Citrus Sinensis ID: 043685

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620
MGSPTLNTTNATTNVSSKISPCAWYGISCNDAGRVINISLRNTGLSGTLRDLSFSSFPQLEYLDLSLNGLFGTIPSQIGNLSKLSYISLDSNQLFGKIPLELSSIEELFLYSNHLNESFPPFLGNLSNIVRLYINNNSLSSSIPTNIGNLKFLFELDLSNNQLGGSIPLSFGNLSNLARLCLYKNLLIGSIPSSLGNLKLIDLKLSSNQLTGYIPYSLGNVTSLSSLLLAKNKLYGSLPPFVDLSINQFRGFLPPFVGNLTNLERLGLMDNHLSGSIPPSLGNSTLTWLTFSLNHFTGYLPHDICRGGALEIFIVDEYRFQGTIPTSLRNCTSLIRVRLDGNNLTGNISEALGIYPNLTFIDLSRNNFYGEISSNWGKCPKLGTLNVSMNNITGGIPREIGNSSQLQALDLSLNQIVGDIPKELGKSNSLTKLILRGNQLTGRLPTEIGSLIKLEYLDFSANRFNNSVPEILGNLLKLHYLGLSNNQFVQELPKELEKLVQLSLLDASHNLFGGEIPFQICSLKSLEMLNLSHNNLSGSIPNCFDGMHGLSVIDISDNQLQGPVPNSTAFRNAPVEALEGNKGLCGGVKGMQPCKVYSTHKQNSGAKWFAIVFPVLGALF
ccccccccccccccccccccccEEEEEEEcccccEEEEEccccccEEEEccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccHHHHccccccEEEEcccccccccccccccccccEEEccccccEEcccccccccccccccccccccccccccccccccccEEEEEccccccccccccEEcccccccccccccccccccccEEEccccccEEcccccccccccccEEEccccEEcccccccccccccccEEEccccEEEEEccccccccccccEEEccccEEEEcccHHHHccccccEEEcccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccHHHHccccccccccccccccccccHHHHccccccEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEEccccccccccccccccccccHHHHccccccccccccccccccccccccccccEEEEEEEEEEEccc
ccccccccccccccccccccccccEEEEEcccccEEEEEcccccccccccHHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccccccccccEEEEccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccEEEEEEccccccccccHHHcccccccEEEEcccccccccccccccccccccccccHHHccccccEEEEcccccccccccHHHcccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEEcEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccEEEEcccccccccccHHHHcccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEEccccccccccccccHccccHHHHcccccccccccccccccccccccccccccEEEEEHHHHHHHc
mgsptlnttnattnvsskispcawygiscndaGRVINISlrntglsgtlrdlsfssfpqleyldlslnglfgtipsqignlSKLSYISldsnqlfgkiplelSSIEELFLYSnhlnesfppflgnLSNIVRLYInnnslsssiptnignlKFLFELDlsnnqlggsiplsfgnlsNLARLCLYKNLLigsipsslgnlklIDLKlssnqltgyipyslgNVTSLSSLLLAKNklygslppfvdlsinqfrgflppfvgnltnlerlglmdnhlsgsippslgnstLTWLTFSLNhftgylphdicrggalEIFIVdeyrfqgtiptslrncTSLIRVRldgnnltgnisealgiypnltfidlsrnnfygeissnwgkcpklgtlnvsmnnitggipreignssqLQALDLSLNqivgdipkelgksnslTKLILRgnqltgrlpteIGSLIKleyldfsanrfnnsVPEILGNLLKLHYLGLSNNQFVQELPKELEKLVQLSLLdashnlfggeipfQICSLKSLEMLNLShnnlsgsipncfdgmhglsvidisdnqlqgpvpnstafrnapvealegnkglcggvkgmqpckvysthkqnsgakWFAIVFPVLGALF
mgsptlnttnattnvsskisPCAWYGISCNDAGRVINISLRNTGLSGTLRDLSFSSFPQLEYLDLSLNGLFGTIPSQIGNLSKLSYISLDSNQLFGKIPLELSSIEELFLYSNHLNESFPPFLGNLSNIVRLYINNNSLSSSIPTNIGNLKFLFELDLSNNQLGGSIPLSFGNLSNLARLCLYKNLLIGSIPSSLGNLKLIDLKLSSNQLTGYIPYSLGNVTSLSSLLLAKNKLYGSLPPFVDLSINQFRGFLPPFVGNLTNLERLGLMDNHLSGSIPPSLGNSTLTWLTFSLNHFTGYLPHDICRGGALEIFIVDEYRfqgtiptslrnctSLIRVRLDGNNLTGNISEALGIYPNLTFIDLSRNNFYGEISSNWGKCPKLGTLNVSMNNITGGIPREIGNSSQLQALDLSLNQIVGDIPkelgksnslTKLIlrgnqltgrlPTEIGSLIKLEYLDFSANRFNNSVPEILGNLLKLHYLGLSNNQFVQELPKELEKLVQLSLLDASHNLFGGEIPFQICSLKSLEMLNLSHNNLSGSIPNCFDGMHGLSVIDISDNQLQGPVPNSTAFRNAPVEALEGNKGLCGGVKGMQPCKVYSthkqnsgakwFAIVFPVLGALF
MGSPTLNTTNATTNVSSKISPCAWYGISCNDAGRVINISLRNTGLSGTLRDLSFSSFPQLEYLDLSLNGLFGTIPSQIGNLSKLSYISLDSNQLFGKIPLELSSIEELFLYSNHLNESFPPFLGNLSNIVRLYinnnslsssiptniGNLKFLFELDLSNNQLGGSIPLSFGNLSNLARLCLYKNLLIGSIPSSLGNLKLIDLKLSSNQLTGYIPYSLGNVTslsslllAKNKLYGSLPPFVDLSINQFRGFLPPFVGNLTNLERLGLMDNHLSGSIPPSLGNSTLTWLTFSLNHFTGYLPHDICRGGALEIFIVDEYRFQGTIPTSLRNCTSLIRVRLDGNNLTGNISEALGIYPNLTFIDLSRNNFYGEISSNWGKCPKLGTLNVSMNNITGGIPREIGNSSQLQALDLSLNQIVGDIPKELGKSNSLTKLILRGNQLTGRLPTEIGSLIKLEYLDFSANRFNNSVPEIlgnllklhylglsnnQFVQELPKELEKLVQLSLLDASHNLFGGEIPFQICSLKSLEMLNLSHNNLSGSIPNCFDGMHGLSVIDISDNQLQGPVPNSTAFRNAPVEALEGNKGLCGGVKGMQPCKVYSTHKQNSGAKWFAIVFPVLGALF
*******************SPCAWYGISCNDAGRVINISLRNTGLSGTLRDLSFSSFPQLEYLDLSLNGLFGTIPSQIGNLSKLSYISLDSNQLFGKIPLELSSIEELFLYSNHLNESFPPFLGNLSNIVRLYINNNSLSSSIPTNIGNLKFLFELDLSNNQLGGSIPLSFGNLSNLARLCLYKNLLIGSIPSSLGNLKLIDLKLSSNQLTGYIPