e-13
PLN02971 543 PLN02971, PLN02971, tryptophan N-hydroxylase 4e-11
PLN00168 519 PLN00168, PLN00168, Cytochrome P450; Provisional 2e-10
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 8e-10
PLN02655 466 PLN02655, PLN02655, ent-kaurene oxidase 7e-05
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information 
 Score = 95.3 bits (237), Expect = 1e-23
 Identities = 49/156 (31%), Positives = 76/156 (48%), Gaps = 13/156 (8%)

Query: 1   MLLYLILLIALCIVATHLNN-------KIKNLPPNPFPALPIVGHLYLIFKNKPL-HRTL 52
               L LL ++ I    +         K   LPP P P  PIVG+L    +  PL HR L
Sbjct: 2   DSFLLSLLFSVLIFNVLIWRWLNASMRKSLRLPPGP-PRWPIVGNL---LQLGPLPHRDL 57

Query: 53  SQLSSKHGPILLLNLGTRRVLLLSSPSAVEECFTKSDVVFANRPRILLGEHLGYNSTSLV 112
           + L  K+GP++ L LG+   +    P  + E   + D VFA+RPR L   HL Y    + 
Sbjct: 58  ASLCKKYGPLVYLRLGSVDAITTDDPELIREILLRQDDVFASRPRTLAAVHLAYGCGDVA 117

Query: 113 WSPYGSHWRNLRKLLSHDILSNTSLQTLSCYIRKDE 148
            +P G HW+ +R++    +L+   L++ + + R +E
Sbjct: 118 LAPLGPHWKRMRRICMEHLLTTKRLESFAKH-RAEE 152

Length = 514
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 148
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.95
PLN02687 517 flavonoid 3'-monooxygenase 99.9
PLN02394 503 trans-cinnamate 4-monooxygenase 99.89
PLN03234 499 cytochrome P450 83B1; Provisional 99.89
PLN02183 516 ferulate 5-hydroxylase 99.89
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.89
PLN02971 543 tryptophan N-hydroxylase 99.88
PLN03112 514 cytochrome P450 family protein; Provisional 99.88
PTZ00404 482 cytochrome P450; Provisional 99.87
PLN02966 502 cytochrome P450 83A1 99.86
PLN00168 519 Cytochrome P450; Provisional 99.86
PLN02196 463 abscisic acid 8'-hydroxylase 99.85
PLN02774 463 brassinosteroid-6-oxidase 99.85
PLN02655 466 ent-kaurene oxidase 99.84
PLN02500 490 cytochrome P450 90B1 99.83
PLN02290 516 cytokinin trans-hydroxylase 99.83
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.82
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.79
PLN03018 534 homomethionine N-hydroxylase 99.79
PLN02302 490 ent-kaurenoic acid oxidase 99.78
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.77
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.76
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.76
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.72
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.69
PLN02738 633 carotene beta-ring hydroxylase 99.64
PLN02936 489 epsilon-ring hydroxylase 99.63
PLN02648 480 allene oxide synthase 99.6
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.52
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 99.46
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.35
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 98.53
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=99.95  E-value=4.9e-27  Score=171.12  Aligned_cols=132  Identities=35%  Similarity=0.603  Sum_probs=114.1

Q ss_pred             HHHHhhcCCCCCCCCCCCCCceeeecchhcccCchHHHHHHHHhhcCCeeEEEcCCccEEEecCHHHHHHHHhhCCCCCC
Q 043622           14 VATHLNNKIKNLPPNPFPALPIVGHLYLIFKNKPLHRTLSQLSSKHGPILLLNLGTRRVLLLSSPSAVEECFTKSDVVFA   93 (148)
Q Consensus        14 ~~~~~~~~~~~~ppgp~~~~p~~G~~~~~~~~~~~~~~~~~~~~~yg~v~~~~~~~~~~v~i~~p~~~~~i~~~~~~~~~   93 (148)
                      ++....++..++||||+ ++|++||++++. ....+..+.++.++||+++.+++|..++|+++|+++++|++.+++..|.
T Consensus        16 ~~~~~~~~~~~lPPGP~-~lPiIGnl~~l~-~~~~h~~~~~ls~~yGpi~tl~lG~~~~Vviss~~~akE~l~~~d~~fa   93 (489)
T KOG0156|consen   16 LFFKKYRKRRNLPPGPP-PLPIIGNLHQLG-SLPPHRSFRKLSKKYGPVFTLRLGSVPVVVISSYEAAKEVLVKQDLEFA   93 (489)
T ss_pred             HHHHhccCCCCCCcCCC-CCCccccHHHcC-CCchhHHHHHHHHHhCCeEEEEecCceEEEECCHHHHHHHHHhCCcccc
Confidence            33444445589999999 999999999994 3359999999999999999999999999999999999999999999999


Q ss_pred             CCCc-hhhhhhhccCCCceEeCCCCchHHHHHhhhhhhcCChhhHhhhhhhhhhcC
Q 043622           94 NRPR-ILLGEHLGYNSTSLVWSPYGSHWRNLRKLLSHDILSNTSLQTLSCYIRKDE  148 (148)
Q Consensus        94 ~~~~-~~~~~~~~~~~~~~~~~~~g~~w~~~R~~~~~~~f~~~~l~~~~~~~~~~~  148 (148)
                      .|+. ......+.+++.|++++.+|+.|+++||+...++|+...++++.. +..+|
T Consensus        94 ~Rp~~~~~~~~~~~~~~~i~~a~yG~~Wr~~Rr~~~~~L~~~~~~~~~~~-~R~~E  148 (489)
T KOG0156|consen   94 DRPDPTATLKYLSYGGKGIVFAPYGDYWREMRRFALTELRSFGRGKSFME-IREEE  148 (489)
T ss_pred             CCCCchhhHHHhcCCCCceEeCCCcHHHHHHHHHHHHHhcChhhhhhhHH-HHHHH
Confidence            9997 224456666678999998899999999999999999999999987 76443

>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
3ruk_A 494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 8e-04
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure 
Iteration: 1

 Score = 39.3 bits (90), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 41/95 (43%)
Query: 32  ALPIVGHLYLIFKNKPLHRTLSQLSSKHGPIXXXXXXXXXXXXXSSPSAVEECFTKSDVV 91
           +LP+VG L  + ++  +H    +L  K+GPI                   +E   K    
Sbjct: 15  SLPLVGSLPFLPRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKD 74
Query: 92  FANRPRILLGEHLGYNSTSLVWSPYGSHWRNLRKL 126
           F+ RP++   +    N   + ++  G+HW+  R+L
Sbjct: 75  FSGRPQMATLDIASNNRKGIAFADSGAHWQLHRRL 109

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 1e-31
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 2e-26
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 7e-25
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 3e-24
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 7e-24
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 4e-23
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 9e-22
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 1e-21
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 3e-21
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 7e-20
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 1e-19
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 5e-19
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 5e-19
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 7e-19
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 2e-18
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 8e-17
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 4e-16
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 2e-13
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 3e-12
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 9e-12
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 9e-12
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 2e-11
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 3e-10
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 3e-09
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 3e-07
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 2e-06
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
 Score =  116 bits (292), Expect = 1e-31
 Identities = 19/126 (15%), Positives = 42/126 (33%), Gaps = 10/126 (7%)

Query: 23  KNLPPNPFPALPIVGHLYLIFKNKPLHRTLSQLSSKHGPILLLNLGTRRVLLLSSPSAVE 82
           +N PP     +P +GH     K+    + L+++  KHG I  +      + +L   +  +
Sbjct: 17  RNEPPLDKGMIPWLGHALEFGKD--AAKFLTRMKEKHGDIFTVRAAGLYITVLLDSNCYD 74

Query: 83  ECFTKSDVVFANRPRILLGEHLGYNSTSLVWSPYGSHWRNLRKLLSHDILSNTSLQTLSC 142
              +    +          + L     +++   +       R  +        SL  LS 
Sbjct: 75  AVLSDVASLDQTSY----AQVLMKRIFNMILPSHNPESEKKRAEMH---FQGASLTQLS- 126

Query: 143 YIRKDE 148
              ++ 
Sbjct: 127 NSMQNN 132
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.88
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.87
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.86
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.86
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.85
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.84
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.83
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.83
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.82
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.81
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.81
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.8
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.8
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.79
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.79
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.78
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.77
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.76
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.76
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.75
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.74
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.73
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.72
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.65
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.62
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.61
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.6
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.6
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.59
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.54
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.53
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.52
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.49
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.47
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.46
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 99.45
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.45
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.44
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.43
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.42
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.42
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.41
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.41
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.4
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.38
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.36
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.34
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 99.31
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.31
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 99.31
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.3
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 99.3
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.3
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.3
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.29
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 99.27
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.26
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.23
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.23
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 99.22
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 99.22
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.2
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 99.2
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.17
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.15
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.1
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.09
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.08
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 98.99
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 98.99
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 98.97
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 98.95
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 98.81
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 98.76
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 98.72
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 98.25
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 94.81
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
Probab=99.88  E-value=9.7e-23  Score=148.64  Aligned_cols=124  Identities=23%  Similarity=0.399  Sum_probs=97.5

Q ss_pred             CCCCCCCCCCCCCceeeecchhcccCchHHHHHHHHhhcCCeeEEEcCCccEEEecCHHHHHHHHhhCCCCCCCCCchhh
Q 043622           21 KIKNLPPNPFPALPIVGHLYLIFKNKPLHRTLSQLSSKHGPILLLNLGTRRVLLLSSPSAVEECFTKSDVVFANRPRILL  100 (148)
Q Consensus        21 ~~~~~ppgp~~~~p~~G~~~~~~~~~~~~~~~~~~~~~yg~v~~~~~~~~~~v~i~~p~~~~~i~~~~~~~~~~~~~~~~  100 (148)
                      +..+.||||+ ++|++||++.+...+..+..+.+|+++||+++++++|+.++++++||+++++++.+++..|.+++....
T Consensus         5 ~~~~~PPgP~-~lPliGnl~~l~~~~~~~~~~~~~~~kYG~i~~~~~g~~~~vvv~~p~~~k~il~~~~~~f~~rp~~~~   83 (494)
T 3swz_A            5 TGAKYPKSLL-SLPLVGSLPFLPRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMAT   83 (494)
T ss_dssp             -------CCB-CCCEEEEESSCTTSSCHHHHHHHTHHHHCSEEEEEETTEEEEEECSHHHHHHHHTTTTTTTBBCCCCHH
T ss_pred             CCCCCCCCCC-CCCeEcchHHhCCCCchhHHHHHHHHHcCCEEEEEeCCCCEEEECCHHHHHHHHHhCcHhhCCCCCcHH
Confidence            3456899999 999999999875124678899999999999999999999999999999999999998889988887655


Q ss_pred             hhhhccCCCceEeCCCCchHHHHHhhhhhhcCCh--hhHhhhhhhhhhc
Q 043622          101 GEHLGYNSTSLVWSPYGSHWRNLRKLLSHDILSN--TSLQTLSCYIRKD  147 (148)
Q Consensus       101 ~~~~~~~~~~~~~~~~g~~w~~~R~~~~~~~f~~--~~l~~~~~~~~~~  147 (148)
                      ....+..+.|++++++|+.|+++||++++ .|+.  ..++.+.+ ++++
T Consensus        84 ~~~~~~~~~gl~~~~~g~~wr~~Rr~~~~-~f~~~~~~~~~~~~-~i~~  130 (494)
T 3swz_A           84 LDIASNNRKGIAFADSGAHWQLHRRLAMA-TFALFKDGDQKLEK-IICQ  130 (494)
T ss_dssp             HHHHTTTTCSSSSSCSSHHHHHHHHHHHH-HTTTTSSSTTCHHH-HHHH
T ss_pred             HHHhccCCCCeEeCCCCHHHHHHHHHHHH-HHHHhcchHHHHHH-HHHH
Confidence            55555545788777779999999999999 7874  44666666 5543
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 148
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 3e-25
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 5e-23
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 6e-23
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 3e-20
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 2e-18
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 5e-17
d1n97a_ 385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 4e-13
d1odoa_ 401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 1e-08
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2c9
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 97.5 bits (241), Expect = 3e-25
 Identities = 29/124 (23%), Positives = 54/124 (43%), Gaps = 4/124 (3%)

Query: 25  LPPNPFPALPIVGHLYLIFKNKPLHRTLSQLSSKHGPILLLNLGTRRVLLLSSPSAVEEC 84
           LPP P P LP++G++  I   K + ++L+ LS  +GP+  L  G + +++L    AV+E 
Sbjct: 4   LPPGPTP-LPVIGNILQIGI-KDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEA 61

Query: 85  FTKSDVVFANRPRILLGEHLGYNSTSLVWSPYGSHWRNLRKLLSHDILSNTSLQTLSCYI 144
                  F+ R    L E         +    G  W+ +R+     + +    +      
Sbjct: 62  LIDLGEEFSGRGIFPLAERANRGFG--IVFSNGKKWKEIRRFSLMTLRNFGMGKRSIEDR 119

Query: 145 RKDE 148
            ++E
Sbjct: 120 VQEE 123
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.84
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.83
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.83
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.8
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.77
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.76
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.6
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.56
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.44
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.23
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.23
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.17
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.04
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 98.95
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 98.86
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 98.63
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 98.58
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 98.49
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 98.48
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 97.88
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 97.79
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.84  E-value=1.1e-21  Score=140.10  Aligned_cols=117  Identities=21%  Similarity=0.307  Sum_probs=95.3

Q ss_pred             CCCCCCCCCCCCCceeeecchhcccCchHHHHHHHHhhcCCeeEEEcCCccEEEecCHHHHHHHHhhCCCCC-CCCCchh
Q 043622           21 KIKNLPPNPFPALPIVGHLYLIFKNKPLHRTLSQLSSKHGPILLLNLGTRRVLLLSSPSAVEECFTKSDVVF-ANRPRIL   99 (148)
Q Consensus        21 ~~~~~ppgp~~~~p~~G~~~~~~~~~~~~~~~~~~~~~yg~v~~~~~~~~~~v~i~~p~~~~~i~~~~~~~~-~~~~~~~   99 (148)
                      +++++ |||+ ++|++|+++++  ..+.+.++.+++++||+++++++++.++|+++||+++++|+.++...+ ..+....
T Consensus         7 ~~~~i-PGP~-~~P~iG~~~~~--~~~~~~~~~~~~~kyG~i~~~~l~~~~~vvv~~p~~~~~il~~~~~~~~~~~~~~~   82 (472)
T d1tqna_           7 KKLGI-PGPT-PLPFLGNILSY--HKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFG   82 (472)
T ss_dssp             HHTTC-CCCC-CBTTTBTGGGG--GGCHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHHHTTTTTTTCCBCCCCS
T ss_pred             hhcCC-CCCC-CcCceeEHHHh--hCCHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHHHHhcCCcccccCCcccc
Confidence            34566 5999 99999999998  678899999999999999999999999999999999999998765433 3333322


Q ss_pred             hhhhhccCCCceEeCCCCchHHHHHhhhhhhcCChhhHhhhhhhhhhc
Q 043622          100 LGEHLGYNSTSLVWSPYGSHWRNLRKLLSHDILSNTSLQTLSCYIRKD  147 (148)
Q Consensus       100 ~~~~~~~~~~~~~~~~~g~~w~~~R~~~~~~~f~~~~l~~~~~~~~~~  147 (148)
                      ....   .++++++++ |+.|+++|+++++ .|+.+.++.+.+ ++++
T Consensus        83 ~~~~---~~~~i~~~~-g~~~~~~R~~~~~-~~~~~~l~~~~~-~~~~  124 (472)
T d1tqna_          83 PVGF---MKSAISIAE-DEEWKRLRSLLSP-TFTSGKLKEMVP-IIAQ  124 (472)
T ss_dssp             CCGG---GGGSTTTCC-HHHHHHHHHHTTG-GGSHHHHHTTHH-HHHH
T ss_pred             cccc---cCCceeccC-cHHHHHhhhhcCc-cccchhhhcccc-hhhh
Confidence            2222   236777777 9999999999999 899999999988 7653
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure