Citrus Sinensis ID: 043639
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 261 | ||||||
| 255541150 | 363 | Metalloendoproteinase 1 precursor, putat | 0.800 | 0.575 | 0.793 | 8e-95 | |
| 147812598 | 353 | hypothetical protein VITISV_024635 [Viti | 0.873 | 0.645 | 0.682 | 8e-89 | |
| 224136988 | 295 | predicted protein [Populus trichocarpa] | 0.877 | 0.776 | 0.696 | 4e-88 | |
| 225453480 | 353 | PREDICTED: metalloendoproteinase 1 [Viti | 0.831 | 0.614 | 0.702 | 1e-87 | |
| 15225398 | 342 | matrix metalloprotease domain-containing | 0.819 | 0.625 | 0.706 | 5e-84 | |
| 359495960 | 302 | PREDICTED: metalloendoproteinase 1-like | 0.869 | 0.751 | 0.635 | 1e-83 | |
| 297824541 | 336 | matrix metalloproteinase [Arabidopsis ly | 0.823 | 0.639 | 0.694 | 3e-83 | |
| 3128477 | 341 | metalloproteinase [Arabidopsis thaliana] | 0.816 | 0.624 | 0.702 | 2e-82 | |
| 147773502 | 373 | hypothetical protein VITISV_013507 [Viti | 0.842 | 0.589 | 0.637 | 5e-81 | |
| 356523082 | 381 | PREDICTED: metalloendoproteinase 1-like | 0.750 | 0.514 | 0.709 | 7e-81 |
| >gi|255541150|ref|XP_002511639.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis] gi|223548819|gb|EEF50308.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 352 bits (903), Expect = 8e-95, Method: Compositional matrix adjust.
Identities = 169/213 (79%), Positives = 188/213 (88%), Gaps = 4/213 (1%)
Query: 46 TRHK----KDYVLFPGKPRWTRHVPMTLSYAFSKENMINYLHITDIKAVFKRAFSKWASV 101
T HK ++YV FPGKPRW R +PM L+YAFS EN+I+YL I+D++ VFKRAFS+W SV
Sbjct: 133 TGHKLHVSRNYVYFPGKPRWGRDIPMNLTYAFSPENLISYLKISDLQEVFKRAFSRWESV 192
Query: 102 IPVSFIETDDYDFADIRIGFYNGDHGDGEPFDGVLGVLAHSFSPESGKFHLDAAETWAVD 161
IPVSFIE DY +ADI+IGFYNGDHGDGEPFDG+LGVLAHSFSPESGKFHLDAAETWAVD
Sbjct: 193 IPVSFIEISDYSYADIKIGFYNGDHGDGEPFDGILGVLAHSFSPESGKFHLDAAETWAVD 252
Query: 162 FGSEKSPVAVDLESVAVHEIGHLLGLTHSPVKEAVMYPTLKPRDKKVDLALDDIQGVQAL 221
F SEKS VAVDLESVAVHEIGHLLGL HS VKEAVMYP+LKPR KKVDL++DDIQGVQAL
Sbjct: 253 FESEKSKVAVDLESVAVHEIGHLLGLAHSSVKEAVMYPSLKPRKKKVDLSVDDIQGVQAL 312
Query: 222 YGSNPNFTIGSLVESDISTNLAVDLRIKSSMWA 254
YGSNPN+T+GSL+ESDISTN AV LRI SS WA
Sbjct: 313 YGSNPNYTLGSLLESDISTNQAVRLRITSSPWA 345
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147812598|emb|CAN66084.1| hypothetical protein VITISV_024635 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224136988|ref|XP_002326995.1| predicted protein [Populus trichocarpa] gi|222835310|gb|EEE73745.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225453480|ref|XP_002274477.1| PREDICTED: metalloendoproteinase 1 [Vitis vinifera] gi|297734565|emb|CBI16616.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|15225398|ref|NP_182030.1| matrix metalloprotease domain-containing protein [Arabidopsis thaliana] gi|26452204|dbj|BAC43190.1| putative metalloproteinase [Arabidopsis thaliana] gi|31711730|gb|AAP68221.1| At2g45040 [Arabidopsis thaliana] gi|330255405|gb|AEC10499.1| matrix metalloprotease domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|359495960|ref|XP_003635123.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297824541|ref|XP_002880153.1| matrix metalloproteinase [Arabidopsis lyrata subsp. lyrata] gi|297325992|gb|EFH56412.1| matrix metalloproteinase [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|3128477|gb|AAC31167.1| metalloproteinase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|147773502|emb|CAN66781.1| hypothetical protein VITISV_013507 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356523082|ref|XP_003530171.1| PREDICTED: metalloendoproteinase 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 261 | ||||||
| TAIR|locus:2055605 | 342 | AT2G45040 [Arabidopsis thalian | 0.816 | 0.622 | 0.710 | 7.4e-82 | |
| TAIR|locus:2130928 | 364 | AT4G16640 [Arabidopsis thalian | 0.708 | 0.508 | 0.619 | 3.5e-59 | |
| TAIR|locus:2020548 | 378 | MMP "matrix metalloproteinase" | 0.666 | 0.460 | 0.576 | 5.6e-52 | |
| TAIR|locus:2032467 | 384 | AT1G24140 [Arabidopsis thalian | 0.678 | 0.460 | 0.529 | 7.7e-48 | |
| TAIR|locus:2025891 | 360 | AT1G59970 [Arabidopsis thalian | 0.670 | 0.486 | 0.524 | 1.4e-46 | |
| UNIPROTKB|O60882 | 483 | MMP20 "Matrix metalloproteinas | 0.636 | 0.343 | 0.406 | 3.4e-29 | |
| UNIPROTKB|P79287 | 483 | MMP20 "Matrix metalloproteinas | 0.639 | 0.345 | 0.398 | 5.9e-29 | |
| UNIPROTKB|F1SV69 | 468 | MMP8 "Uncharacterized protein" | 0.628 | 0.350 | 0.406 | 2.2e-28 | |
| UNIPROTKB|E2RMU9 | 483 | MMP20 "Uncharacterized protein | 0.616 | 0.333 | 0.406 | 3e-28 | |
| MGI|MGI:1353466 | 482 | Mmp20 "matrix metallopeptidase | 0.636 | 0.344 | 0.390 | 3.8e-28 |
| TAIR|locus:2055605 AT2G45040 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 803 (287.7 bits), Expect = 7.4e-82, Sum P(2) = 7.4e-82
Identities = 152/214 (71%), Positives = 177/214 (82%)
Query: 38 DKYDPAEATRHK-KDYVLFPGKPRWTRHVPMTLSYAFSKENMINYLHITDIKAVFKRAFS 96
D +P A H K YV FPG+PRWTR VP+ L+YAFS+EN+ YL TDI+ VF+RAF
Sbjct: 110 DDVEPKTAPFHTGKKYVYFPGRPRWTRDVPLKLTYAFSQENLTPYLAPTDIRRVFRRAFG 169
Query: 97 KWASVIPVSFIETDDYDFADIRIGFYNGDHGDGEPFDGVLGVLAHSFSPESGKFHLDAAE 156
KWASVIPVSFIET+DY ADI+IGF+NGDHGDGEPFDGVLGVLAH+FSPE+G+ HLD AE
Sbjct: 170 KWASVIPVSFIETEDYVIADIKIGFFNGDHGDGEPFDGVLGVLAHTFSPENGRLHLDKAE 229
Query: 157 TWAVDFGSEKSPVAVDLESVAVHEIGHLLGLTHSPVKEAVMYPTLKPRDKKVDLALDDIQ 216
TWAVDF EKS VAVDLESVAVHEIGH+LGL HS VK+A MYPTLKPR KKV+L +DD+
Sbjct: 230 TWAVDFDEEKSSVAVDLESVAVHEIGHVLGLGHSSVKDAAMYPTLKPRSKKVNLNMDDVV 289
Query: 217 GVQALYGSNPNFTIGSLVESDISTNLAVDLRIKS 250
GVQ+LYG+NPNFT+ SL+ S+ STNLA RI+S
Sbjct: 290 GVQSLYGTNPNFTLNSLLASETSTNLADGSRIRS 323
|
|
| TAIR|locus:2130928 AT4G16640 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2020548 MMP "matrix metalloproteinase" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2032467 AT1G24140 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025891 AT1G59970 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O60882 MMP20 "Matrix metalloproteinase-20" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P79287 MMP20 "Matrix metalloproteinase-20" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SV69 MMP8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RMU9 MMP20 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1353466 Mmp20 "matrix metallopeptidase 20 (enamelysin)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00019156001 | SubName- Full=Chromosome chr15 scaffold_19, whole genome shotgun sequence; (291 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 261 | |||
| pfam00413 | 159 | pfam00413, Peptidase_M10, Matrixin | 5e-65 | |
| cd04278 | 157 | cd04278, ZnMc_MMP, Zinc-dependent metalloprotease, | 1e-62 | |
| smart00235 | 139 | smart00235, ZnMc, Zinc-dependent metalloprotease | 2e-23 | |
| cd04279 | 156 | cd04279, ZnMc_MMP_like_1, Zinc-dependent metallopr | 8e-17 | |
| cd04277 | 186 | cd04277, ZnMc_serralysin_like, Zinc-dependent meta | 4e-12 | |
| cd04268 | 165 | cd04268, ZnMc_MMP_like, Zinc-dependent metalloprot | 1e-09 | |
| cd00203 | 167 | cd00203, ZnMc, Zinc-dependent metalloprotease | 8e-08 | |
| PRK13267 | 179 | PRK13267, PRK13267, archaemetzincin-like protein; | 1e-04 | |
| cd11375 | 173 | cd11375, Peptidase_M54, Peptidase family M54, also | 4e-04 | |
| COG1913 | 181 | COG1913, COG1913, Predicted Zn-dependent proteases | 6e-04 | |
| cd04327 | 198 | cd04327, ZnMc_MMP_like_3, Zinc-dependent metallopr | 0.002 |
| >gnl|CDD|215908 pfam00413, Peptidase_M10, Matrixin | Back alignment and domain information |
|---|
Score = 199 bits (509), Expect = 5e-65
Identities = 71/167 (42%), Positives = 91/167 (54%), Gaps = 11/167 (6%)
Query: 60 RWTRHVPMTLSYAFSKENMINYLHITDIKAVFKRAFSKWASVIPVSFIETDDYDFADIRI 119
+W + L+Y L +++ +RAF W+ V P++F E ADI+I
Sbjct: 1 KWKKK---NLTYRIVNYT--PDLSRDEVRRAIRRAFKVWSEVTPLTFTEVPT-GTADIKI 54
Query: 120 GFYNGDHGDGEPFDGVLGVLAHSFSPES--GKFHLDAAETWAVDFGSEKSPVAVDLESVA 177
GF G+HGDG PFDG GVLAH+F P G H D E W V G+ P +L VA
Sbjct: 55 GFGRGEHGDGYPFDGPGGVLAHAFFPGPIGGDIHFDDDEQWTV--GNSSGPEGTNLFLVA 112
Query: 178 VHEIGHLLGLTHSPVKEAVMYPTLKPRDKKVD-LALDDIQGVQALYG 223
HEIGH LGL HS +A+MYP P K V L DDI+G+Q+LYG
Sbjct: 113 AHEIGHALGLGHSSDPDAIMYPYYSPYKKPVFRLDQDDIKGIQSLYG 159
|
The members of this family are enzymes that cleave peptides. These proteases require zinc for catalysis. Length = 159 |
| >gnl|CDD|239805 cd04278, ZnMc_MMP, Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family | Back alignment and domain information |
|---|
| >gnl|CDD|214576 smart00235, ZnMc, Zinc-dependent metalloprotease | Back alignment and domain information |
|---|
| >gnl|CDD|239806 cd04279, ZnMc_MMP_like_1, Zinc-dependent metalloprotease; MMP_like sub-family 1 | Back alignment and domain information |
|---|
| >gnl|CDD|239804 cd04277, ZnMc_serralysin_like, Zinc-dependent metalloprotease, serralysin_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|239796 cd04268, ZnMc_MMP_like, Zinc-dependent metalloprotease, MMP_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238124 cd00203, ZnMc, Zinc-dependent metalloprotease | Back alignment and domain information |
|---|
| >gnl|CDD|237325 PRK13267, PRK13267, archaemetzincin-like protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|213029 cd11375, Peptidase_M54, Peptidase family M54, also called archaemetzincins or archaelysins | Back alignment and domain information |
|---|
| >gnl|CDD|224825 COG1913, COG1913, Predicted Zn-dependent proteases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|239819 cd04327, ZnMc_MMP_like_3, Zinc-dependent metalloprotease; MMP_like sub-family 3 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 261 | |||
| KOG1565 | 469 | consensus Gelatinase A and related matrix metallop | 100.0 | |
| cd04278 | 157 | ZnMc_MMP Zinc-dependent metalloprotease, matrix me | 100.0 | |
| PF00413 | 154 | Peptidase_M10: Matrixin This Prosite motif covers | 100.0 | |
| cd04279 | 156 | ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MM | 99.96 | |
| smart00235 | 140 | ZnMc Zinc-dependent metalloprotease. Neutral zinc | 99.92 | |
| cd04277 | 186 | ZnMc_serralysin_like Zinc-dependent metalloproteas | 99.91 | |
| cd04268 | 165 | ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_ | 99.91 | |
| cd04327 | 198 | ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MM | 99.74 | |
| cd00203 | 167 | ZnMc Zinc-dependent metalloprotease. This super-fa | 99.73 | |
| cd04276 | 197 | ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MM | 99.61 | |
| cd04280 | 180 | ZnMc_astacin_like Zinc-dependent metalloprotease, | 99.57 | |
| ) family of metalloendopeptidases encompasses a range of proteins found in hydra to humans, in mature and developmental systems []. Their functions include activation of growth factors, degradation of polypeptides, and processing of extracellular proteins []. The proteins are synthesised with N-terminal signal and pro-enzyme sequences, and many contain multiple domains C-terminal to the protease domain. They are either secreted from cells, or are associated with the plasma membrane. The astacin molecule adopts a kidney shape, with a deep active-site cleft between its N- and C-terminal domains []. The zinc ion, which lies at the bottom of the cleft, exhibits a unique penta-coordinated mode of binding, involving 3 histidine residues, a tyrosine and a water molecule (which is also bound to the carboxylate side chain of Glu93) []. The N-terminal domain comprises 2 alpha-helices and a 5-stranded beta-sheet. The overall topology of this domain is shared by the archetypal zinc-endopeptidase thermolysin. Astacin protease domains also share common features with serralysins, matrix metalloendopeptidases, and snake venom proteases; they cleave peptide bonds in polypeptides such as insulin B chain and bradykinin, and in proteins such as casein and gelatin; and they have arylamidase activity [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3LQB_A 3EDH_A 3EDG_A 3EDI_A 1IAE_A 1IAB_A 1IAA_A 1AST_A 1IAC_A 1QJJ_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF01400">PF01400 | 191 | Astacin: Astacin (Peptidase family M12A) This Pros | 99.54 | |
| cd04281 | 200 | ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1 | 99.54 | |
| PF12388 | 211 | Peptidase_M57: Dual-action HEIGH metallo-peptidase | 99.52 | |
| cd04282 | 230 | ZnMc_meprin Zinc-dependent metalloprotease, meprin | 99.44 | |
| cd04283 | 182 | ZnMc_hatching_enzyme Zinc-dependent metalloproteas | 99.4 | |
| KOG3714 | 411 | consensus Meprin A metalloprotease [Posttranslatio | 99.35 | |
| PF02031 | 132 | Peptidase_M7: Streptomyces extracellular neutral p | 99.19 | |
| COG5549 | 236 | Predicted Zn-dependent protease [Posttranslational | 98.94 | |
| PF11350 | 203 | DUF3152: Protein of unknown function (DUF3152); In | 98.33 | |
| cd04267 | 192 | ZnMc_ADAM_like Zinc-dependent metalloprotease, ADA | 97.98 | |
| cd04273 | 207 | ZnMc_ADAMTS_like Zinc-dependent metalloprotease, A | 97.96 | |
| PF13583 | 206 | Reprolysin_4: Metallo-peptidase family M12B Reprol | 97.91 | |
| PF05572 | 154 | Peptidase_M43: Pregnancy-associated plasma protein | 97.68 | |
| PF13574 | 173 | Reprolysin_2: Metallo-peptidase family M12B Reprol | 97.54 | |
| cd04275 | 225 | ZnMc_pappalysin_like Zinc-dependent metalloproteas | 97.44 | |
| COG1913 | 181 | Predicted Zn-dependent proteases [General function | 97.38 | |
| PF13688 | 196 | Reprolysin_5: Metallo-peptidase family M12; PDB: 2 | 97.32 | |
| PF13582 | 124 | Reprolysin_3: Metallo-peptidase family M12B Reprol | 97.23 | |
| cd04271 | 228 | ZnMc_ADAM_fungal Zinc-dependent metalloprotease, A | 97.18 | |
| PRK13267 | 179 | archaemetzincin-like protein; Reviewed | 97.14 | |
| cd04269 | 194 | ZnMc_adamalysin_II_like Zinc-dependent metalloprot | 97.07 | |
| PF07998 | 194 | Peptidase_M54: Peptidase family M54; InterPro: IPR | 96.91 | |
| PF01421 | 199 | Reprolysin: Reprolysin (M12B) family zinc metallop | 96.46 | |
| cd04270 | 244 | ZnMc_TACE_like Zinc-dependent metalloprotease; TAC | 96.33 | |
| cd04272 | 220 | ZnMc_salivary_gland_MPs Zinc-dependent metalloprot | 95.98 | |
| KOG4525 | 614 | consensus Jacalin-like lectin domain-containing pr | 95.48 | |
| PF11150 | 213 | DUF2927: Protein of unknown function (DUF2927); In | 95.03 | |
| PF04298 | 222 | Zn_peptidase_2: Putative neutral zinc metallopepti | 94.63 | |
| PF10462 | 305 | Peptidase_M66: Peptidase M66; InterPro: IPR019503 | 94.59 | |
| PF05548 | 314 | Peptidase_M11: Gametolysin peptidase M11; InterPro | 94.47 | |
| PF12044 | 423 | Metallopep: Putative peptidase family; InterPro: I | 93.87 | |
| TIGR03296 | 286 | M6dom_TIGR03296 M6 family metalloprotease domain. | 93.46 | |
| COG2738 | 226 | Predicted Zn-dependent protease [General function | 93.27 | |
| PTZ00337 | 567 | surface protease GP63; Provisional | 92.63 | |
| PTZ00257 | 622 | Glycoprotein GP63 (leishmanolysin); Provisional | 92.46 | |
| COG3824 | 136 | Predicted Zn-dependent protease [General function | 91.42 | |
| PF01457 | 521 | Peptidase_M8: Leishmanolysin This Prosite motif co | 91.41 | |
| PF05547 | 645 | Peptidase_M6: Immune inhibitor A peptidase M6; Int | 88.8 | |
| KOG3607 | 716 | consensus Meltrins, fertilins and related Zn-depen | 87.96 | |
| PF09471 | 264 | Peptidase_M64: IgA Peptidase M64; InterPro: IPR019 | 86.61 | |
| PF06262 | 97 | DUF1025: Possibl zinc metallo-peptidase; InterPro: | 85.79 | |
| KOG3658 | 764 | consensus Tumor necrosis factor-alpha-converting e | 84.1 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 82.85 |
| >KOG1565 consensus Gelatinase A and related matrix metalloproteases [Posttranslational modification, protein turnover, chaperones; Extracellular structures] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.2e-48 Score=370.50 Aligned_cols=187 Identities=43% Similarity=0.787 Sum_probs=172.2
Q ss_pred HHHHHHhcCCCCCCCCCCCcccccCCCCCChhhhhccccceeeCCCCCcccCCCCeeEEEEEecCCcCCcCCHHHHHHHH
Q 043639 12 IFIIFIHESPQCIAVRSTPKFKLKQSDKYDPAEATRHKKDYVLFPGKPRWTRHVPMTLSYAFSKENMINYLHITDIKAVF 91 (261)
Q Consensus 12 ~~~~~~m~~PRCGvpD~~~~~~~~~~~~~~~~~~~~~~kry~~~~~~~kW~~~~~~~LTY~~~~~~~~~~l~~~~~~~~i 91 (261)
-.|+..|++|||||||. | |++++++.||.+. +|||+|. |++++++..+++.++
T Consensus 79 ~~Tl~~m~~prCgvpd~-------------------~---~~~~~~~~kW~k~---~lT~ri~--n~~~~l~~~~vr~~~ 131 (469)
T KOG1565|consen 79 NATLALMNKPRCGVPDG-------------------R---YRYFPGKPKWNKE---HLTYRIK--NYTPYLPQAEVRCAK 131 (469)
T ss_pred hhhhhhccCCCcCCCCC-------------------c---cccCcccCccccc---ccceecc--ccCCCCCHHHHHHHH
Confidence 46889999999999991 2 6778899999999 9999999 678899999999999
Q ss_pred HHHHHHhHhcCCceEEEcCCCCCcceEEEeeecCCCCCCCccCCCCceeeecCCC---CceeeecccccccccCCCCCCC
Q 043639 92 KRAFSKWASVIPVSFIETDDYDFADIRIGFYNGDHGDGEPFDGVLGVLAHSFSPE---SGKFHLDAAETWAVDFGSEKSP 168 (261)
Q Consensus 92 ~~Af~~Ws~vt~l~F~ev~~~~~aDI~I~f~~~~hgd~~~fdG~gg~lAhA~~P~---~G~vhfd~~e~wt~~~~~~~~~ 168 (261)
++||+.|+++++|+|+|+.....|||+|.|..+.|||++||||++|+|||||+|+ .|++|||++|.|+++. .
T Consensus 132 ~~Af~~Ws~vtpl~f~e~~~~~~aDi~i~F~~~~h~d~~PFDG~~g~laHAf~Pg~~~~G~~hfD~dE~Wt~~~-----~ 206 (469)
T KOG1565|consen 132 SEAFKLWSDVTPLTFQEVKEEGEADIRISFFPGDHGDGFPFDGPGGVLAHAFFPGPGIGGDLHFDKDETWTYGD-----S 206 (469)
T ss_pred HHHHhhcccCCCCccccCCCCCCCceeeeeeccCCCCCCcccCCCCceecccCCCCCCCCccccCcccceeccC-----C
Confidence 9999999999999999999778999999999999999999999999999999995 6899999999999862 2
Q ss_pred ccccchhhhhhhhhhhcCCCCCCCCCCccccccCCCCCCCCCCHHHHHHHHHHhCCCCCCCC
Q 043639 169 VAVDLESVAVHEIGHLLGLTHSPVKEAVMYPTLKPRDKKVDLALDDIQGVQALYGSNPNFTI 230 (261)
Q Consensus 169 ~~~~l~~Va~HEiGHaLGL~Hs~~~~svM~p~y~~~~~~~~l~~dDI~~iq~LYG~~~~~~~ 230 (261)
.+++|+.||+|||||+|||.||.++++||||+|++...++.|++|||.+||.|||.+++...
T Consensus 207 ~g~~l~~Va~HEiGH~LGL~HS~~~~aiM~P~y~~~~~~~~L~~DDv~giq~lYG~~~~~~~ 268 (469)
T KOG1565|consen 207 NGVDLFLVAAHEIGHALGLGHSSDPDAIMYPFYQPDSGNFDLSQDDVRGIQHLYGGPPRDYF 268 (469)
T ss_pred ccchhHHHhhhhcccccccCCCCCcccccccccccCCCCcccChhhhhhhHHHhCCCccccc
Confidence 48999999999999999999999999999999997667889999999999999999887543
|
|
| >cd04278 ZnMc_MMP Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family | Back alignment and domain information |
|---|
| >PF00413 Peptidase_M10: Matrixin This Prosite motif covers only the active site | Back alignment and domain information |
|---|
| >cd04279 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MMP_like sub-family 1 | Back alignment and domain information |
|---|
| >smart00235 ZnMc Zinc-dependent metalloprotease | Back alignment and domain information |
|---|
| >cd04277 ZnMc_serralysin_like Zinc-dependent metalloprotease, serralysin_like subfamily | Back alignment and domain information |
|---|
| >cd04268 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like subfamily | Back alignment and domain information |
|---|
| >cd04327 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MMP_like sub-family 3 | Back alignment and domain information |
|---|
| >cd00203 ZnMc Zinc-dependent metalloprotease | Back alignment and domain information |
|---|
| >cd04276 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MMP_like sub-family 2 | Back alignment and domain information |
|---|
| >cd04280 ZnMc_astacin_like Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site | Back alignment and domain information |
|---|
| >PF01400 Astacin: Astacin (Peptidase family M12A) This Prosite motif covers only the active site | Back alignment and domain information |
|---|
| >cd04281 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1/TLD-like subfamily | Back alignment and domain information |
|---|
| >PF12388 Peptidase_M57: Dual-action HEIGH metallo-peptidase; InterPro: IPR024653 This entry represents the metallopeptidases M10, M27 and M57 | Back alignment and domain information |
|---|
| >cd04282 ZnMc_meprin Zinc-dependent metalloprotease, meprin_like subfamily | Back alignment and domain information |
|---|
| >cd04283 ZnMc_hatching_enzyme Zinc-dependent metalloprotease, hatching enzyme-like subfamily | Back alignment and domain information |
|---|
| >KOG3714 consensus Meprin A metalloprotease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02031 Peptidase_M7: Streptomyces extracellular neutral proteinase (M7) family; InterPro: IPR000013 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG5549 Predicted Zn-dependent protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11350 DUF3152: Protein of unknown function (DUF3152); InterPro: IPR022603 This entry represents Actinobacteria proteins of unknown function | Back alignment and domain information |
|---|
| >cd04267 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADAM_like or reprolysin_like subgroup | Back alignment and domain information |
|---|
| >cd04273 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, ADAMTS_like subgroup | Back alignment and domain information |
|---|
| >PF13583 Reprolysin_4: Metallo-peptidase family M12B Reprolysin-like | Back alignment and domain information |
|---|
| >PF05572 Peptidase_M43: Pregnancy-associated plasma protein-A; InterPro: IPR008754 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF13574 Reprolysin_2: Metallo-peptidase family M12B Reprolysin-like; PDB: 1KAP_P 1JIW_P 1AKL_A 1OM7_A 1OM8_A 1O0T_A 1OM6_A 1H71_P 1O0Q_A 1OMJ_A | Back alignment and domain information |
|---|
| >cd04275 ZnMc_pappalysin_like Zinc-dependent metalloprotease, pappalysin_like subfamily | Back alignment and domain information |
|---|
| >COG1913 Predicted Zn-dependent proteases [General function prediction only] | Back alignment and domain information |
|---|
| >PF13688 Reprolysin_5: Metallo-peptidase family M12; PDB: 2FV5_B 3EWJ_A 3KME_A 3L0T_B 1BKC_E 3G42_D 2I47_D 2FV9_B 3LEA_A 1ZXC_B | Back alignment and domain information |
|---|
| >PF13582 Reprolysin_3: Metallo-peptidase family M12B Reprolysin-like; PDB: 3P24_C | Back alignment and domain information |
|---|
| >cd04271 ZnMc_ADAM_fungal Zinc-dependent metalloprotease, ADAM_fungal subgroup | Back alignment and domain information |
|---|
| >PRK13267 archaemetzincin-like protein; Reviewed | Back alignment and domain information |
|---|
| >cd04269 ZnMc_adamalysin_II_like Zinc-dependent metalloprotease; adamalysin_II_like subfamily | Back alignment and domain information |
|---|
| >PF07998 Peptidase_M54: Peptidase family M54; InterPro: IPR012962 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF01421 Reprolysin: Reprolysin (M12B) family zinc metalloprotease This Prosite motif covers only the active site | Back alignment and domain information |
|---|
| >cd04270 ZnMc_TACE_like Zinc-dependent metalloprotease; TACE_like subfamily | Back alignment and domain information |
|---|
| >cd04272 ZnMc_salivary_gland_MPs Zinc-dependent metalloprotease, salivary_gland_MPs | Back alignment and domain information |
|---|
| >KOG4525 consensus Jacalin-like lectin domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF11150 DUF2927: Protein of unknown function (DUF2927); InterPro: IPR021323 This family is conserved in Proteobacteria | Back alignment and domain information |
|---|
| >PF04298 Zn_peptidase_2: Putative neutral zinc metallopeptidase; InterPro: IPR007395 Members of this family of bacterial proteins are described as hypothetical proteins or zinc-dependent proteases | Back alignment and domain information |
|---|
| >PF10462 Peptidase_M66: Peptidase M66; InterPro: IPR019503 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF05548 Peptidase_M11: Gametolysin peptidase M11; InterPro: IPR008752 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF12044 Metallopep: Putative peptidase family; InterPro: IPR021917 This family of proteins is functionally uncharacterised | Back alignment and domain information |
|---|
| >TIGR03296 M6dom_TIGR03296 M6 family metalloprotease domain | Back alignment and domain information |
|---|
| >COG2738 Predicted Zn-dependent protease [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00337 surface protease GP63; Provisional | Back alignment and domain information |
|---|
| >PTZ00257 Glycoprotein GP63 (leishmanolysin); Provisional | Back alignment and domain information |
|---|
| >COG3824 Predicted Zn-dependent protease [General function prediction only] | Back alignment and domain information |
|---|
| >PF01457 Peptidase_M8: Leishmanolysin This Prosite motif covers only the active site | Back alignment and domain information |
|---|
| >PF05547 Peptidase_M6: Immune inhibitor A peptidase M6; InterPro: IPR008757 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG3607 consensus Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09471 Peptidase_M64: IgA Peptidase M64; InterPro: IPR019026 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF06262 DUF1025: Possibl zinc metallo-peptidase; InterPro: IPR010428 This is a family of bacterial protein with undetermined function | Back alignment and domain information |
|---|
| >KOG3658 consensus Tumor necrosis factor-alpha-converting enzyme (TACE/ADAM17) and related metalloproteases [Extracellular structures] | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 261 | ||||
| 2jsd_A | 160 | Solution Structure Of Mmp20 Complexed With Nngh Len | 2e-26 | ||
| 1su3_A | 450 | X-Ray Structure Of Human Prommp-1: New Insights Int | 1e-25 | ||
| 1kbc_A | 164 | Procarboxypeptidase Ternary Complex Length = 164 | 2e-25 | ||
| 1bzs_A | 165 | Crystal Structure Of Mmp8 Complexed With Hmr2909 Le | 2e-25 | ||
| 1mnc_A | 163 | Structure Of Human Neutrophil Collagenase Reveals L | 3e-25 | ||
| 1jaq_A | 163 | Complex Of 1-Hydroxylamine-2-Isobutylmalonyl-Ala-Gl | 4e-25 | ||
| 3ayk_A | 169 | Catalytic Fragment Of Human Fibroblast Collagenase | 7e-25 | ||
| 2j0t_A | 170 | Crystal Structure Of The Catalytic Domain Of Mmp-1 | 8e-25 | ||
| 1fbl_A | 370 | Structure Of Full-Length Porcine Synovial Collagena | 9e-25 | ||
| 2clt_A | 367 | Crystal Structure Of The Active Form (Full-Length) | 2e-24 | ||
| 2ddy_A | 173 | Solution Structure Of Matrilysin (Mmp-7) Complexed | 2e-24 | ||
| 2y6d_A | 174 | The Discovery Of Mmp7 Inhibitors Exploiting A Novel | 2e-24 | ||
| 1mmp_A | 170 | Matrilysin Complexed With Carboxylate Inhibitor Len | 2e-24 | ||
| 1cgl_A | 169 | Structure Of The Catalytic Domain Of Fibroblast Col | 2e-24 | ||
| 1cge_A | 168 | Crystal Structures Of Recombinant 19-Kda Human Fibr | 4e-24 | ||
| 3tt4_A | 159 | Human Mmp8 In Complex With L-Glutamate Motif Inhibi | 6e-24 | ||
| 1cgf_A | 162 | Crystal Structures Of Recombinant 19-Kda Human Fibr | 1e-23 | ||
| 1a86_A | 158 | Mmp8 With Malonic And Aspartic Acid Based Inhibitor | 3e-23 | ||
| 2y6c_A | 165 | The Discovery Of Mmp7 Inhibitors Exploiting A Novel | 3e-23 | ||
| 3shi_A | 156 | Crystal Structure Of Human Mmp1 Catalytic Domain At | 6e-23 | ||
| 2xs4_A | 167 | Structure Of Karilysin Catalytic Mmp Domain In Comp | 6e-23 | ||
| 2xs3_A | 166 | Structure Of Karilysin Catalytic Mmp Domain Length | 6e-23 | ||
| 2k2g_A | 165 | Solution Structure Of The Wild-Type Catalytic Domai | 8e-23 | ||
| 2z2d_A | 164 | Solution Structure Of Human Macrophage Elastase (Mm | 8e-23 | ||
| 1jiz_A | 166 | Crystal Structure Analysis Of Human Macrophage Elas | 9e-23 | ||
| 3ayu_A | 167 | Crystal Structure Of Mmp-2 Active Site Mutant In Co | 2e-22 | ||
| 2poj_A | 164 | Nmr Solution Structure Of The Inhibitor-Free State | 4e-22 | ||
| 966c_A | 157 | Crystal Structure Of Fibroblast Collagenase-1 Compl | 4e-22 | ||
| 3ba0_A | 365 | Crystal Structure Of Full-Length Human Mmp-12 Lengt | 6e-22 | ||
| 1fls_A | 165 | Solution Structure Of The Catalytic Fragment Of Hum | 9e-22 | ||
| 3kry_A | 164 | Crystal Structure Of Mmp-13 In Complex With Sc-7808 | 1e-21 | ||
| 2d1n_A | 166 | Collagenase-3 (Mmp-13) Complexed To A Hydroxamic Ac | 1e-21 | ||
| 2ow9_A | 170 | Crystal Structure Analysis Of The Mmp13 Catalytic D | 1e-21 | ||
| 456c_A | 168 | Crystal Structure Of Collagenase-3 (Mmp-13) Complex | 1e-21 | ||
| 3kec_A | 167 | Crystal Structure Of Human Mmp-13 Complexed With A | 1e-21 | ||
| 1os2_A | 165 | Ternary Enzyme-Product-Inhibitor Complexes Of Human | 1e-21 | ||
| 1eub_A | 171 | Solution Structure Of The Catalytic Domain Of Human | 1e-21 | ||
| 4a7b_A | 169 | Mmp13 In Complex With A Novel Selective Non Zinc Bi | 1e-21 | ||
| 1rmz_A | 159 | Crystal Structure Of The Catalytic Domain Of Human | 1e-21 | ||
| 3f15_A | 158 | Crystal Structure Of The Catalytic Domain Of Human | 1e-21 | ||
| 2wo8_A | 164 | Mmp12 Complex With A Beta Hydroxy Carboxylic Acid L | 2e-21 | ||
| 1ros_A | 163 | Crystal Structure Of Mmp-12 Complexed To 2-(1,3-Dio | 2e-21 | ||
| 1qib_A | 161 | Crystal Structure Of Gelatinase A Catalytic Domain | 2e-21 | ||
| 2k9c_A | 152 | Paramagnetic Shifts In Solid-State Nmr Of Proteins | 2e-21 | ||
| 1hov_A | 163 | Solution Structure Of A Catalytic Domain Of Mmp-2 C | 2e-21 | ||
| 1utt_A | 159 | Crystal Structure Of Mmp-12 Complexed To 2- (1,3-Di | 2e-21 | ||
| 3ljz_A | 164 | Crystal Structure Of Human Mmp-13 Complexed With An | 3e-21 | ||
| 4gr8_A | 152 | Crystal Structure Of The Catalytic Domain Of Human | 9e-21 | ||
| 1jk3_A | 158 | Crystal Structure Of Human Mmp-12 (Macrophage Elast | 1e-20 | ||
| 2w0d_A | 164 | Does A Fast Nuclear Magnetic Resonance Spectroscopy | 1e-20 | ||
| 1cxv_A | 164 | Structure Of Recombinant Mouse Collagenase-3 (Mmp-1 | 1e-20 | ||
| 1gkc_A | 163 | Mmp9-inhibitor Complex Length = 163 | 4e-20 | ||
| 1slm_A | 255 | Crystal Structure Of Fibroblast Stromelysin-1: The | 4e-20 | ||
| 1biw_A | 173 | Design And Synthesis Of Conformationally-Constraine | 5e-20 | ||
| 2d1o_A | 171 | Stromelysin-1 (Mmp-3) Complexed To A Hydroxamic Aci | 6e-20 | ||
| 3oho_A | 169 | Catalytic Domain Of Stromelysin-1 In Complex With N | 6e-20 | ||
| 1ums_A | 174 | Stromelysin-1 Catalytic Domain With Hydrophobic Inh | 6e-20 | ||
| 1caq_A | 168 | X-Ray Structure Of Human Stromelysin Catalytic Doma | 7e-20 | ||
| 1gkd_A | 163 | Mmp9 Active Site Mutant-Inhibitor Complex Length = | 8e-20 | ||
| 2ovx_A | 159 | Mmp-9 Active Site Mutant With Barbiturate Inhibitor | 1e-19 | ||
| 1c8t_A | 167 | Human Stromelysin-1 (E202q) Catalytic Domain Comple | 1e-19 | ||
| 1usn_A | 165 | Crystal Structure Of The Catalytic Domain Of Human | 2e-19 | ||
| 1b8y_A | 167 | X-Ray Structure Of Human Stromelysin Catalytic Doma | 2e-19 | ||
| 1uea_A | 173 | Mmp-3TIMP-1 Complex Length = 173 | 3e-19 | ||
| 1hv5_A | 165 | Crystal Structure Of The Stromelysin-3 (Mmp-11) Cat | 2e-18 | ||
| 1qia_A | 162 | Crystal Structure Of Stromelysin Catalytic Domain L | 5e-18 | ||
| 1hfs_A | 160 | Crystal Structure Of The Catalytic Domain Of Human | 6e-18 | ||
| 2jnp_A | 161 | Solution Structure Of Matrix Metalloproteinase 3 (M | 6e-18 | ||
| 1q3a_A | 165 | Crystal Structure Of The Catalytic Domain Of Human | 1e-17 | ||
| 1qic_A | 161 | Crystal Structure Of Stromelysin Catalytic Domain L | 1e-17 | ||
| 1rm8_A | 169 | Crystal Structure Of The Catalytic Domain Of Mmp-16 | 2e-17 | ||
| 3ma2_D | 181 | Complex Membrane Type-1 Matrix Metalloproteinase (M | 2e-17 | ||
| 3v96_B | 165 | Complex Of Matrix Metalloproteinase-10 Catalytic Do | 2e-17 | ||
| 1bqq_M | 174 | Crystal Structure Of The Mt1-Mmp--Timp-2 Complex Le | 8e-17 | ||
| 1ck7_A | 631 | Gelatinase A (Full-Length) Length = 631 | 2e-12 | ||
| 1ck7_A | 631 | Gelatinase A (Full-Length) Length = 631 | 3e-06 | ||
| 1eak_A | 421 | Catalytic Domain Of Prommp-2 E404q Mutant Length = | 2e-12 | ||
| 1eak_A | 421 | Catalytic Domain Of Prommp-2 E404q Mutant Length = | 8e-06 | ||
| 1l6j_A | 425 | Crystal Structure Of Human Matrix Metalloproteinase | 4e-10 | ||
| 1l6j_A | 425 | Crystal Structure Of Human Matrix Metalloproteinase | 8e-06 | ||
| 1smp_A | 471 | Crystal Structure Of A Complex Between Serratia Mar | 4e-05 | ||
| 1srp_A | 471 | Structural Analysis Of Serratia Protease Length = 4 | 4e-05 | ||
| 1af0_A | 471 | Serratia Protease In Complex With Inhibitor Length | 6e-05 | ||
| 1sat_A | 471 | Crystal Structure Of The 50 Kda Metallo Protease Fr | 8e-05 |
| >pdb|2JSD|A Chain A, Solution Structure Of Mmp20 Complexed With Nngh Length = 160 | Back alignment and structure |
|
| >pdb|1SU3|A Chain A, X-Ray Structure Of Human Prommp-1: New Insights Into Collagenase Action Length = 450 | Back alignment and structure |
| >pdb|1KBC|A Chain A, Procarboxypeptidase Ternary Complex Length = 164 | Back alignment and structure |
| >pdb|1BZS|A Chain A, Crystal Structure Of Mmp8 Complexed With Hmr2909 Length = 165 | Back alignment and structure |
| >pdb|1MNC|A Chain A, Structure Of Human Neutrophil Collagenase Reveals Large S1' Specificity Pocket Length = 163 | Back alignment and structure |
| >pdb|1JAQ|A Chain A, Complex Of 1-Hydroxylamine-2-Isobutylmalonyl-Ala-Gly-Nh2 With The Catalytic Domain Of Matrix Metallo Proteinase-8 (Met80 Form) Length = 163 | Back alignment and structure |
| >pdb|3AYK|A Chain A, Catalytic Fragment Of Human Fibroblast Collagenase Complexed With Cgs-27023a, Nmr, Minimized Average Structure Length = 169 | Back alignment and structure |
| >pdb|2J0T|A Chain A, Crystal Structure Of The Catalytic Domain Of Mmp-1 In Complex With The Inhibitory Domain Of Timp-1 Length = 170 | Back alignment and structure |
| >pdb|1FBL|A Chain A, Structure Of Full-Length Porcine Synovial Collagenase (Mmp1) Reveals A C-Terminal Domain Containing A Calcium-Linked, Four-Bladed Beta- Propeller Length = 370 | Back alignment and structure |
| >pdb|2CLT|A Chain A, Crystal Structure Of The Active Form (Full-Length) Of Human Fibroblast Collagenase. Length = 367 | Back alignment and structure |
| >pdb|2DDY|A Chain A, Solution Structure Of Matrilysin (Mmp-7) Complexed To Constraint Conformational Sulfonamide Inhibitor Length = 173 | Back alignment and structure |
| >pdb|2Y6D|A Chain A, The Discovery Of Mmp7 Inhibitors Exploiting A Novel Selectivity Trigger Length = 174 | Back alignment and structure |
| >pdb|1MMP|A Chain A, Matrilysin Complexed With Carboxylate Inhibitor Length = 170 | Back alignment and structure |
| >pdb|1CGL|A Chain A, Structure Of The Catalytic Domain Of Fibroblast Collagenase Complexed With An Inhibitor Length = 169 | Back alignment and structure |
| >pdb|1CGE|A Chain A, Crystal Structures Of Recombinant 19-Kda Human Fibroblast Collagenase Complexed To Itself Length = 168 | Back alignment and structure |
| >pdb|3TT4|A Chain A, Human Mmp8 In Complex With L-Glutamate Motif Inhibitor Length = 159 | Back alignment and structure |
| >pdb|1CGF|A Chain A, Crystal Structures Of Recombinant 19-Kda Human Fibroblast Collagenase Complexed To Itself Length = 162 | Back alignment and structure |
| >pdb|1A86|A Chain A, Mmp8 With Malonic And Aspartic Acid Based Inhibitor Length = 158 | Back alignment and structure |
| >pdb|2Y6C|A Chain A, The Discovery Of Mmp7 Inhibitors Exploiting A Novel Selectivity Trigger Length = 165 | Back alignment and structure |
| >pdb|3SHI|A Chain A, Crystal Structure Of Human Mmp1 Catalytic Domain At 2.2 A Resolution Length = 156 | Back alignment and structure |
| >pdb|2XS4|A Chain A, Structure Of Karilysin Catalytic Mmp Domain In Complex With Magnesium Length = 167 | Back alignment and structure |
| >pdb|2XS3|A Chain A, Structure Of Karilysin Catalytic Mmp Domain Length = 166 | Back alignment and structure |
| >pdb|2K2G|A Chain A, Solution Structure Of The Wild-Type Catalytic Domain Of Human Matrix Metalloproteinase 12 (Mmp-12) In Complex With A Tight-Binding Inhibitor Length = 165 | Back alignment and structure |
| >pdb|2Z2D|A Chain A, Solution Structure Of Human Macrophage Elastase (Mmp-12) Catalytic Domain Complexed With A Gamma-Keto Butanoic Acid Inhibitor Length = 164 | Back alignment and structure |
| >pdb|1JIZ|A Chain A, Crystal Structure Analysis Of Human Macrophage Elastase Mmp- 12 Length = 166 | Back alignment and structure |
| >pdb|3AYU|A Chain A, Crystal Structure Of Mmp-2 Active Site Mutant In Complex With App- Drived Decapeptide Inhibitor Length = 167 | Back alignment and structure |
| >pdb|2POJ|A Chain A, Nmr Solution Structure Of The Inhibitor-Free State Of Macrophage Metalloelastase (Mmp-12) Length = 164 | Back alignment and structure |
| >pdb|966C|A Chain A, Crystal Structure Of Fibroblast Collagenase-1 Complexed To A Diphenyl-Ether Sulphone Based Hydroxamic Acid Length = 157 | Back alignment and structure |
| >pdb|3BA0|A Chain A, Crystal Structure Of Full-Length Human Mmp-12 Length = 365 | Back alignment and structure |
| >pdb|1FLS|A Chain A, Solution Structure Of The Catalytic Fragment Of Human Collagenase-3 (Mmp-13) Complexed With A Hydroxamic Acid Inhibitor Length = 165 | Back alignment and structure |
| >pdb|3KRY|A Chain A, Crystal Structure Of Mmp-13 In Complex With Sc-78080 Length = 164 | Back alignment and structure |
| >pdb|2D1N|A Chain A, Collagenase-3 (Mmp-13) Complexed To A Hydroxamic Acid Inhibitor Length = 166 | Back alignment and structure |
| >pdb|2OW9|A Chain A, Crystal Structure Analysis Of The Mmp13 Catalytic Domain In Complex With Specific Inhibitor Length = 170 | Back alignment and structure |
| >pdb|456C|A Chain A, Crystal Structure Of Collagenase-3 (Mmp-13) Complexed To A Diphenyl-Ether Sulphone Based Hydroxamic Acid Length = 168 | Back alignment and structure |
| >pdb|3KEC|A Chain A, Crystal Structure Of Human Mmp-13 Complexed With A Phenyl-2h-Tetrazole Compound Length = 167 | Back alignment and structure |
| >pdb|1OS2|A Chain A, Ternary Enzyme-Product-Inhibitor Complexes Of Human Mmp12 Length = 165 | Back alignment and structure |
| >pdb|1EUB|A Chain A, Solution Structure Of The Catalytic Domain Of Human Collagenase-3 (Mmp-13) Complexed To A Potent Non-Peptidic Sulfonamide Inhibitor Length = 171 | Back alignment and structure |
| >pdb|4A7B|A Chain A, Mmp13 In Complex With A Novel Selective Non Zinc Binding Inhibitor Cmpd22 Length = 169 | Back alignment and structure |
| >pdb|1RMZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mmp12 Complexed With The Inhibitor Nngh At 1.3 A Resolution Length = 159 | Back alignment and structure |
| >pdb|3F15|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mmp12 Complexed With The Inhibitor (S)-N-(2,3-Dihydroxypropyl)-4- Methoxy-N-(2-Nitroso-2-Oxoethyl)benzenesulfonamide Length = 158 | Back alignment and structure |
| >pdb|2WO8|A Chain A, Mmp12 Complex With A Beta Hydroxy Carboxylic Acid Length = 164 | Back alignment and structure |
| >pdb|1ROS|A Chain A, Crystal Structure Of Mmp-12 Complexed To 2-(1,3-Dioxo-1,3- Dihydro-2h-Isoindol-2-Yl)ethyl-4-(4-Ethoxy[1, 1-Biphenyl]-4- Yl)-4-Oxobutanoic Acid Length = 163 | Back alignment and structure |
| >pdb|1QIB|A Chain A, Crystal Structure Of Gelatinase A Catalytic Domain Length = 161 | Back alignment and structure |
| >pdb|2K9C|A Chain A, Paramagnetic Shifts In Solid-State Nmr Of Proteins To Elicit Structural Information Length = 152 | Back alignment and structure |
| >pdb|1HOV|A Chain A, Solution Structure Of A Catalytic Domain Of Mmp-2 Complexed With Sc-74020 Length = 163 | Back alignment and structure |
| >pdb|1UTT|A Chain A, Crystal Structure Of Mmp-12 Complexed To 2- (1,3-Dioxo-1,3-Dihydro-2h-Isoindol-2-Yl)ethyl-4- (4-Ethoxy[1,1-Biphenyl]-4-Yl)-4-Oxobutanoic Acid Length = 159 | Back alignment and structure |
| >pdb|3LJZ|A Chain A, Crystal Structure Of Human Mmp-13 Complexed With An Amino-2-Indanol Compound Length = 164 | Back alignment and structure |
| >pdb|4GR8|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mmp12 In Complex With Selective Phosphinic Inhibitor Rxp470c Length = 152 | Back alignment and structure |
| >pdb|1JK3|A Chain A, Crystal Structure Of Human Mmp-12 (Macrophage Elastase) At True Atomic Resolution Length = 158 | Back alignment and structure |
| >pdb|2W0D|A Chain A, Does A Fast Nuclear Magnetic Resonance Spectroscopy- And X-Ray Crystallography Hybrid Approach Provide Reliable Structural Information Of Ligand-Protein Complexes? A Case Study Of Metalloproteinases. Length = 164 | Back alignment and structure |
| >pdb|1CXV|A Chain A, Structure Of Recombinant Mouse Collagenase-3 (Mmp-13) Length = 164 | Back alignment and structure |
| >pdb|1GKC|A Chain A, Mmp9-inhibitor Complex Length = 163 | Back alignment and structure |
| >pdb|1SLM|A Chain A, Crystal Structure Of Fibroblast Stromelysin-1: The C-Truncated Human Proenzyme Length = 255 | Back alignment and structure |
| >pdb|1BIW|A Chain A, Design And Synthesis Of Conformationally-Constrained Mmp Inhibitors Length = 173 | Back alignment and structure |
| >pdb|2D1O|A Chain A, Stromelysin-1 (Mmp-3) Complexed To A Hydroxamic Acid Inhibitor Length = 171 | Back alignment and structure |
| >pdb|3OHO|A Chain A, Catalytic Domain Of Stromelysin-1 In Complex With N-Hydroxy-2-(4- Methylphenylsulfonamido)acetamide Length = 169 | Back alignment and structure |
| >pdb|1UMS|A Chain A, Stromelysin-1 Catalytic Domain With Hydrophobic Inhibitor Bound, Ph 7.0, 32oc, 20 Mm Cacl2, 15% Acetonitrile; Nmr Ensemble Of 20 Structures Length = 174 | Back alignment and structure |
| >pdb|1CAQ|A Chain A, X-Ray Structure Of Human Stromelysin Catalytic Domain Complexes With Non-Peptide Inhibitors: Implication For Inhibitor Selectivity Length = 168 | Back alignment and structure |
| >pdb|1GKD|A Chain A, Mmp9 Active Site Mutant-Inhibitor Complex Length = 163 | Back alignment and structure |
| >pdb|2OVX|A Chain A, Mmp-9 Active Site Mutant With Barbiturate Inhibitor Length = 159 | Back alignment and structure |
| >pdb|1C8T|A Chain A, Human Stromelysin-1 (E202q) Catalytic Domain Complexed With Ro-26-2812 Length = 167 | Back alignment and structure |
| >pdb|1USN|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Fibroblast Stromelysin-1 Inhibited With Thiadiazole Inhibitor Pnu-142372 Length = 165 | Back alignment and structure |
| >pdb|1B8Y|A Chain A, X-Ray Structure Of Human Stromelysin Catalytic Domain Complexed With Non-Peptide Inhibitors: Implications For Inhibitor Selectivity Length = 167 | Back alignment and structure |
| >pdb|1UEA|A Chain A, Mmp-3TIMP-1 Complex Length = 173 | Back alignment and structure |
| >pdb|1HV5|A Chain A, Crystal Structure Of The Stromelysin-3 (Mmp-11) Catalytic Domain Complexed With A Phosphinic Inhibitor Length = 165 | Back alignment and structure |
| >pdb|1QIA|A Chain A, Crystal Structure Of Stromelysin Catalytic Domain Length = 162 | Back alignment and structure |
| >pdb|1HFS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Fibroblast Stromelysin-1 Inhibited With The N-Carboxy-Alkyl Inhibitor L-764,004 Length = 160 | Back alignment and structure |
| >pdb|2JNP|A Chain A, Solution Structure Of Matrix Metalloproteinase 3 (Mmp-3) In The Presence Of N-Isobutyl-N-[4- Methoxyphenylsulfonyl]glycyl Hydroxamic Acid (Nngh) Length = 161 | Back alignment and structure |
| >pdb|1Q3A|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Matrix Metalloproteinase 10 Length = 165 | Back alignment and structure |
| >pdb|1QIC|A Chain A, Crystal Structure Of Stromelysin Catalytic Domain Length = 161 | Back alignment and structure |
| >pdb|1RM8|A Chain A, Crystal Structure Of The Catalytic Domain Of Mmp-16MT3- Mmp: Characterization Of Mt-Mmp Specific Features Length = 169 | Back alignment and structure |
| >pdb|3MA2|D Chain D, Complex Membrane Type-1 Matrix Metalloproteinase (Mt1-Mmp) With Tissue Inhibitor Of Metalloproteinase-1 (Timp-1) Length = 181 | Back alignment and structure |
| >pdb|3V96|B Chain B, Complex Of Matrix Metalloproteinase-10 Catalytic Domain (Mmp-10cd) With Tissue Inhibitor Of Metalloproteinases-1 (Timp-1) Length = 165 | Back alignment and structure |
| >pdb|1BQQ|M Chain M, Crystal Structure Of The Mt1-Mmp--Timp-2 Complex Length = 174 | Back alignment and structure |
| >pdb|1CK7|A Chain A, Gelatinase A (Full-Length) Length = 631 | Back alignment and structure |
| >pdb|1CK7|A Chain A, Gelatinase A (Full-Length) Length = 631 | Back alignment and structure |
| >pdb|1EAK|A Chain A, Catalytic Domain Of Prommp-2 E404q Mutant Length = 421 | Back alignment and structure |
| >pdb|1EAK|A Chain A, Catalytic Domain Of Prommp-2 E404q Mutant Length = 421 | Back alignment and structure |
| >pdb|1L6J|A Chain A, Crystal Structure Of Human Matrix Metalloproteinase Mmp9 (gelatinase B) Length = 425 | Back alignment and structure |
| >pdb|1L6J|A Chain A, Crystal Structure Of Human Matrix Metalloproteinase Mmp9 (gelatinase B) Length = 425 | Back alignment and structure |
| >pdb|1SMP|A Chain A, Crystal Structure Of A Complex Between Serratia Marcescens Metallo-Protease And An Inhibitor From Erwinia Chrysanthemi Length = 471 | Back alignment and structure |
| >pdb|1SRP|A Chain A, Structural Analysis Of Serratia Protease Length = 471 | Back alignment and structure |
| >pdb|1AF0|A Chain A, Serratia Protease In Complex With Inhibitor Length = 471 | Back alignment and structure |
| >pdb|1SAT|A Chain A, Crystal Structure Of The 50 Kda Metallo Protease From S. Marcescens Length = 471 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 261 | |||
| 3ayu_A | 167 | 72 kDa type IV collagenase; protease, hydrolase-hy | 5e-51 | |
| 1cge_A | 168 | Fibroblast collagenase; hydrolase (metalloprotease | 1e-49 | |
| 830c_A | 168 | MMP-13, MMP-13; matrix metalloprotease; HET: RS1; | 1e-47 | |
| 2y6d_A | 174 | Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapie | 8e-47 | |
| 1hy7_A | 173 | Stromelysin-1, MMP-3; mixed alpha beta structure, | 9e-47 | |
| 2xs4_A | 167 | Karilysin protease; hydrolase, bacterial MMP, viru | 1e-46 | |
| 1i76_A | 163 | MMP-8;, neutrophil collagenase; hydrolase, complex | 6e-45 | |
| 2jsd_A | 160 | Matrix metalloproteinase-20; MMP-NNGH, structural | 3e-44 | |
| 1y93_A | 159 | Macrophage metalloelastase; matrix metalloproteina | 5e-43 | |
| 3ma2_D | 181 | Matrix metalloproteinase-14; protein - protein com | 5e-43 | |
| 1rm8_A | 169 | MMP-16, matrix metalloproteinase-16, MT3-MMP; memb | 1e-42 | |
| 1hv5_A | 165 | Stromelysin 3; inhibition, phosphinic inhibitor, h | 2e-42 | |
| 1slm_A | 255 | Stromelysin-1; hydrolase, metalloprotease, fibrobl | 5e-42 | |
| 2ovx_A | 159 | Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) | 1e-41 | |
| 1su3_A | 450 | Interstitial collagenase; prodomain, hemopexin dom | 8e-37 | |
| 3ba0_A | 365 | Macrophage metalloelastase; FULL-length MMP-12, he | 1e-35 | |
| 1eak_A | 421 | 72 kDa type IV collagenase; hydrolase-hydrolase in | 9e-31 | |
| 1eak_A | 421 | 72 kDa type IV collagenase; hydrolase-hydrolase in | 7e-14 | |
| 1l6j_A | 425 | Matrix metalloproteinase-9; twisted beta sheet fla | 5e-25 | |
| 1l6j_A | 425 | Matrix metalloproteinase-9; twisted beta sheet fla | 4e-16 | |
| 1ck7_A | 631 | Protein (gelatinase A); hydrolase (metalloprotease | 2e-19 | |
| 1ck7_A | 631 | Protein (gelatinase A); hydrolase (metalloprotease | 4e-16 | |
| 1k7i_A | 479 | PROC, secreted protease C; metalloprotease, hydrol | 1e-13 | |
| 1sat_A | 471 | Serratia protease; parallel beta helix, parallel b | 6e-12 | |
| 1g9k_A | 463 | Serralysin; beta jelly roll, hydrolase; 1.96A {Pse | 3e-10 | |
| 1kap_P | 479 | Alkaline protease; calcium binding protein, zinc m | 1e-08 | |
| 3p24_A | 397 | BFT-3; metzincins, metalloendopeptidase, hydrolase | 3e-05 |
| >3ayu_A 72 kDa type IV collagenase; protease, hydrolase-hydrolase inhibitor complex; 2.00A {Homo sapiens} PDB: 1qib_A 1hov_A* Length = 167 | Back alignment and structure |
|---|
Score = 163 bits (414), Expect = 5e-51
Identities = 66/179 (36%), Positives = 89/179 (49%), Gaps = 15/179 (8%)
Query: 52 YVLFPGKPRWTRHVPMTLSYAFSKENMINYLHITDIKAVFKRAFSKWASVIPVSFIETDD 111
Y FP KP+W ++ ++Y L + F RAF W+ V P+ F D
Sbjct: 1 YNFFPRKPKWDKN---QITYRII--GYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHD 55
Query: 112 YDFADIRIGFYNGDHGDGEPFDGVLGVLAHSFSPES---GKFHLDAAETWAVDFGSEKSP 168
+ ADI I F +HGDG PFDG G+LAH+F+P + G H D E W + G
Sbjct: 56 GE-ADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGKGVGY-- 112
Query: 169 VAVDLESVAVHEIGHLLGLTHSPVKEAVMYPTLKPRDKKVDLALDDIQGVQALYGSNPN 227
L VA H GH +GL HS A+M P K L+ DDI+G+Q LYG++P+
Sbjct: 113 ---SLFLVAAHAFGHAMGLEHSQDPGALMAPIYTYT-KNFRLSQDDIKGIQELYGASPD 167
|
| >1cge_A Fibroblast collagenase; hydrolase (metalloprotease); 1.90A {Homo sapiens} SCOP: d.92.1.11 PDB: 2j0t_A 1ayk_A 1hfc_A* 2ayk_A 2tcl_A* 3ayk_A* 4ayk_A* 1cgl_A* 1cgf_A 966c_A* 3shi_A Length = 168 | Back alignment and structure |
|---|
| >830c_A MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 1.60A {Homo sapiens} SCOP: d.92.1.11 PDB: 456c_A* 1you_A* 4a7b_A* 3tvc_A* 1eub_A* 1xuc_A* 1xud_A* 1xur_A* 2yig_A* 3elm_A* 3i7g_A* 3i7i_A* 3zxh_A* 2ow9_A* 2ozr_A* 3kek_A* 3kej_A* 3kec_A* 2d1n_A* 1fls_A* ... Length = 168 | Back alignment and structure |
|---|
| >2y6d_A Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapiens} PDB: 2ddy_A* 1mmq_A* 1mmp_A* 1mmr_A* 2y6c_A* Length = 174 | Back alignment and structure |
|---|
| >1hy7_A Stromelysin-1, MMP-3; mixed alpha beta structure, zinc protease, inhibited, hydrol; HET: MBS; 1.50A {Homo sapiens} SCOP: d.92.1.11 PDB: 1biw_A* 1bm6_A* 1bqo_A* 1b3d_A* 1cqr_A 1d5j_A* 1d7x_A* 1d8f_A* 1d8m_A* 1g05_A* 1g49_A* 1c3i_A* 1sln_A* 1uea_A 2srt_A* 1ums_A* 1umt_A* 2d1o_A* 3oho_A* 1ciz_A* ... Length = 173 | Back alignment and structure |
|---|
| >2xs4_A Karilysin protease; hydrolase, bacterial MMP, virulence factor, metalloprotease, dependent, peptidase; 1.70A {Tannerella forsythia} PDB: 2xs3_A Length = 167 | Back alignment and structure |
|---|
| >1i76_A MMP-8;, neutrophil collagenase; hydrolase, complex (metalloprotease/inhibitor); HET: BSI; 1.20A {Homo sapiens} SCOP: d.92.1.11 PDB: 1i73_A* 1jao_A* 1jap_A 1jaq_A* 1jj9_A* 1mmb_A* 1zp5_A* 1zs0_A* 1zvx_A* 3dng_A* 3dpe_A* 3dpf_A* 1kbc_A* 1jan_A* 1bzs_A* 1mnc_A* 2oy2_A 1a86_A* 1jh1_A* 1a85_A ... Length = 163 | Back alignment and structure |
|---|
| >2jsd_A Matrix metalloproteinase-20; MMP-NNGH, structural genomics, structural proteomics in europe, spine, spine-2, spine2-complexes, hydrolase; HET: NGH; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >1y93_A Macrophage metalloelastase; matrix metalloproteinase, MMP12, complex (elastase inhibitor), acetohydroxamic acid, hydrola; 1.03A {Homo sapiens} SCOP: d.92.1.11 PDB: 1rmz_A 1ycm_A* 1z3j_A* 2hu6_A* 2oxu_A 2oxw_A 2oxz_A 3lik_A* 3lil_A* 3lir_A* 3ljg_A* 1os9_A 1os2_A 3f17_A* 3ehy_A* 3ehx_A* 3f15_A* 3f16_A* 3f18_A* 3f19_A* ... Length = 159 | Back alignment and structure |
|---|
| >3ma2_D Matrix metalloproteinase-14; protein - protein complex, cleavage on PAIR of basic residue disulfide bond, membrane, metal-binding; 2.05A {Homo sapiens} PDB: 1bqq_M 1buv_M Length = 181 | Back alignment and structure |
|---|
| >1rm8_A MMP-16, matrix metalloproteinase-16, MT3-MMP; membrane type - matrix metalloproteinase, batimastat, hydroxamate inhibitor, protease, hydrolase; HET: BAT; 1.80A {Homo sapiens} SCOP: d.92.1.11 Length = 169 | Back alignment and structure |
|---|
| >1hv5_A Stromelysin 3; inhibition, phosphinic inhibitor, hydrolase; HET: CPS RXP; 2.60A {Mus musculus} SCOP: d.92.1.11 Length = 165 | Back alignment and structure |
|---|
| >1slm_A Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 Length = 255 | Back alignment and structure |
|---|
| >2ovx_A Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) type IV collagenase) (92 kDa gelatinase)...; S1-prime pocket, hydrolase-hydrola inhibitor complex; HET: 4MR; 2.00A {Homo sapiens} SCOP: d.92.1.11 PDB: 2ovz_A* 2ow0_A* 2ow1_A* 2ow2_A* 1gkd_A* 1gkc_A* Length = 159 | Back alignment and structure |
|---|
| >1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Length = 450 | Back alignment and structure |
|---|
| >3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Length = 365 | Back alignment and structure |
|---|
| >1eak_A 72 kDa type IV collagenase; hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase A, hydrolase- hydrolase inhib complex; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Length = 421 | Back alignment and structure |
|---|
| >1eak_A 72 kDa type IV collagenase; hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase A, hydrolase- hydrolase inhib complex; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Length = 421 | Back alignment and structure |
|---|
| >1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Length = 425 | Back alignment and structure |
|---|
| >1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Length = 425 | Back alignment and structure |
|---|
| >1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Length = 631 | Back alignment and structure |
|---|
| >1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Length = 631 | Back alignment and structure |
|---|
| >1k7i_A PROC, secreted protease C; metalloprotease, hydrolase; 1.59A {Erwinia chrysanthemi} SCOP: b.80.7.1 d.92.1.6 PDB: 1k7g_A 1k7q_A 1go8_P 3hbv_P 3hda_P 3hbu_P 1go7_P 3hb2_P Length = 479 | Back alignment and structure |
|---|
| >1sat_A Serratia protease; parallel beta helix, parallel beta roll, hydrolase (serine protease); 1.75A {Serratia marcescens} SCOP: b.80.7.1 d.92.1.6 PDB: 1af0_A* 1smp_A 1srp_A Length = 471 | Back alignment and structure |
|---|
| >1g9k_A Serralysin; beta jelly roll, hydrolase; 1.96A {Pseudomonas} SCOP: b.80.7.1 d.92.1.6 PDB: 1o0q_A 1o0t_A 1om6_A 1om7_A 1om8_A 1omj_A 1h71_P Length = 463 | Back alignment and structure |
|---|
| >1kap_P Alkaline protease; calcium binding protein, zinc metalloprotease; 1.64A {Pseudomonas aeruginosa} SCOP: b.80.7.1 d.92.1.6 PDB: 1jiw_P 1akl_A Length = 479 | Back alignment and structure |
|---|
| >3p24_A BFT-3; metzincins, metalloendopeptidase, hydrolase; HET: PG4; 1.80A {Bacteroides fragilis} Length = 397 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 261 | |||
| 1eak_A | 421 | 72 kDa type IV collagenase; hydrolase-hydrolase in | 100.0 | |
| 1l6j_A | 425 | Matrix metalloproteinase-9; twisted beta sheet fla | 100.0 | |
| 1slm_A | 255 | Stromelysin-1; hydrolase, metalloprotease, fibrobl | 100.0 | |
| 830c_A | 168 | MMP-13, MMP-13; matrix metalloprotease; HET: RS1; | 100.0 | |
| 3ma2_D | 181 | Matrix metalloproteinase-14; protein - protein com | 100.0 | |
| 1ck7_A | 631 | Protein (gelatinase A); hydrolase (metalloprotease | 100.0 | |
| 1su3_A | 450 | Interstitial collagenase; prodomain, hemopexin dom | 100.0 | |
| 2y6d_A | 174 | Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapie | 100.0 | |
| 2ovx_A | 159 | Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) | 100.0 | |
| 2xs4_A | 167 | Karilysin protease; hydrolase, bacterial MMP, viru | 100.0 | |
| 3ayu_A | 167 | 72 kDa type IV collagenase; protease, hydrolase-hy | 100.0 | |
| 1hy7_A | 173 | Stromelysin-1, MMP-3; mixed alpha beta structure, | 100.0 | |
| 1cge_A | 168 | Fibroblast collagenase; hydrolase (metalloprotease | 100.0 | |
| 1i76_A | 163 | MMP-8;, neutrophil collagenase; hydrolase, complex | 100.0 | |
| 1hv5_A | 165 | Stromelysin 3; inhibition, phosphinic inhibitor, h | 100.0 | |
| 1y93_A | 159 | Macrophage metalloelastase; matrix metalloproteina | 100.0 | |
| 1rm8_A | 169 | MMP-16, matrix metalloproteinase-16, MT3-MMP; memb | 100.0 | |
| 2jsd_A | 160 | Matrix metalloproteinase-20; MMP-NNGH, structural | 100.0 | |
| 3ba0_A | 365 | Macrophage metalloelastase; FULL-length MMP-12, he | 100.0 | |
| 1k7i_A | 479 | PROC, secreted protease C; metalloprotease, hydrol | 100.0 | |
| 1kap_P | 479 | Alkaline protease; calcium binding protein, zinc m | 100.0 | |
| 1sat_A | 471 | Serratia protease; parallel beta helix, parallel b | 100.0 | |
| 1g9k_A | 463 | Serralysin; beta jelly roll, hydrolase; 1.96A {Pse | 100.0 | |
| 1c7k_A | 132 | NCNP, zinc endoprotease; alpha and beta protein, m | 99.92 | |
| 3edh_A | 201 | Bone morphogenetic protein 1; vicinal disulfide, a | 99.71 | |
| 3lq0_A | 235 | Proastacin; metallopeptidase, zymogen activation, | 99.65 | |
| 3lqb_A | 199 | Hatching enzyme, LOC792177 protein; hydrolase, met | 99.61 | |
| 4gwm_A | 592 | Meprin A subunit beta; mulidomain structure, hydro | 99.34 | |
| 3p24_A | 397 | BFT-3; metzincins, metalloendopeptidase, hydrolase | 99.13 | |
| 2x7m_A | 195 | Archaemetzincin; metalloprotease, protease, hydrol | 97.43 | |
| 4axq_A | 163 | Archaemetzincin; metalloprotease, protease, hydrol | 97.41 | |
| 2cki_A | 262 | Ulilysin; metalloprotease, hydrolase; HET: ARG; 1. | 97.38 | |
| 3lmc_A | 210 | Peptidase, zinc-dependent; structural genomics, PS | 97.37 | |
| 3b8z_A | 217 | Protein adamts-5; alpha/beta, hydrolase; HET: 294; | 97.18 | |
| 1qua_A | 197 | Acutolysin-C, hemorrhagin III; metalloprotease, he | 97.16 | |
| 1yp1_A | 202 | FII; FII hydrolase; 1.90A {Deinagkistrodon acutus} | 97.13 | |
| 1kuf_A | 203 | Atrolysin E, metalloproteinase; alpha/beta protein | 97.12 | |
| 1bud_A | 197 | Protein (acutolysin A); metalloproteinase, snake v | 96.99 | |
| 2w15_A | 202 | Zinc metalloproteinase BAP1; hydrolase inhibitor c | 96.95 | |
| 1r55_A | 214 | ADAM 33; metalloprotease, inhibitor, asthma, hydro | 96.9 | |
| 2v4b_A | 300 | Adamts-1; zymogen, protease, hydrolase, metallopro | 96.86 | |
| 2rjq_A | 378 | Adamts-5; metalloprotease domain, aggrecanase, cle | 96.81 | |
| 2rjp_A | 316 | Adamts-4; metalloprotease domain, aggrecanase, cle | 96.8 | |
| 2dw0_A | 419 | Catrocollastatin; apoptotic toxin, SVMP, metallopr | 96.76 | |
| 2e3x_A | 427 | Coagulation factor X-activating enzyme light CHAI; | 96.74 | |
| 2ddf_A | 257 | ADAM 17; hydrolase; HET: INN CIT; 1.70A {Homo sapi | 96.73 | |
| 1atl_A | 202 | Atrolysin C; metalloendopeptidase, hydrolase-hydro | 96.68 | |
| 2ero_A | 427 | VAP-1, vascular apoptosis-inducing protein 1; meta | 96.6 | |
| 2i47_A | 288 | ADAM 17; TACE-inhibitor complex, hydrolase; HET: I | 96.47 | |
| 4dd8_A | 208 | Disintegrin and metalloproteinase domain-containi | 96.4 | |
| 3k7n_A | 397 | K-like; SVMP, hydrolase; HET: NAG FUC FUL; 2.30A { | 96.11 | |
| 3k7l_A | 422 | Atragin; SVMP, metalloprotease, hydrolase; HET: NA | 95.79 | |
| 1lml_A | 478 | Leishmanolysin; metalloprotease, glycoprotein; 1.8 | 95.52 | |
| 3g5c_A | 510 | ADAM 22; alpha/beta fold, cross-linked domain, cel | 93.92 | |
| 3ujz_A | 869 | Metalloprotease STCE; mucin-type glycoprotein, hyd | 90.22 | |
| 3p1v_A | 407 | Metallo-endopeptidase; structural genomics, joint | 87.92 | |
| 3e11_A | 114 | Predicted zincin-like metalloprotease; DUF1025 fam | 84.52 |
| >1eak_A 72 kDa type IV collagenase; hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase A, hydrolase- hydrolase inhib complex; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1e-53 Score=401.19 Aligned_cols=191 Identities=37% Similarity=0.659 Sum_probs=169.6
Q ss_pred HHHHHHHHhcCCCCCCCCCCCcccccCCCCCChhhhhccccceeeCCCCCcccCCCCeeEEEEEecCCcCCcCCHHHHHH
Q 043639 10 LLIFIIFIHESPQCIAVRSTPKFKLKQSDKYDPAEATRHKKDYVLFPGKPRWTRHVPMTLSYAFSKENMINYLHITDIKA 89 (261)
Q Consensus 10 ~~~~~~~~m~~PRCGvpD~~~~~~~~~~~~~~~~~~~~~~kry~~~~~~~kW~~~~~~~LTY~~~~~~~~~~l~~~~~~~ 89 (261)
|=-.|+++|++|||||||+. + |+++++++||.++ +|||+|. +++++|+.+++++
T Consensus 58 LD~~T~~~M~~PRCGvpD~~------------------~---~~~~~~~~kW~k~---~LTY~i~--~~~~~l~~~~v~~ 111 (421)
T 1eak_A 58 LDQNTIETMRKPRCGNPDVA------------------N---YNFFPRKPKWDKN---QITYRII--GYTPDLDPETVDD 111 (421)
T ss_dssp CCHHHHHHHTSCBCSSCSSC------------------S---SCCSSCCCCCSSS---EEEEEEC--CCCTTSCHHHHHH
T ss_pred cCHHHHHHhcCCCCCCCCcc------------------c---cccccCCcccccc---eEEEEEe--cCCCCCCHHHHHH
Confidence 34579999999999999983 2 6677889999999 9999998 7889999999999
Q ss_pred HHHHHHHHhHhcCCceEEEcCCCCCcceEEEeeecCCCCCCCccCCCCceeeecCCC---CceeeecccccccccCCC--
Q 043639 90 VFKRAFSKWASVIPVSFIETDDYDFADIRIGFYNGDHGDGEPFDGVLGVLAHSFSPE---SGKFHLDAAETWAVDFGS-- 164 (261)
Q Consensus 90 ~i~~Af~~Ws~vt~l~F~ev~~~~~aDI~I~f~~~~hgd~~~fdG~gg~lAhA~~P~---~G~vhfd~~e~wt~~~~~-- 164 (261)
+|++||++|++|++|+|+||.+ ..|||+|.|.+++|||++||||+||+|||||+|+ .|++|||++|.|+++...
T Consensus 112 ~i~~AF~~Ws~vtpLtF~ev~~-~~ADI~I~F~~g~HgD~~pFDG~gg~LAHAf~P~~g~~Gd~HFD~dE~Wt~~~~~~~ 190 (421)
T 1eak_A 112 AFARAFQVWSDVTPLRFSRIHD-GEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVV 190 (421)
T ss_dssp HHHHHHHHHHTSSSCEEEECCS-SCCSEEEEEECSSCSSSCCCCSSSSBCEEECCSSSTTTTCEEEETTSCEESSSSCCC
T ss_pred HHHHHHHHHhcccCceeEEcCC-CCCCEEEEEecCCCCCccccCCCCCccccccCCCCCCCCceeeeeccceeccCCcce
Confidence 9999999999999999999987 5999999999999999999999999999999997 699999999999986520
Q ss_pred --------------------------------------------------------------------------------
Q 043639 165 -------------------------------------------------------------------------------- 164 (261)
Q Consensus 165 -------------------------------------------------------------------------------- 164 (261)
T Consensus 191 ~~~~g~~~~~~C~fPF~~~g~~~~~Ct~~g~~~g~~WCstt~~yd~d~~~~~C~~~~~~~~~gn~~~~~C~FPF~~~~~~ 270 (421)
T 1eak_A 191 RVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTS 270 (421)
T ss_dssp BCBSGGGTTSBCCSSEEETTEEESSCBCTTCSSCCCEEESSSBTTTSCCEEECCCTTTCCCSTTTTTCCCCSSEEETTEE
T ss_pred eeecccCCCCcccCCeEECCceeccccccCccCCCceeccccccCcCCceeecCCcceeecccCCCCCcccCceeeCCee
Confidence
Q ss_pred --------------------------------C--------C--------------------------------------
Q 043639 165 --------------------------------E--------K-------------------------------------- 166 (261)
Q Consensus 165 --------------------------------~--------~-------------------------------------- 166 (261)
. .
T Consensus 271 y~~Ct~~g~~dg~~WC~tt~~yd~d~~~~~C~~~~~~~~~gn~~G~pC~fPF~~~~~~y~~Ct~~Gr~~g~~WCatt~~f 350 (421)
T 1eak_A 271 YDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANY 350 (421)
T ss_dssp ESSCBCTTCSSCCCEEESSSCTTTSCCEEECCCCCCSCBSTTTTTCCCCSSEEETTEEESSCBCTTCSSSCCEEESSSCH
T ss_pred eccccccCcccCceeeecccccCccccccccCcccceeeccCCCCCceeeeEEEcceEEEeccccCCcCCceeeeecccc
Confidence 0 0
Q ss_pred ---------CCccccchhhhhhhhhhhcCCCCCCCCCCccccccCCCCCCCCCCHHHHHHHHHHhCCCCCC
Q 043639 167 ---------SPVAVDLESVAVHEIGHLLGLTHSPVKEAVMYPTLKPRDKKVDLALDDIQGVQALYGSNPNF 228 (261)
Q Consensus 167 ---------~~~~~~l~~Va~HEiGHaLGL~Hs~~~~svM~p~y~~~~~~~~l~~dDI~~iq~LYG~~~~~ 228 (261)
...+.+|+.|++|||||+|||+|+.++++||+|+|+.. ..+.|+++||++||+|||++..+
T Consensus 351 D~DekWg~Cp~~g~~l~~va~HE~GHaLGL~Hs~~~~avM~p~Y~~~-~~~~l~~dDi~gIq~LYG~~~~~ 420 (421)
T 1eak_A 351 DDDRKWGFCPDQGYSLFLVAAHQFGHAMGLEHSQDPGALMAPIYTYT-KNFRLSQDDIKGIQELYGASPDI 420 (421)
T ss_dssp HHHCCEEECCCCCEEHHHHHHHHHHHHTTCCCCSCTTSTTCSBCCCC-SSCCCCHHHHHHHHHHHCCCCCC
T ss_pred ccccceEeeccccccchhhhhhhhhhccCCCCCCCCCCccccccccC-CCCCCCHHHHHHHHHHhCCCCCC
Confidence 00245888999999999999999999999999999854 67899999999999999987654
|
| >1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 | Back alignment and structure |
|---|
| >1slm_A Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 | Back alignment and structure |
|---|
| >830c_A MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 1.60A {Homo sapiens} SCOP: d.92.1.11 PDB: 456c_A* 1you_A* 4a7b_A* 3tvc_A* 1eub_A* 1xuc_A* 1xud_A* 1xur_A* 2yig_A* 3elm_A* 3i7g_A* 3i7i_A* 3zxh_A* 2ow9_A* 2ozr_A* 3kek_A* 3kej_A* 3kec_A* 2d1n_A* 1fls_A* ... | Back alignment and structure |
|---|
| >3ma2_D Matrix metalloproteinase-14; protein - protein complex, cleavage on PAIR of basic residue disulfide bond, membrane, metal-binding; 2.05A {Homo sapiens} SCOP: d.92.1.11 PDB: 1bqq_M 1buv_M | Back alignment and structure |
|---|
| >1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A | Back alignment and structure |
|---|
| >1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* | Back alignment and structure |
|---|
| >2y6d_A Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapiens} PDB: 2ddy_A* 1mmq_A* 1mmp_A* 1mmr_A* 2y6c_A* | Back alignment and structure |
|---|
| >2ovx_A Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) type IV collagenase) (92 kDa gelatinase)...; S1-prime pocket, hydrolase-hydrola inhibitor complex; HET: 4MR; 2.00A {Homo sapiens} SCOP: d.92.1.11 PDB: 2ovz_A* 2ow0_A* 2ow1_A* 2ow2_A* 1gkd_A* 1gkc_A* | Back alignment and structure |
|---|
| >2xs4_A Karilysin protease; hydrolase, bacterial MMP, virulence factor, metalloprotease, dependent, peptidase; 1.70A {Tannerella forsythia} PDB: 2xs3_A | Back alignment and structure |
|---|
| >3ayu_A 72 kDa type IV collagenase; protease, hydrolase-hydrolase inhibitor complex; 2.00A {Homo sapiens} PDB: 1qib_A 1hov_A* | Back alignment and structure |
|---|
| >1hy7_A Stromelysin-1, MMP-3; mixed alpha beta structure, zinc protease, inhibited, hydrol; HET: MBS; 1.50A {Homo sapiens} SCOP: d.92.1.11 PDB: 1biw_A* 1bm6_A* 1bqo_A* 1b3d_A* 1cqr_A 1d5j_A* 1d7x_A* 1d8f_A* 1d8m_A* 1g05_A* 1g49_A* 1c3i_A* 1sln_A* 1uea_A 2srt_A* 1ums_A* 1umt_A* 2d1o_A* 3oho_A* 1ciz_A* ... | Back alignment and structure |
|---|
| >1cge_A Fibroblast collagenase; hydrolase (metalloprotease); 1.90A {Homo sapiens} SCOP: d.92.1.11 PDB: 2j0t_A 1ayk_A 1hfc_A* 2ayk_A 2tcl_A* 3ayk_A* 4ayk_A* 1cgl_A* 1cgf_A 966c_A* 3shi_A | Back alignment and structure |
|---|
| >1i76_A MMP-8;, neutrophil collagenase; hydrolase, complex (metalloprotease/inhibitor); HET: BSI; 1.20A {Homo sapiens} SCOP: d.92.1.11 PDB: 1i73_A* 1jao_A* 1jap_A 1jaq_A* 1jj9_A* 1mmb_A* 1zp5_A* 1zs0_A* 1zvx_A* 3dng_A* 3dpe_A* 3dpf_A* 1kbc_A* 1jan_A* 1bzs_A* 1mnc_A* 2oy2_A 1a86_A* 1jh1_A* 1a85_A ... | Back alignment and structure |
|---|
| >1hv5_A Stromelysin 3; inhibition, phosphinic inhibitor, hydrolase; HET: CPS RXP; 2.60A {Mus musculus} SCOP: d.92.1.11 | Back alignment and structure |
|---|
| >1y93_A Macrophage metalloelastase; matrix metalloproteinase, MMP12, complex (elastase inhibitor), acetohydroxamic acid, hydrola; 1.03A {Homo sapiens} SCOP: d.92.1.11 PDB: 1rmz_A 1ycm_A* 1z3j_A* 2hu6_A* 2oxu_A 2oxw_A 2oxz_A 3lik_A* 3lil_A* 3lir_A* 3ljg_A* 1os9_A 1os2_A 3f17_A* 3ehy_A* 3ehx_A* 3f15_A* 3f16_A* 3f18_A* 3f19_A* ... | Back alignment and structure |
|---|
| >1rm8_A MMP-16, matrix metalloproteinase-16, MT3-MMP; membrane type - matrix metalloproteinase, batimastat, hydroxamate inhibitor, protease, hydrolase; HET: BAT; 1.80A {Homo sapiens} SCOP: d.92.1.11 | Back alignment and structure |
|---|
| >2jsd_A Matrix metalloproteinase-20; MMP-NNGH, structural genomics, structural proteomics in europe, spine, spine-2, spine2-complexes, hydrolase; HET: NGH; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A | Back alignment and structure |
|---|
| >1k7i_A PROC, secreted protease C; metalloprotease, hydrolase; 1.59A {Erwinia chrysanthemi} SCOP: b.80.7.1 d.92.1.6 PDB: 1k7g_A 1k7q_A 1go8_P 3hbv_P 3hda_P 3hbu_P 1go7_P 3hb2_P | Back alignment and structure |
|---|
| >1kap_P Alkaline protease; calcium binding protein, zinc metalloprotease; 1.64A {Pseudomonas aeruginosa} SCOP: b.80.7.1 d.92.1.6 PDB: 1jiw_P 1akl_A | Back alignment and structure |
|---|
| >1sat_A Serratia protease; parallel beta helix, parallel beta roll, hydrolase (serine protease); 1.75A {Serratia marcescens} SCOP: b.80.7.1 d.92.1.6 PDB: 1af0_A* 1smp_A 1srp_A | Back alignment and structure |
|---|
| >1g9k_A Serralysin; beta jelly roll, hydrolase; 1.96A {Pseudomonas} SCOP: b.80.7.1 d.92.1.6 PDB: 1o0q_A 1o0t_A 1om6_A 1om7_A 1om8_A 1omj_A 1h71_P | Back alignment and structure |
|---|
| >1c7k_A NCNP, zinc endoprotease; alpha and beta protein, metalloproteinase, hydrolase; 1.00A {Streptomyces caespitosus} SCOP: d.92.1.1 PDB: 1kuh_A | Back alignment and structure |
|---|
| >3edh_A Bone morphogenetic protein 1; vicinal disulfide, alternative splicing, calcium, chondrogenesis, cleavage on PAIR of basic residues, cytokine; 1.25A {Homo sapiens} SCOP: d.92.1.0 PDB: 3edg_A 3edi_A | Back alignment and structure |
|---|
| >3lq0_A Proastacin; metallopeptidase, zymogen activation, proenzyme, protease, D bond, hydrolase, metal-binding, metalloprotease, zymogen; 1.45A {Astacus astacus} PDB: 1iab_A 1iaa_A 1ast_A 1iac_A 1iad_A 1iae_A 1qji_A* 1qjj_A | Back alignment and structure |
|---|
| >3lqb_A Hatching enzyme, LOC792177 protein; hydrolase, metalloprotease, astacin, metal- protease; 1.10A {Danio rerio} | Back alignment and structure |
|---|
| >4gwm_A Meprin A subunit beta; mulidomain structure, hydrolase; HET: NAG BMA FUC MAN; 1.85A {Homo sapiens} PDB: 4gwn_A* | Back alignment and structure |
|---|
| >3p24_A BFT-3; metzincins, metalloendopeptidase, hydrolase; HET: PG4; 1.80A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2x7m_A Archaemetzincin; metalloprotease, protease, hydrolase, metal-bindi; 1.50A {Methanopyrus kandleri} | Back alignment and structure |
|---|
| >4axq_A Archaemetzincin; metalloprotease, protease, hydrolase, metal-bindi; 1.40A {Archaeoglobus fulgidus} PDB: 2xhq_A 3zvs_A 4a3w_A* | Back alignment and structure |
|---|
| >2cki_A Ulilysin; metalloprotease, hydrolase; HET: ARG; 1.7A {Methanosarcina acetivorans} PDB: 2j83_A* 3lum_A* 3lun_A* | Back alignment and structure |
|---|
| >3lmc_A Peptidase, zinc-dependent; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, MUR16; 2.00A {Methanocorpusculum labreanum} | Back alignment and structure |
|---|
| >3b8z_A Protein adamts-5; alpha/beta, hydrolase; HET: 294; 1.40A {Homo sapiens} PDB: 3hyg_A* 3hy9_A* 3hy7_A* 3ljt_A* | Back alignment and structure |
|---|
| >1qua_A Acutolysin-C, hemorrhagin III; metalloprotease, hemorrhagic toxin, snake venom proteinase; 2.20A {Deinagkistrodon acutus} SCOP: d.92.1.9 | Back alignment and structure |
|---|
| >1yp1_A FII; FII hydrolase; 1.90A {Deinagkistrodon acutus} | Back alignment and structure |
|---|
| >1kuf_A Atrolysin E, metalloproteinase; alpha/beta protein, hydrolase; 1.35A {Protobothrops mucrosquamatus} SCOP: d.92.1.9 PDB: 1kui_A 1kuk_A 1kug_A 1wni_A | Back alignment and structure |
|---|
| >1bud_A Protein (acutolysin A); metalloproteinase, snake venom, MMP, toxin; 1.90A {Deinagkistrodon acutus} SCOP: d.92.1.9 PDB: 1bsw_A | Back alignment and structure |
|---|
| >2w15_A Zinc metalloproteinase BAP1; hydrolase inhibitor complex, metal-binding, zinc-depending, metalloprotease, metalloproteinase/inhibitor complex; HET: WR2; 1.05A {Bothrops asper} PDB: 2w12_A* 2w13_A* 2w14_A* 1nd1_A 3gbo_A | Back alignment and structure |
|---|
| >1r55_A ADAM 33; metalloprotease, inhibitor, asthma, hydrolase; HET: NAG MAN 097; 1.58A {Homo sapiens} SCOP: d.92.1.9 PDB: 1r54_A* | Back alignment and structure |
|---|
| >2v4b_A Adamts-1; zymogen, protease, hydrolase, metalloprotease, heparin-binding, metalloproteinase, metzincin, glycoprotein metal-binding; 2.00A {Homo sapiens} PDB: 2jih_A 3q2g_A* 3q2h_A* | Back alignment and structure |
|---|
| >2rjq_A Adamts-5; metalloprotease domain, aggrecanase, cleavage on PAIR of BAS residues, extracellular matrix, glycoprotein, hydrolase, ME binding; HET: NAG BAT; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2rjp_A Adamts-4; metalloprotease domain, aggrecanase, cleavage on PAIR of basic residues, extracellular matrix, glycoprotein, hydrolase, metal-binding; HET: 886; 2.80A {Homo sapiens} PDB: 3b2z_A | Back alignment and structure |
|---|
| >2dw0_A Catrocollastatin; apoptotic toxin, SVMP, metalloproteinase, apoptosis, toxin; HET: NAG BMA MAN GM6; 2.15A {Crotalus atrox} PDB: 2dw1_A* 2dw2_A* 3dsl_A* 3hdb_A* | Back alignment and structure |
|---|
| >2e3x_A Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis} | Back alignment and structure |
|---|
| >2ddf_A ADAM 17; hydrolase; HET: INN CIT; 1.70A {Homo sapiens} PDB: 2fv5_A* 3l0v_A* 3kme_A* 3l0t_A* 3kmc_A* 3le9_A* 3lea_A* 3lgp_A* 3o64_A* 3ewj_A* 3edz_A* 3e8r_A* 2fv9_A* 1zxc_A* 2oi0_A* 3b92_A* 2a8h_A* 1bkc_A* 3cki_A 1bkc_I* ... | Back alignment and structure |
|---|
| >1atl_A Atrolysin C; metalloendopeptidase, hydrolase-hydrolase inhibitor complex; HET: 0QI; 1.80A {Crotalus atrox} SCOP: d.92.1.9 PDB: 1htd_A 1dth_A* 3aig_A* 2aig_P* 4aig_A* 1iag_A | Back alignment and structure |
|---|
| >2ero_A VAP-1, vascular apoptosis-inducing protein 1; metalloprotease, disintegrin, calcium-binding, ADAM, SVMP, M protein, toxin; HET: NAG; 2.50A {Crotalus atrox} PDB: 2erp_A* 2erq_A* | Back alignment and structure |
|---|
| >2i47_A ADAM 17; TACE-inhibitor complex, hydrolase; HET: INN KGY; 1.90A {Homo sapiens} SCOP: d.92.1.10 PDB: 3g42_A* | Back alignment and structure |
|---|
| >4dd8_A Disintegrin and metalloproteinase domain-containi 8; batimastat, inflammation, alpha/beta motif, metalloproteinas allergic asthma, tumorigenesis; HET: BAT; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3k7n_A K-like; SVMP, hydrolase; HET: NAG FUC FUL; 2.30A {Naja atra} | Back alignment and structure |
|---|
| >3k7l_A Atragin; SVMP, metalloprotease, hydrolase; HET: NAG; 2.50A {Naja atra} | Back alignment and structure |
|---|
| >1lml_A Leishmanolysin; metalloprotease, glycoprotein; 1.86A {Leishmania major} SCOP: d.92.1.3 | Back alignment and structure |
|---|
| >3g5c_A ADAM 22; alpha/beta fold, cross-linked domain, cell adhesion, cleavag of basic residues, EGF-like domain, glycoprotein, membrane, phosphoprotein; HET: NAG; 2.36A {Homo sapiens} | Back alignment and structure |
|---|
| >3ujz_A Metalloprotease STCE; mucin-type glycoprotein, hydrolase; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3p1v_A Metallo-endopeptidase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; HET: MSE; 1.93A {Bacteroides ovatus atcc 8483} PDB: 4df9_A* | Back alignment and structure |
|---|
| >3e11_A Predicted zincin-like metalloprotease; DUF1025 family protein, zincin-like fold, conserved matrix metalloprotease motif; 1.80A {Acidothermus cellulolyticus 11B} SCOP: d.92.1.17 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 261 | ||||
| d1mmqa_ | 166 | d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sap | 6e-42 | |
| d1hy7a_ | 168 | d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo | 8e-42 | |
| d1i76a_ | 163 | d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Hum | 1e-40 | |
| d1xuca1 | 169 | d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Huma | 4e-39 | |
| d1hv5a_ | 162 | d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus | 2e-38 | |
| d2ovxa1 | 159 | d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human | 1e-37 | |
| d1y93a1 | 158 | d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) | 1e-37 | |
| d1rm8a_ | 169 | d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16 | 1e-37 | |
| d1hfca_ | 157 | d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Hum | 3e-37 | |
| d1qiba_ | 161 | d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) | 5e-37 | |
| d1bqqm_ | 174 | d.92.1.11 (M:) Membrane-type matrix metalloprotein | 2e-35 | |
| d1sata2 | 243 | d.92.1.6 (A:4-246) Metalloprotease {Serratia marce | 3e-22 | |
| d1k7ia2 | 241 | d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrys | 8e-20 | |
| d1kapp2 | 246 | d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas ae | 3e-19 | |
| d1g9ka2 | 242 | d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp | 3e-17 |
| >d1mmqa_ d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9606]} Length = 166 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Matrix metalloproteases, catalytic domain
domain: Matrilysin (MMP-7)
species: Human (Homo sapiens) [TaxId: 9606]
Score = 139 bits (350), Expect = 6e-42
Identities = 62/176 (35%), Positives = 84/176 (47%), Gaps = 15/176 (8%)
Query: 52 YVLFPGKPRWTRHVPMTLSYAFSKENMINYLHITDIKAVFKRAFSKWASVIPVSFIETDD 111
Y LFP P+WT ++Y + L + + +A + W IP+ F +
Sbjct: 1 YSLFPNSPKWTSK---VVTYRIV--SYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVW 55
Query: 112 YDFADIRIGFYNGDHGDGEPFDGVLGVLAHSFSPESGKF---HLDAAETWAVDFGSEKSP 168
DI IGF G HGD PFDG LAH+F+P +G H D E W
Sbjct: 56 GTA-DIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGS-----S 109
Query: 169 VAVDLESVAVHEIGHLLGLTHSPVKEAVMYPTLKPRD-KKVDLALDDIQGVQALYG 223
+ ++ A HE+GH LG+ HS AVMYPT D + L+ DDI+G+Q LYG
Sbjct: 110 LGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYG 165
|
| >d1hy7a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Length = 168 | Back information, alignment and structure |
|---|
| >d1i76a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]} Length = 163 | Back information, alignment and structure |
|---|
| >d1xuca1 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d1hv5a_ d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxId: 10090]} Length = 162 | Back information, alignment and structure |
|---|
| >d2ovxa1 d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Length = 159 | Back information, alignment and structure |
|---|
| >d1y93a1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]} Length = 158 | Back information, alignment and structure |
|---|
| >d1rm8a_ d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16) {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d1hfca_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 157 | Back information, alignment and structure |
|---|
| >d1qiba_ d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} Length = 161 | Back information, alignment and structure |
|---|
| >d1bqqm_ d.92.1.11 (M:) Membrane-type matrix metalloproteinase (CDMT1-MMP) {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1sata2 d.92.1.6 (A:4-246) Metalloprotease {Serratia marcescens [TaxId: 615]} Length = 243 | Back information, alignment and structure |
|---|
| >d1k7ia2 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]} Length = 241 | Back information, alignment and structure |
|---|
| >d1kapp2 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]} Length = 246 | Back information, alignment and structure |
|---|
| >d1g9ka2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]} Length = 242 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 261 | |||
| d1mmqa_ | 166 | Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9 | 100.0 | |
| d1hv5a_ | 162 | Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxI | 100.0 | |
| d1xuca1 | 169 | Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxI | 100.0 | |
| d1hy7a_ | 168 | Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibro | 100.0 | |
| d1i76a_ | 163 | Neutrophil collagenase (MMP-8) {Human (Homo sapien | 100.0 | |
| d1hfca_ | 157 | Fibroblast collagenase (MMP-1) {Human (Homo sapien | 100.0 | |
| d1qiba_ | 161 | Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d2ovxa1 | 159 | Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: | 100.0 | |
| d1y93a1 | 158 | Macrophage elastase (MMP-12) {Human (Homo sapiens) | 100.0 | |
| d1rm8a_ | 169 | Matrix metalloproteinase-16 (MMP-16) {Human (Homo | 100.0 | |
| d1bqqm_ | 174 | Membrane-type matrix metalloproteinase (CDMT1-MMP) | 100.0 | |
| d1sata2 | 243 | Metalloprotease {Serratia marcescens [TaxId: 615]} | 99.96 | |
| d1kapp2 | 246 | Metalloprotease {Pseudomonas aeruginosa [TaxId: 28 | 99.95 | |
| d1k7ia2 | 241 | Metalloprotease {Erwinia chrysanthemi [TaxId: 556] | 99.95 | |
| d1g9ka2 | 242 | Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId | 99.93 | |
| d1asta_ | 200 | Astacin {European fresh water crayfish (Astacus as | 99.57 | |
| d1c7ka_ | 132 | Zinc protease {Streptomyces caespitosus [TaxId: 53 | 99.15 | |
| d1su3a1 | 67 | Fibroblast collagenase (MMP-1) {Human (Homo sapien | 98.09 | |
| d1slma1 | 65 | Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibro | 98.02 | |
| d1eaka1 | 76 | Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: | 97.81 | |
| d1l6ja1 | 77 | Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: | 97.74 | |
| d1bswa_ | 197 | Snake venom metalloprotease {Five-pace snake (Agki | 97.32 | |
| d2i47a1 | 254 | TNF-alpha converting enzyme, TACE, catalytic domai | 97.2 | |
| d1kufa_ | 201 | Snake venom metalloprotease {Taiwan habu (Trimeres | 97.2 | |
| d1nd1a_ | 202 | Snake venom metalloprotease {Terciopelo (Bothrops | 97.14 | |
| d1quaa_ | 197 | Snake venom metalloprotease {Chinese five-pace sna | 97.04 | |
| d1r55a_ | 203 | ADAM33 {Human (Homo sapiens) [TaxId: 9606]} | 96.9 | |
| d1atla_ | 200 | Snake venom metalloprotease {Western diamonback ra | 96.85 | |
| d1lmla_ | 475 | Leishmanolysin {Leishmania major [TaxId: 5664]} | 94.38 | |
| d3e11a1 | 113 | Uncharacterized protein Acel_2062 {Acidothermus ce | 87.27 |
| >d1mmqa_ d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Matrix metalloproteases, catalytic domain
domain: Matrilysin (MMP-7)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=1.2e-39 Score=268.71 Aligned_cols=162 Identities=39% Similarity=0.723 Sum_probs=143.0
Q ss_pred eeeCCCCCcccCCCCeeEEEEEecCCcCCcCCHHHHHHHHHHHHHHhHhcCCceEEEcCCCCCcceEEEeeecCCCCCCC
Q 043639 52 YVLFPGKPRWTRHVPMTLSYAFSKENMINYLHITDIKAVFKRAFSKWASVIPVSFIETDDYDFADIRIGFYNGDHGDGEP 131 (261)
Q Consensus 52 y~~~~~~~kW~~~~~~~LTY~~~~~~~~~~l~~~~~~~~i~~Af~~Ws~vt~l~F~ev~~~~~aDI~I~f~~~~hgd~~~ 131 (261)
|++||+.+||+++ +|||+|. +++++++..+++++|++||+.|+++++|+|+|+.+ +.+||+|.|....+....+
T Consensus 1 y~~~~~~~kW~~~---~iTY~i~--~~~~~~~~~~~~~~i~~A~~~W~~v~~i~F~~v~~-~~~di~i~~~~~~~~~~~~ 74 (166)
T d1mmqa_ 1 YSLFPNSPKWTSK---VVTYRIV--SYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVW-GTADIMIGFARGAHGDSYP 74 (166)
T ss_dssp CCBCTTCCCCCSS---EEEEEEC--CCCTTSCHHHHHHHHHHHHHHHHHHSSCEEEECSS-SCCSEEEEEECSCCSSSCC
T ss_pred CCCCCCCCCCCCC---ceEEEEe--cCCCCCCHHHHHHHHHHHHHHHhCcCCeeEEeccc-CCcceEEEEeccccCCccc
Confidence 6789999999998 9999997 56777888899999999999999999999999987 7899999999988888889
Q ss_pred ccCCCCceeeecCCCC---ceeeecccccccccCCCCCCCccccchhhhhhhhhhhcCCCCCCCCCCccccccCCCC-CC
Q 043639 132 FDGVLGVLAHSFSPES---GKFHLDAAETWAVDFGSEKSPVAVDLESVAVHEIGHLLGLTHSPVKEAVMYPTLKPRD-KK 207 (261)
Q Consensus 132 fdG~gg~lAhA~~P~~---G~vhfd~~e~wt~~~~~~~~~~~~~l~~Va~HEiGHaLGL~Hs~~~~svM~p~y~~~~-~~ 207 (261)
++|..+.+++++.+.. ++++||..+.|..... ...+++.|++|||||||||+|++++++||||.|.+.. ..
T Consensus 75 ~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~-----~~~~~~~v~~HEiGHaLGL~H~~~~~svM~~~~~~~~~~~ 149 (166)
T d1mmqa_ 75 FDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSS-----LGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQN 149 (166)
T ss_dssp CCSSSSCCEEECCSSSTTTTCEEEETTSCEESSSS-----SSEEHHHHHHHHHHHHHTBCCCSCTTSTTSSSSCSSCTTS
T ss_pred ccccceeeeeccCCCccccceEEecchhhhhcccc-----ccchhhhhhhhhhccccCCCCCCCCCCeECceecCCCCcC
Confidence 9999999999987754 7899998888765432 3567789999999999999999999999999998643 45
Q ss_pred CCCCHHHHHHHHHHhCC
Q 043639 208 VDLALDDIQGVQALYGS 224 (261)
Q Consensus 208 ~~l~~dDI~~iq~LYG~ 224 (261)
..|+++||++||+|||.
T Consensus 150 ~~l~~~Di~aiq~LYG~ 166 (166)
T d1mmqa_ 150 FKLSQDDIKGIQKLYGK 166 (166)
T ss_dssp CCCCHHHHHHHHHHHCC
T ss_pred CCCCHHHHHHHHHHhCc
Confidence 68999999999999994
|
| >d1hv5a_ d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xuca1 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hy7a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i76a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hfca_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qiba_ d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ovxa1 d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y93a1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rm8a_ d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bqqm_ d.92.1.11 (M:) Membrane-type matrix metalloproteinase (CDMT1-MMP) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sata2 d.92.1.6 (A:4-246) Metalloprotease {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1kapp2 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1k7ia2 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1g9ka2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1asta_ d.92.1.8 (A:) Astacin {European fresh water crayfish (Astacus astacus) [TaxId: 6715]} | Back information, alignment and structure |
|---|
| >d1c7ka_ d.92.1.1 (A:) Zinc protease {Streptomyces caespitosus [TaxId: 53502]} | Back information, alignment and structure |
|---|
| >d1su3a1 a.20.1.2 (A:32-98) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1slma1 a.20.1.2 (A:16-80) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eaka1 a.20.1.2 (A:32-107) Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l6ja1 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bswa_ d.92.1.9 (A:) Snake venom metalloprotease {Five-pace snake (Agkistrodon acutus), acutolysin A [TaxId: 36307]} | Back information, alignment and structure |
|---|
| >d2i47a1 d.92.1.10 (A:220-473) TNF-alpha converting enzyme, TACE, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kufa_ d.92.1.9 (A:) Snake venom metalloprotease {Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E [TaxId: 103944]} | Back information, alignment and structure |
|---|
| >d1nd1a_ d.92.1.9 (A:) Snake venom metalloprotease {Terciopelo (Bothrops asper), bap1 [TaxId: 8722]} | Back information, alignment and structure |
|---|
| >d1quaa_ d.92.1.9 (A:) Snake venom metalloprotease {Chinese five-pace snake (Agkistrodon acutus), acutolysin C [TaxId: 36307]} | Back information, alignment and structure |
|---|
| >d1r55a_ d.92.1.9 (A:) ADAM33 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1atla_ d.92.1.9 (A:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId: 8730]} | Back information, alignment and structure |
|---|
| >d1lmla_ d.92.1.3 (A:) Leishmanolysin {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d3e11a1 d.92.1.17 (A:1-113) Uncharacterized protein Acel_2062 {Acidothermus cellulolyticus [TaxId: 28049]} | Back information, alignment and structure |
|---|