Citrus Sinensis ID: 043665

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MARAIATAFPDIKCIVLICLLWWIIWWGTNNLEFFLEFEAIPPANVVLLKWILHDWSDEESLRYLKKKCEESIPSNDEGRKTQLCFDLLMATFLNGKEGSVYDWKKLFLAAGFSHYKITPNLGLWSLIEAYP
cHHHHHHHccccEEEEEEcccHHHcccccccEEEEcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccEEHHHHHHcccccccccHHHHHHHHHHccccccEEEEcccccEEEEEEc
cHHHHHHHcccEEEEEEccccEEcccccccccEEEEcccccccccEEEccccHHHccHHHHHHHHHHHHHHHccccccEEEEEEEEEEHHEEccccccccHHHHHHHHHHccccccEEEEEccccEEEEEcc
MARAIATAFPDIKCIVLICLLWWIIWWgtnnlefflefeaippaNVVLLKWILHDWSDEESLRYLKKKCeesipsndegrkTQLCFDLLMATFlngkegsvydWKKLFLAAGfshykitpnlglWSLIEAYP
maraiatafpdikCIVLICLLWWIIWWGTNNLEFFLEFEAIPPANVVLLKWILHDWSDEESLRYLKKKCeesipsndegrKTQLCFDLLMATFLNGKEGSVYDWKKLFLAAGFSHykitpnlglWSLIEAYP
MARAIATAFPDIKcivlicllwwiiwwGTNNLEFFLEFEAIPPANVVLLKWILHDWSDEESLRYLKKKCEESIPSNDEGRKTQLCFDLLMATFLNGKEGSVYDWKKLFLAAGFSHYKITPNLGLWSLIEAYP
****IATAFPDIKCIVLICLLWWIIWWGTNNLEFFLEFEAIPPANVVLLKWILHDWSDEESLRYLKK*************KTQLCFDLLMATFLNGKEGSVYDWKKLFLAAGFSHYKITPNLGLWSLIEA**
MARAIATAFPDIKCIVLICLLWWIIWWGTNNLEFFLEFEAIPPANVVLLKWILHDWSDEESLRYLKKKCEESIPSNDEGRKTQLCFDLLMATFLNGKEGSVYDWKKLFLAAGFSHYKITPNLGLWSLIEAYP
MARAIATAFPDIKCIVLICLLWWIIWWGTNNLEFFLEFEAIPPANVVLLKWILHDWSDEESLRYLKKKCEESIPSNDEGRKTQLCFDLLMATFLNGKEGSVYDWKKLFLAAGFSHYKITPNLGLWSLIEAYP
MARAIATAFPDIKCIVLICLLWWIIWWGTNNLEFFLEFEAIPPANVVLLKWILHDWSDEESLRYLKKKCEESIPSNDEGRKTQLCFDLLMATFLNGKEGSVYDWKKLFLAAGFSHYKITPNLGLWSLIEAYP
iiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARAIATAFPDIKCIVLICLLWWIIWWGTNNLEFFLEFEAIPPANVVLLKWILHDWSDEESLRYLKKKCEESIPSNDEGRKTQLCFDLLMATFLNGKEGSVYDWKKLFLAAGFSHYKITPNLGLWSLIEAYP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query132 2.2.26 [Sep-21-2011]
B6VJS4357 Trans-resveratrol di-O-me yes no 0.992 0.366 0.490 3e-31
A8QW53374 5-pentadecatrienyl resorc N/A no 0.962 0.339 0.440 2e-23
Q93WU3356 Chavicol O-methyltransfer N/A no 0.992 0.367 0.393 2e-22
Q8GSN1348 Myricetin O-methyltransfe N/A no 0.992 0.376 0.406 5e-22
Q84KK5357 Isoflavone 7-O-methyltran N/A no 0.977 0.361 0.421 5e-22
O24529352 Isoflavone-7-O-methyltran N/A no 0.977 0.366 0.427 1e-21
O22308352 Isoflavone-7-O-methyltran N/A no 0.977 0.366 0.427 1e-21
O22309352 Isoflavone-7-O-methyltran N/A no 0.977 0.366 0.427 1e-21
Q93WU2357 Eugenol O-methyltransfera N/A no 0.992 0.366 0.393 4e-21
O24305360 6a-hydroxymaackiain methy N/A no 1.0 0.366 0.414 7e-21
>sp|B6VJS4|ROMT_VITVI Trans-resveratrol di-O-methyltransferase OS=Vitis vinifera GN=ROMT PE=1 SV=2 Back     alignment and function desciption
 Score =  133 bits (334), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 92/153 (60%), Gaps = 22/153 (14%)

Query: 1   MARAIATAFPDIKCIVLICLLWWIIWWGTNNLEFFLE--FEAIPPANVVLLKWILHDWSD 58
           +A+AIA AFP + C VL          G+ NL +F    FEAIPPA+ +LLKWILHDWS+
Sbjct: 206 VAKAIANAFPHLNCTVLDLSHVVAGLQGSKNLNYFAGDMFEAIPPADAILLKWILHDWSN 265

Query: 59  EESLRYLKKKCEESIPSNDEGRK-------------------TQLCFDLLMATFLNGKEG 99
           EE ++ LK+ C E+IPS + G K                   TQL FD+ M  F  G+E 
Sbjct: 266 EECVKILKR-CREAIPSKENGGKVIIIDMIMMKNQGDYKSTETQLFFDMTMMIFAPGRER 324

Query: 100 SVYDWKKLFLAAGFSHYKITPNLGLWSLIEAYP 132
              +W+KLFL AGFSHYKITP LGL SLIE YP
Sbjct: 325 DENEWEKLFLDAGFSHYKITPILGLRSLIEVYP 357
Catalyzes the biosynthesis of pterostilbene from resveratrol. Pterostilbene has both antifungal and pharmacological properties. Also has activity toward resveratrol monomethyl ether (RME).
Vitis vinifera (taxid: 29760)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 4EC: 0
>sp|A8QW53|OMT3_SORBI 5-pentadecatrienyl resorcinol O-methyltransferase OS=Sorghum bicolor GN=OMT3 PE=1 SV=1 Back     alignment and function description
>sp|Q93WU3|CVMT1_OCIBA Chavicol O-methyltransferase OS=Ocimum basilicum GN=CVOMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q8GSN1|MOMT_CATRO Myricetin O-methyltransferase OS=Catharanthus roseus PE=1 SV=1 Back     alignment and function description
>sp|Q84KK5|D7OMT_GLYEC Isoflavone 7-O-methyltransferase OS=Glycyrrhiza echinata GN=D7OMT PE=1 SV=1 Back     alignment and function description
>sp|O24529|7OMT8_MEDSA Isoflavone-7-O-methyltransferase 8 OS=Medicago sativa PE=1 SV=1 Back     alignment and function description
>sp|O22308|7OMT6_MEDSA Isoflavone-7-O-methyltransferase 6 OS=Medicago sativa PE=2 SV=1 Back     alignment and function description
>sp|O22309|7OMT9_MEDSA Isoflavone-7-O-methyltransferase 9 OS=Medicago sativa PE=2 SV=1 Back     alignment and function description
>sp|Q93WU2|EOMT1_OCIBA Eugenol O-methyltransferase OS=Ocimum basilicum GN=EOMT1 PE=1 SV=1 Back     alignment and function description
>sp|O24305|M3OM1_PEA 6a-hydroxymaackiain methyltransferase 1 OS=Pisum sativum GN=HMM1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
333733187 357 O-methyltransferase [Vitis pseudoreticul 0.992 0.366 0.496 5e-30
421919646 357 O-metyltransferase [Vitis riparia] 0.992 0.366 0.496 6e-30
302143368 294 unnamed protein product [Vitis vinifera] 0.992 0.445 0.496 7e-30
359485297 357 PREDICTED: 8-hydroxyquercetin 8-O-methyl 0.992 0.366 0.496 8e-30
212290116 357 resveratrol O-methyltransferase [Vitis v 0.992 0.366 0.496 8e-30
359485261 357 PREDICTED: tabersonine 16-O-methyltransf 0.992 0.366 0.496 9e-30
359485259 357 PREDICTED: tabersonine 16-O-methyltransf 0.992 0.366 0.496 9e-30
147776504 323 hypothetical protein VITISV_027590 [Viti 0.992 0.405 0.496 1e-29
347664501 357 O-methyltransferase [Vitis vinifera] 0.992 0.366 0.490 1e-29
302143370 278 unnamed protein product [Vitis vinifera] 0.992 0.471 0.496 2e-29
>gi|333733187|gb|AEF97347.1| O-methyltransferase [Vitis pseudoreticulata] Back     alignment and taxonomy information
 Score =  135 bits (340), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 76/153 (49%), Positives = 92/153 (60%), Gaps = 22/153 (14%)

Query: 1   MARAIATAFPDIKCIVLICLLWWIIWWGTNNLEFFLE--FEAIPPANVVLLKWILHDWSD 58
           +A+AIA AFP + C VL          G+ NL +F    FEAIPPA+ +LLKWILHDWSD
Sbjct: 206 VAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEAIPPADAILLKWILHDWSD 265

Query: 59  EESLRYLKKKCEESIPSNDEGRK-------------------TQLCFDLLMATFLNGKEG 99
           EE ++ LK+ C E+IPS + G K                   TQL FD+ M  F  G+E 
Sbjct: 266 EECVKILKR-CREAIPSKENGGKVIIIDMIMMKNQGDYKSTETQLFFDMTMMIFAAGRER 324

Query: 100 SVYDWKKLFLAAGFSHYKITPNLGLWSLIEAYP 132
              +W+KLFL AGFSHYKITP LGL SLIE YP
Sbjct: 325 DENEWEKLFLDAGFSHYKITPILGLRSLIEVYP 357

Source: Vitis pseudoreticulata

Species: Vitis pseudoreticulata

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|421919646|gb|AFX68805.1| O-metyltransferase [Vitis riparia] Back     alignment and taxonomy information
>gi|302143368|emb|CBI21929.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485297|ref|XP_002281368.2| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|212290116|emb|CAQ76879.1| resveratrol O-methyltransferase [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485261|ref|XP_003633249.1| PREDICTED: tabersonine 16-O-methyltransferase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485259|ref|XP_003633248.1| PREDICTED: tabersonine 16-O-methyltransferase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147776504|emb|CAN69556.1| hypothetical protein VITISV_027590 [Vitis vinifera] Back     alignment and taxonomy information
>gi|347664501|gb|AEP17011.1| O-methyltransferase [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143370|emb|CBI21931.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
UNIPROTKB|A8QW53374 OMT3 "5-pentadecatrienyl resor 0.659 0.232 0.419 3.4e-23
UNIPROTKB|Q84KK4365 HI4'OMT "Isoflavone 4'-O-methy 0.598 0.216 0.397 4.8e-22
UNIPROTKB|Q84KK5357 D7OMT "Isoflavone 7-O-methyltr 0.598 0.221 0.378 5.9e-22
UNIPROTKB|Q6VMW0366 OMT2 "8-hydroxyquercetin 8-O-m 0.598 0.215 0.397 3e-21
UNIPROTKB|Q84KK6367 HI4'OMT "Isoflavone 4'-O-methy 0.439 0.158 0.525 5e-21
UNIPROTKB|B0EXJ8355 16OMT "Tabersonine 16-O-methyl 0.916 0.340 0.361 1.6e-14
UNIPROTKB|Q8GSN1348 Q8GSN1 "Myricetin O-methyltran 0.757 0.287 0.417 4.1e-14
TAIR|locus:2132806382 AT4G35160 [Arabidopsis thalian 0.356 0.123 0.387 1e-11
TAIR|locus:2132801325 AT4G35150 [Arabidopsis thalian 0.356 0.144 0.387 2.6e-11
TAIR|locus:2034016363 AT1G51990 [Arabidopsis thalian 0.303 0.110 0.465 3.4e-10
UNIPROTKB|A8QW53 OMT3 "5-pentadecatrienyl resorcinol O-methyltransferase" [Sorghum bicolor (taxid:4558)] Back     alignment and assigned GO terms
 Score = 169 (64.5 bits), Expect = 3.4e-23, Sum P(2) = 3.4e-23
 Identities = 39/93 (41%), Positives = 57/93 (61%)

Query:     4 AIATAFPDIKXXXXXXXXXXXXXXGTN--NLEFFLE--FEAIPPANVVLLKWILHDWSDE 59
             AIA AFP +K               ++  N++F     FE+IPPANVVLLKWILHDWS++
Sbjct:   225 AIAAAFPCLKCTVLDLPHVVAKAPSSSIGNVQFVGGDMFESIPPANVVLLKWILHDWSND 284

Query:    60 ESLRYLKKKCEESIPSNDEGRKTQLCFDLLMAT 92
             E ++ LK  C+++IPS D G K  +  D+++ +
Sbjct:   285 ECIKILKN-CKQAIPSRDAGGKI-IIIDVVVGS 315
GO:0008171 "O-methyltransferase activity" evidence=IDA
GO:0008757 "S-adenosylmethionine-dependent methyltransferase activity" evidence=IDA
GO:0032259 "methylation" evidence=IDA
UNIPROTKB|Q84KK4 HI4'OMT "Isoflavone 4'-O-methyltransferase" [Lotus japonicus (taxid:34305)] Back     alignment and assigned GO terms
UNIPROTKB|Q84KK5 D7OMT "Isoflavone 7-O-methyltransferase" [Glycyrrhiza echinata (taxid:46348)] Back     alignment and assigned GO terms
UNIPROTKB|Q6VMW0 OMT2 "8-hydroxyquercetin 8-O-methyltransferase" [Mentha x piperita (taxid:34256)] Back     alignment and assigned GO terms
UNIPROTKB|Q84KK6 HI4'OMT "Isoflavone 4'-O-methyltransferase" [Glycyrrhiza echinata (taxid:46348)] Back     alignment and assigned GO terms
UNIPROTKB|B0EXJ8 16OMT "Tabersonine 16-O-methyltransferase" [Catharanthus roseus (taxid:4058)] Back     alignment and assigned GO terms
UNIPROTKB|Q8GSN1 Q8GSN1 "Myricetin O-methyltransferase" [Catharanthus roseus (taxid:4058)] Back     alignment and assigned GO terms
TAIR|locus:2132806 AT4G35160 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132801 AT4G35150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034016 AT1G51990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
pfam00891239 pfam00891, Methyltransf_2, O-methyltransferase 3e-20
>gnl|CDD|216177 pfam00891, Methyltransf_2, O-methyltransferase Back     alignment and domain information 
 Score = 82.3 bits (204), Expect = 3e-20
 Identities = 45/129 (34%), Positives = 63/129 (48%), Gaps = 26/129 (20%)

Query: 2   ARAIATAFPDIKCIVLICLLWWIIWW--GTNNLEF----FLEFEAIPPANVVLLKWILHD 55
           A AI  A+P IK IV    L  +I      + +EF    F  FE++P A+ +LLKW+LHD
Sbjct: 116 AAAIVRAYPHIKGIVFD--LPHVIADAPSADRVEFVGGDF--FESVPEADAILLKWVLHD 171

Query: 56  WSDEESLRYLKKKCEESIPSN----------DEGR-----KTQLCFDLLMATFLNGKEGS 100
           WSDE+ ++ L K+C E++P             E          L  DL M     GKE +
Sbjct: 172 WSDEDCVKIL-KRCYEALPPGGKVIVVEMVLPEDPDDDLETEVLLLDLNMLVLNGGKERT 230

Query: 101 VYDWKKLFL 109
             +W+KL  
Sbjct: 231 EKEWRKLLS 239

This family includes a range of O-methyltransferases. These enzymes utilise S-adenosyl methionine. Length = 239

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 132
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 99.96
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 99.94
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 99.79
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.17
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 98.98
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 98.92
PLN02490340 MPBQ/MSBQ methyltransferase 98.91
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 98.89
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.88
PLN02233261 ubiquinone biosynthesis methyltransferase 98.86
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 98.86
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.83
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 98.77
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 98.74
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.68
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 98.66
PLN02336475 phosphoethanolamine N-methyltransferase 98.64
PLN02244340 tocopherol O-methyltransferase 98.59
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 98.53
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 98.49
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 98.48
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 98.48
PRK08317241 hypothetical protein; Provisional 98.44
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 98.41
PLN02232160 ubiquinone biosynthesis methyltransferase 98.39
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.35
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 98.34
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 98.34
PLN03075296 nicotianamine synthase; Provisional 98.29
TIGR00452314 methyltransferase, putative. Known examples to dat 98.27
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 98.27
PLN02585315 magnesium protoporphyrin IX methyltransferase 98.25
PRK06202232 hypothetical protein; Provisional 98.23
PRK11207197 tellurite resistance protein TehB; Provisional 98.19
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 98.18
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 98.12
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 98.1
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 98.09
TIGR03438301 probable methyltransferase. This model represents 98.08
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 98.08
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 98.08
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 98.08
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 98.05
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 98.02
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 97.99
PRK06922677 hypothetical protein; Provisional 97.98
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 97.92
PLN02336 475 phosphoethanolamine N-methyltransferase 97.91
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 97.88
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 97.83
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 97.76
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 97.74
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 97.73
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 97.66
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 97.65
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 97.64
PRK10611287 chemotaxis methyltransferase CheR; Provisional 97.6
COG4106257 Tam Trans-aconitate methyltransferase [General fun 97.57
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 97.54
PRK12335287 tellurite resistance protein TehB; Provisional 97.51
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 97.5
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 97.5
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 97.47
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 97.46
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 97.43
PRK05785226 hypothetical protein; Provisional 97.42
PRK04457262 spermidine synthase; Provisional 97.39
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 97.29
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 97.17
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 97.16
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 97.14
KOG2361264 consensus Predicted methyltransferase [General fun 97.14
PRK10258251 biotin biosynthesis protein BioC; Provisional 97.13
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 97.13
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 97.04
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 97.04
PRK04266226 fibrillarin; Provisional 97.03
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 96.78
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 96.73
PRK14968188 putative methyltransferase; Provisional 96.71
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 96.66
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 96.6
KOG2899288 consensus Predicted methyltransferase [General fun 96.58
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 96.5
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 96.48
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 96.19
PRK13255218 thiopurine S-methyltransferase; Reviewed 96.09
KOG1270282 consensus Methyltransferases [Coenzyme transport a 96.08
TIGR00536284 hemK_fam HemK family putative methylases. The gene 96.04
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 95.82
PRK01581374 speE spermidine synthase; Validated 95.81
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 95.81
PHA03411279 putative methyltransferase; Provisional 95.8
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 95.73
PTZ00146293 fibrillarin; Provisional 95.67
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 95.54
PLN02366308 spermidine synthase 95.5
PRK00811283 spermidine synthase; Provisional 95.5
COG0421282 SpeE Spermidine synthase [Amino acid transport and 95.44
PRK00536262 speE spermidine synthase; Provisional 95.25
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 95.23
PRK13256226 thiopurine S-methyltransferase; Reviewed 95.11
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 94.92
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 94.92
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 94.9
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 94.74
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 94.71
COG4123248 Predicted O-methyltransferase [General function pr 94.43
PRK07402196 precorrin-6B methylase; Provisional 94.3
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 94.29
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 94.24
PRK03612521 spermidine synthase; Provisional 94.23
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 93.86
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 93.67
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 93.49
KOG4300252 consensus Predicted methyltransferase [General fun 93.29
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 93.13
PLN02823336 spermine synthase 92.68
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 92.65
KOG1975 389 consensus mRNA cap methyltransferase [RNA processi 92.23
COG4627185 Uncharacterized protein conserved in bacteria [Fun 92.08
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 92.0
PRK14967223 putative methyltransferase; Provisional 91.66
COG4301321 Uncharacterized conserved protein [Function unknow 91.64
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 91.63
PF06859110 Bin3: Bicoid-interacting protein 3 (Bin3); InterPr 91.52
COG2890280 HemK Methylase of polypeptide chain release factor 91.28
PF02153 258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 91.19
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 91.0
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 90.96
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 90.94
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 90.67
PLN02672 1082 methionine S-methyltransferase 90.52
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 90.32
TIGR00027260 mthyl_TIGR00027 methyltransferase, putative, TIGR0 90.15
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 89.4
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 89.04
COG4262508 Predicted spermidine synthase with an N-terminal m 88.99
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 88.56
PF0710997 Mg-por_mtran_C: Magnesium-protoporphyrin IX methyl 88.53
COG3315297 O-Methyltransferase involved in polyketide biosynt 88.21
PRK14902444 16S rRNA methyltransferase B; Provisional 86.03
KOG1271227 consensus Methyltransferases [General function pre 84.21
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 83.91
PLN02589247 caffeoyl-CoA O-methyltransferase 83.7
PLN02476278 O-methyltransferase 82.01
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 81.97
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 80.61
PF10017127 Methyltransf_33: Histidine-specific methyltransfer 80.42
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 80.24
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information 
Probab=99.96  E-value=1.4e-30  Score=193.77  Aligned_cols=107  Identities=29%  Similarity=0.492  Sum_probs=94.9

Q ss_pred             HHHHHHHCCCCeEEEeechhHHhhhcCCCCeEEEe--ccccCCCceEEEehhhhcCCChHHHHHHHHHHhhhhCCCC--C
Q 043665            2 ARAIATAFPDIKCIVLICLLWWIIWWGTNNLEFFL--EFEAIPPANVVLLKWILHDWSDEESLRYLKKKCEESIPSN--D   77 (132)
Q Consensus         2 ~~~l~~~~P~l~~~v~Dlp~v~~~a~~~~ri~~~~--~~~~~P~~D~~ll~~vlh~~~de~~~~iL~~~~~~al~~~--g   77 (132)
                      +.+++++||+++++++|+|+|++.+++.+||++++  ||+++|.||+|+++||||+|+|++|++||+ +++++|+||  |
T Consensus       115 ~~~l~~~~P~l~~~v~Dlp~v~~~~~~~~rv~~~~gd~f~~~P~~D~~~l~~vLh~~~d~~~~~iL~-~~~~al~pg~~g  193 (241)
T PF00891_consen  115 AIALARAYPNLRATVFDLPEVIEQAKEADRVEFVPGDFFDPLPVADVYLLRHVLHDWSDEDCVKILR-NAAAALKPGKDG  193 (241)
T ss_dssp             HHHHHHHSTTSEEEEEE-HHHHCCHHHTTTEEEEES-TTTCCSSESEEEEESSGGGS-HHHHHHHHH-HHHHHSEECTTE
T ss_pred             HHHHHHHCCCCcceeeccHhhhhccccccccccccccHHhhhccccceeeehhhhhcchHHHHHHHH-HHHHHhCCCCCC
Confidence            67899999999999999999999999999999999  889999999999999999999999999999 999999998  7


Q ss_pred             ---------C--C--Ccch---hhhhhhhhhcCCCccCCHHHHHHHHH
Q 043665           78 ---------E--G--RKTQ---LCFDLLMATFLNGKEGSVYDWKKLFL  109 (132)
Q Consensus        78 ---------~--~--~~~~---~~~dl~m~~~~~g~~rt~~e~~~ll~  109 (132)
                               +  .  +...   ..+|++||++++|++||.+||++||+
T Consensus       194 ~llI~e~~~~~~~~~~~~~~~~~~~dl~ml~~~~G~~rt~~e~~~ll~  241 (241)
T PF00891_consen  194 RLLIIEMVLPDDRTGPPSAEMDALFDLNMLVLTGGKERTEEEWEALLK  241 (241)
T ss_dssp             EEEEEEEEECSSSSSHHHHHHHHHHHHHHHHHHSSS-EEHHHHHHHHH
T ss_pred             eEEEEeeccCCCCCCchHHHHHHHHHHHHHHhcCCCCcCHHHHHHHhC
Confidence                     1  1  1122   58999999999999999999999985

The reaction is catalysed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented. Three classes of DNA Mtases transfer the methyl group from AdoMet to the target base to form either N-6-methyladenine, or N-4-methylcytosine, or C-5- methylcytosine. In C-5-cytosine Mtases, ten conserved motifs are arranged in the same order []. Motif I (a glycine-rich or closely related consensus sequence; FAGxGG in M.HhaI []), shared by other AdoMet-Mtases [], is part of the cofactor binding site and motif IV (PCQ) is part of the catalytic site. In contrast, sequence comparison among N-6-adenine and N-4-cytosine Mtases indicated two of the conserved segments [], although more conserved segments may be present. One of them corresponds to motif I in C-5-cytosine Mtases, and the other is named (D/N/S)PP(Y/F). Crystal structures are known for a number of Mtases [, , , ]. The cofactor binding sites are almost identical and the essential catalytic amino acids coincide. The comparable protein folding and the existence of equivalent amino acids in similar secondary and tertiary positions indicate that many (if not all) AdoMet-Mtases have a common catalytic domain structure. This permits tertiary structure prediction of other DNA, RNA, protein, and small-molecule AdoMet-Mtases from their amino acid sequences []. This domain includes a range of O-methyltransferases some of which utilise S-adenosyl methionine as substrate []. In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes. In eukaryotes, DNA methylation has been implicated in the control of several cellular processes, including differentiation, gene regulation, and embryonic development. O-methyltransferases have a common catalytic domain structure, which might be universal among S-adenosyl-L-methionine (AdoMet)-dependent methyltransferases []. Comparative analysis of the predicted amino acid sequences of a number of plant O-methyltransferase cDNA clones show that they share some 32-71% sequence identity, and can be grouped according to the different compounds they utilise as substrates [].; GO: 0008171 O-methyltransferase activity; PDB: 1FPQ_A 1FP1_D 3P9K_B 3P9I_D 3P9C_A 3I53_A 3I5U_A 3I64_A 3I58_A 1ZG3_A ....
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>COG4627 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>COG4301 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00027 mthyl_TIGR00027 methyltransferase, putative, TIGR00027 family Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PF07109 Mg-por_mtran_C: Magnesium-protoporphyrin IX methyltransferase C-terminus; InterPro: IPR010940 This entry represents the C terminus (approximately 100 residues) of bacterial and eukaryotic Magnesium-protoporphyrin IX methyltransferase (2 Back     alignment and domain information
>COG3315 O-Methyltransferase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PF10017 Methyltransf_33: Histidine-specific methyltransferase, SAM-dependent; InterPro: IPR019257 This domain is found in methyltransferases and various hypothetical proteins Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
1fp2_A352 Crystal Structure Analysis Of Isoflavone O-Methyltr 9e-22
1fpx_A352 Crystal Structure Analysis Of Selenomethionine Subs 9e-21
1zg3_A358 Crystal Structure Of The Isoflavanone 4'-O-Methyltr 5e-20
1zga_A357 Crystal Structure Of Isoflavanone 4'-o-methyltransf 5e-20
1zgj_A354 Crystal Structure Of Isoflavanone 4'-O-Methyltransf 5e-20
2qyo_A357 Crystal Structure Of Isoflavone O-Methyltransferase 2e-18
1kyw_A365 Crystal Structure Analysis Of Caffeic Acid5-Hydroxy 1e-08
3reo_A368 Monolignol O-Methyltransferase (Momt) Length = 368 3e-07
3p9c_A364 Crystal Structure Of Perennial Ryegrass Lpomt1 Boun 2e-05
3lst_A348 Crystal Structure Of Calo1, Methyltransferase In Ca 2e-05
1fp1_D372 Crystal Structure Analysis Of Chalcone O-Methyltran 3e-05
1fpq_A372 Crystal Structure Analysis Of Selenomethionine Subs 3e-04
>pdb|1FP2|A Chain A, Crystal Structure Analysis Of Isoflavone O-Methyltransferase Length = 352 Back     alignment and structure 
Iteration: 1

 Score = 98.6 bits (244), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 62/152 (40%), Positives = 84/152 (55%), Gaps = 23/152 (15%)
Query: 2   ARAIATAFPDIKXXXXXXXXXXXXXXGTNNLEFFLE--FEAIPPANVVLLKWILHDWSDE 59
           A+ I   FP +K              G+NNL +     F +IP A+ VLLK+ILH+W+D+
Sbjct: 203 AKIICETFPKLKCIVFDRPQVVENLSGSNNLTYVGGDMFTSIPNADAVLLKYILHNWTDK 262
Query: 60  ESLRYLKKKCEESIPSN-----------------DEGRKTQ--LCFDLLMATFLNGKEGS 100
           + LR LKK C+E++ ++                 DE + TQ  L  D+ MA  LNGKE +
Sbjct: 263 DCLRILKK-CKEAVTNDGKRGKVTIIDMVIDKKKDENQVTQIKLLMDVNMAC-LNGKERN 320
Query: 101 VYDWKKLFLAAGFSHYKITPNLGLWSLIEAYP 132
             +WKKLF+ AGF HYKI+P  G  SLIE YP
Sbjct: 321 EEEWKKLFIEAGFQHYKISPLTGFLSLIEIYP 352
>pdb|1FPX|A Chain A, Crystal Structure Analysis Of Selenomethionine Substituted Isoflavone O-Methyltransferase Length = 352 Back     alignment and structure
>pdb|1ZG3|A Chain A, Crystal Structure Of The Isoflavanone 4'-O-Methyltransferase Complexed With Sah And 2,7,4'-Trihydroxyisoflavanone Length = 358 Back     alignment and structure
>pdb|1ZGA|A Chain A, Crystal Structure Of Isoflavanone 4'-o-methyltransferase Complexed With (+)-6a-hydroxymaackiain Length = 357 Back     alignment and structure
>pdb|1ZGJ|A Chain A, Crystal Structure Of Isoflavanone 4'-O-Methyltransferase Complexed With (+)-Pisatin Length = 354 Back     alignment and structure
>pdb|2QYO|A Chain A, Crystal Structure Of Isoflavone O-Methyltransferase Homolog In Complex With Biochanin A And Sah Length = 357 Back     alignment and structure
>pdb|1KYW|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde Length = 365 Back     alignment and structure
>pdb|3REO|A Chain A, Monolignol O-Methyltransferase (Momt) Length = 368 Back     alignment and structure
>pdb|3P9C|A Chain A, Crystal Structure Of Perennial Ryegrass Lpomt1 Bound To Sah Length = 364 Back     alignment and structure
>pdb|3LST|A Chain A, Crystal Structure Of Calo1, Methyltransferase In Calicheamicin Biosynthesis, Sah Bound Form Length = 348 Back     alignment and structure
>pdb|1FP1|D Chain D, Crystal Structure Analysis Of Chalcone O-Methyltransferase Length = 372 Back     alignment and structure
>pdb|1FPQ|A Chain A, Crystal Structure Analysis Of Selenomethionine Substituted Chalcone O- Methyltransferase Length = 372 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 2e-38
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 4e-37
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 5e-37
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 8e-37
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 5e-35
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 2e-34
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 5e-34
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 6e-34
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 8e-34
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 1e-33
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 8e-33
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 3e-30
2r3s_A335 Uncharacterized protein; methyltransferase domain, 9e-24
3dp7_A363 SAM-dependent methyltransferase; structural genomi 6e-21
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 2e-16
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Length = 348 Back     alignment and structure
 Score =  131 bits (332), Expect = 2e-38
 Identities = 30/153 (19%), Positives = 55/153 (35%), Gaps = 24/153 (15%)

Query: 1   MARAIATAFPDIKCIVL-----ICLLWWIIWWGTNNLEF----FLEFEAIPPANVVLLKW 51
               +    P ++ ++L     +              +     F     +P A+V +LK 
Sbjct: 198 FLLTVLREHPGLQGVLLDRAEVVARHRLDAPDVAGRWKVVEGDF--LREVPHADVHVLKR 255

Query: 52  ILHDWSDEESLRYLKKKCEESIPSN------------DEGRKTQLCFDLLMATFLNGKEG 99
           ILH+W DE+S+R L   C   +P++                      D +M     G+E 
Sbjct: 256 ILHNWGDEDSVRIL-TNCRRVMPAHGRVLVIDAVVPEGNDAHQSKEMDFMMLAARTGQER 314

Query: 100 SVYDWKKLFLAAGFSHYKITPNLGLWSLIEAYP 132
           +  + + LF AAG    ++     + S+    P
Sbjct: 315 TAAELEPLFTAAGLRLDRVVGTSSVMSIAVGVP 347
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Length = 369 Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Length = 352 Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Length = 334 Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Length = 360 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Length = 332 Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Length = 364 Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Length = 372 Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Length = 358 Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 1kyz_A* 1kyw_A* Length = 368 Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Length = 374 Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Length = 359 Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Length = 335 Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Length = 363 Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Length = 352 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 100.0
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 99.95
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 99.94
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.93
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 99.93
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 99.92
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 99.92
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 99.9
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 99.9
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 99.89
3dp7_A363 SAM-dependent methyltransferase; structural genomi 99.89
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.85
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 99.84
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.83
2r3s_A335 Uncharacterized protein; methyltransferase domain, 99.82
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 99.81
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.39
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.3
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 99.16
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.16
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.14
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.08
3ocj_A305 Putative exported protein; structural genomics, PS 99.06
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.05
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.03
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.02
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.01
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.01
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 98.98
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 98.98
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 98.95
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 98.93
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.92
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 98.91
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 98.89
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.89
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 98.88
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 98.87
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 98.87
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.87
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 98.87
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 98.84
2p7i_A250 Hypothetical protein; putative methyltransferase, 98.83
1vl5_A260 Unknown conserved protein BH2331; putative methylt 98.83
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 98.82
3f4k_A257 Putative methyltransferase; structural genomics, P 98.81
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 98.79
3lcc_A235 Putative methyl chloride transferase; halide methy 98.79
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 98.76
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 98.76
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.76
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 98.74
1xxl_A239 YCGJ protein; structural genomics, protein structu 98.73
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 98.73
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 98.72
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 98.69
3gu3_A284 Methyltransferase; alpha-beta protein, structural 98.69
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 98.63
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 98.63
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 98.61
3i9f_A170 Putative type 11 methyltransferase; structural gen 98.59
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 98.56
3ege_A261 Putative methyltransferase from antibiotic biosyn 98.55
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 98.54
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.53
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 98.49
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 98.49
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 98.45
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 98.41
1vlm_A219 SAM-dependent methyltransferase; possible histamin 98.36
3cc8_A230 Putative methyltransferase; structural genomics, j 98.36
3giw_A277 Protein of unknown function DUF574; rossmann-fold 98.32
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 98.31
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 98.3
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 98.28
2i62_A265 Nicotinamide N-methyltransferase; structural genom 98.24
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 98.23
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 98.23
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 98.21
2b3t_A276 Protein methyltransferase HEMK; translation termin 98.17
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 98.16
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 98.16
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 98.14
1wzn_A252 SAM-dependent methyltransferase; structural genomi 98.13
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.12
2kw5_A202 SLR1183 protein; structural genomics, northeast st 98.09
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 97.99
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 97.98
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 97.97
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 97.91
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 97.86
2h00_A254 Methyltransferase 10 domain containing protein; st 97.85
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 97.83
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 97.76
2qm3_A373 Predicted methyltransferase; putative methyltransf 97.72
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 97.61
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 97.6
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 97.6
3m70_A286 Tellurite resistance protein TEHB homolog; structu 97.57
4hg2_A257 Methyltransferase type 11; structural genomics, PS 97.57
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 97.52
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 97.51
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 97.51
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 97.5
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 97.48
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 97.48
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 97.46
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 97.42
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 97.42
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 97.41
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 97.4
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 97.39
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 97.39
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 97.38
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 97.38
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 97.35
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 97.3
3gjy_A317 Spermidine synthase; APC62791, structural genomics 97.28
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 97.27
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 97.25
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 97.21
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 97.14
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 97.12
3lpm_A259 Putative methyltransferase; structural genomics, p 97.12
1yb2_A275 Hypothetical protein TA0852; structural genomics, 97.08
3m33_A226 Uncharacterized protein; structural genomics, PSI- 97.06
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 97.05
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 97.03
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 97.03
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 96.94
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 96.88
3duw_A223 OMT, O-methyltransferase, putative; alternating of 96.87
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 96.86
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 96.82
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 96.77
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 96.73
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 96.68
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 96.67
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 96.66
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 96.6
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 96.6
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 96.48
1jsx_A207 Glucose-inhibited division protein B; methyltransf 96.48
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 96.48
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 96.43
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 96.43
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 96.42
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 96.35
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 96.34
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 96.25
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 96.25
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 96.17
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 96.11
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 96.09
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 96.09
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 96.01
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 96.0
2i7c_A283 Spermidine synthase; transferase, structural genom 95.96
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 95.93
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 95.92
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 95.85
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 95.83
2frn_A278 Hypothetical protein PH0793; structural genomics, 95.83
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 95.82
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 95.81
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 95.76
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 95.71
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 95.69
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 95.61
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 95.6
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 95.58
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 95.57
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 95.56
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 95.51
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 95.49
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 95.43
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 95.4
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 95.4
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 95.36
2pt6_A321 Spermidine synthase; transferase, structural genom 95.29
1rjd_A334 PPM1P, carboxy methyl transferase for protein phos 95.28
2uyo_A310 Hypothetical protein ML2640; putative methyltransf 95.27
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 95.25
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 95.24
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 95.19
2o07_A304 Spermidine synthase; structural genomics, structur 95.14
2avd_A229 Catechol-O-methyltransferase; structural genomics, 95.12
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 95.09
1xj5_A334 Spermidine synthase 1; structural genomics, protei 95.04
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 95.04
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 94.92
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 94.92
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 94.69
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 94.66
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 94.58
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 94.37
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 94.26
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 94.2
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 94.01
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 93.97
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 93.97
2cmg_A262 Spermidine synthase; transferase, putrescine amino 93.95
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 93.9
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 93.84
2esr_A177 Methyltransferase; structural genomics, hypothetic 93.83
1ws6_A171 Methyltransferase; structural genomics, riken stru 93.79
1ne2_A200 Hypothetical protein TA1320; structural genomics, 93.72
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 93.58
3sso_A419 Methyltransferase; macrolide, natural product, ros 93.56
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 93.49
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 93.34
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 93.03
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 93.01
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 92.46
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 91.9
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 91.82
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 91.62
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 91.57
2b25_A336 Hypothetical protein; structural genomics, methyl 91.56
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 91.51
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 91.51
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 91.33
3iei_A334 Leucine carboxyl methyltransferase 1; LCMT-1, S-ad 91.01
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 90.75
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 90.5
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 90.43
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 89.94
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 89.16
2fpo_A202 Methylase YHHF; structural genomics, putative meth 88.75
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 88.67
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 88.66
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 88.25
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 87.57
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 87.06
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 86.88
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 86.33
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 85.95
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 85.68
2efj_A384 3,7-dimethylxanthine methyltransferase; SAM-depend 84.68
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 82.56
3k6r_A278 Putative transferase PH0793; structural genomics, 81.96
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 81.79
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 80.18
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
Probab=100.00  E-value=5e-34  Score=221.50  Aligned_cols=130  Identities=21%  Similarity=0.324  Sum_probs=119.2

Q ss_pred             HHHHHHHCCCCeEEEeechhHHhhhcC------CCCeEEEe--ccc-cCCCceEEEehhhhcCCChHHHHHHHHHHhhhh
Q 043665            2 ARAIATAFPDIKCIVLICLLWWIIWWG------TNNLEFFL--EFE-AIPPANVVLLKWILHDWSDEESLRYLKKKCEES   72 (132)
Q Consensus         2 ~~~l~~~~P~l~~~v~Dlp~v~~~a~~------~~ri~~~~--~~~-~~P~~D~~ll~~vlh~~~de~~~~iL~~~~~~a   72 (132)
                      +.+++++||+++++++|+|++++.+++      .+||++++  ||+ +.|++|+|++++|||||+|++|++||+ +++++
T Consensus       194 ~~~l~~~~p~~~~~~~dlp~v~~~a~~~~~~~~~~rv~~~~gD~~~~~~~~~D~~~~~~vlh~~~d~~~~~iL~-~~~~a  272 (353)
T 4a6d_A          194 AKECMSLYPGCKITVFDIPEVVWTAKQHFSFQEEEQIDFQEGDFFKDPLPEADLYILARVLHDWADGKCSHLLE-RIYHT  272 (353)
T ss_dssp             HHHHHHHCSSCEEEEEECHHHHHHHHHHSCC--CCSEEEEESCTTTSCCCCCSEEEEESSGGGSCHHHHHHHHH-HHHHH
T ss_pred             HHHHHHhCCCceeEeccCHHHHHHHHHhhhhcccCceeeecCccccCCCCCceEEEeeeecccCCHHHHHHHHH-HHHhh
Confidence            678999999999999999999998875      58999999  887 566799999999999999999999999 99999


Q ss_pred             CCCCC-----C--------CCcchhhhhhhhhhcCCCccCCHHHHHHHHHhCCCeeeEEEecCCcceEEEEEC
Q 043665           73 IPSND-----E--------GRKTQLCFDLLMATFLNGKEGSVYDWKKLFLAAGFSHYKITPNLGLWSLIEAYP  132 (132)
Q Consensus        73 l~~~g-----~--------~~~~~~~~dl~m~~~~~g~~rt~~e~~~ll~~aGf~~~~~~~~~~~~~~ie~~p  132 (132)
                      |+|||     +        .+.....+|++||+.+||++||.+||++||++|||+.++++++++..++|+++|
T Consensus       273 l~pgg~lli~e~~~~~~~~~~~~~~~~dl~ml~~~~g~ert~~e~~~ll~~AGf~~v~v~~~~~~~~~i~ArK  345 (353)
T 4a6d_A          273 CKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGFRDFQFKKTGAIYDAILARK  345 (353)
T ss_dssp             CCTTCEEEEEECCCCTTSCCCHHHHHHHHHHHHSSSCCCCCHHHHHHHHHHHTCEEEEEECCSSSCEEEEEEC
T ss_pred             CCCCCEEEEEEeeeCCCCCCCHHHHHHHHHHHHhCCCcCCCHHHHHHHHHHCCCceEEEEEcCCceEEEEEEe
Confidence            99999     1        123457899999999999999999999999999999999999999999999987
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A Back     alignment and structure
>2uyo_A Hypothetical protein ML2640; putative methyltransferase, transferas; 1.7A {Mycobacterium leprae} SCOP: c.66.1.57 PDB: 2ckd_A 2uyq_A* Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>3iei_A Leucine carboxyl methyltransferase 1; LCMT-1, S-adenosyl-L-methionine; HET: SAH MES; 1.90A {Homo sapiens} PDB: 3p71_T* 3mnt_A* 3o7w_A* Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 132
d1fp2a2244 c.66.1.12 (A:109-352) Isoflavone O-methyltransfera 4e-23
d1fp1d2244 c.66.1.12 (D:129-372) Chalcone O-methyltransferase 5e-23
d1kyza2243 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferuli 2e-17
d1qzza2256 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase 7e-09
d1tw3a2253 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransf 1e-07
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Plant O-methyltransferase, C-terminal domain
domain: Isoflavone O-methyltransferase
species: Alfalfa (Medicago sativa) [TaxId: 3879]

 Score = 88.3 bits (218), Expect = 4e-23
 Identities = 57/153 (37%), Positives = 81/153 (52%), Gaps = 23/153 (15%)

Query: 1   MARAIATAFPDIKCIV--LICLLWWIIWWGTNNLEFFLEFEAIPPANVVLLKWILHDWSD 58
            A+ I   FP +KCIV     ++  +             F +IP A+ VLLK+ILH+W+D
Sbjct: 94  TAKIICETFPKLKCIVFDRPQVVENLSGSNNLTYVGGDMFTSIPNADAVLLKYILHNWTD 153

Query: 59  EESLRYLKKKCEESIPSNDEGRK-------------------TQLCFDLLMATFLNGKEG 99
           ++ LR LKK C+E++ ++ +  K                    +L  D+ MA   NGKE 
Sbjct: 154 KDCLRILKK-CKEAVTNDGKRGKVTIIDMVIDKKKDENQVTQIKLLMDVNMACL-NGKER 211

Query: 100 SVYDWKKLFLAAGFSHYKITPNLGLWSLIEAYP 132
           +  +WKKLF+ AGF HYKI+P  G  SLIE YP
Sbjct: 212 NEEEWKKLFIEAGFQHYKISPLTGFLSLIEIYP 244
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 243 Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Length = 256 Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Length = 253 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 100.0
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 100.0
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 100.0
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.97
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.94
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.24
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.2
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.11
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 98.93
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 98.92
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 98.76
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 98.71
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 98.64
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 98.5
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 98.48
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 98.46
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 98.4
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 98.3
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 98.29
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 98.18
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 98.0
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 98.0
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 97.83
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 97.77
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 97.53
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 97.5
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 97.37
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 97.34
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 97.22
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 97.08
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 97.07
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 97.04
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 97.02
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 96.85
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 96.81
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 96.56
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 96.47
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 95.93
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 95.9
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 95.85
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 95.82
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 95.59
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 95.1
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 94.71
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 94.48
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 94.47
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 94.38
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 94.38
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 94.05
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 93.96
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 93.5
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 93.28
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 93.22
d2uyoa1297 Putative methyltransferase ML2640 {Mycobacterium l 93.15
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 93.09
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 92.78
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 92.37
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 92.25
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 91.74
d2h00a1250 Methyltransferase 10 domain containing protein MET 89.82
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 89.42
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 88.47
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 87.52
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 86.06
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 84.56
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 83.39
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 82.67
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 81.84
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 81.76
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Plant O-methyltransferase, C-terminal domain
domain: Isoflavone O-methyltransferase
species: Alfalfa (Medicago sativa) [TaxId: 3879]

Probab=100.00  E-value=4.6e-38  Score=232.41  Aligned_cols=129  Identities=47%  Similarity=0.827  Sum_probs=117.9

Q ss_pred             HHHHHHHCCCCeEEEeechhHHhhhcCCCCeEEEe--ccccCCCceEEEehhhhcCCChHHHHHHHHHHhhhhCCCCC--
Q 043665            2 ARAIATAFPDIKCIVLICLLWWIIWWGTNNLEFFL--EFEAIPPANVVLLKWILHDWSDEESLRYLKKKCEESIPSND--   77 (132)
Q Consensus         2 ~~~l~~~~P~l~~~v~Dlp~v~~~a~~~~ri~~~~--~~~~~P~~D~~ll~~vlh~~~de~~~~iL~~~~~~al~~~g--   77 (132)
                      +++++++||+++++++|+|+|++.+...+||++++  ||+++|++|+|++++|||||+|++|++||+ ++++||+|||  
T Consensus        95 ~~~l~~~~P~l~~~v~Dlp~vi~~~~~~~rv~~~~gD~f~~~p~aD~~~l~~vLHdw~d~~~~~iL~-~~~~al~pgg~~  173 (244)
T d1fp2a2          95 AKIICETFPKLKCIVFDRPQVVENLSGSNNLTYVGGDMFTSIPNADAVLLKYILHNWTDKDCLRILK-KCKEAVTNDGKR  173 (244)
T ss_dssp             HHHHHHHCTTCEEEEEECHHHHTTCCCBTTEEEEECCTTTCCCCCSEEEEESCGGGSCHHHHHHHHH-HHHHHHSGGGCC
T ss_pred             HHHHHHhCCCCeEEEecCHHHHHhCcccCceEEEecCcccCCCCCcEEEEEeecccCChHHHHHHHH-HHHHHcCcccCC
Confidence            67899999999999999999999998899999999  999999999999999999999999999999 9999999984  


Q ss_pred             ----------CC---C----cchhhhhhhhhhcCCCccCCHHHHHHHHHhCCCeeeEEEecCCcceEEEEEC
Q 043665           78 ----------EG---R----KTQLCFDLLMATFLNGKEGSVYDWKKLFLAAGFSHYKITPNLGLWSLIEAYP  132 (132)
Q Consensus        78 ----------~~---~----~~~~~~dl~m~~~~~g~~rt~~e~~~ll~~aGf~~~~~~~~~~~~~~ie~~p  132 (132)
                                +.   .    .....+|++|++ .||++||.+||++||++|||+.++++|+++..||||++|
T Consensus       174 ~~lli~e~~~~~~~~~~~~~~~~~~~dl~m~~-~~G~ert~~e~~~ll~~AGf~~~~i~~~~~~~svIE~~p  244 (244)
T d1fp2a2         174 GKVTIIDMVIDKKKDENQVTQIKLLMDVNMAC-LNGKERNEEEWKKLFIEAGFQHYKISPLTGFLSLIEIYP  244 (244)
T ss_dssp             CEEEEEECEECTTTSCHHHHHHHHHHHHHGGG-GTCCCEEHHHHHHHHHHTTCCEEEEEEEETTEEEEEEEC
T ss_pred             cEEEEEEeecCCCCCCchHHHHHHHHHHHHHh-CCCcCCCHHHHHHHHHHcCCceEEEEECCCCeEEEEEeC
Confidence                      11   1    123467888876 699999999999999999999999999999999999998
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2uyoa1 c.66.1.57 (A:14-310) Putative methyltransferase ML2640 {Mycobacterium leprae [TaxId: 1769]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure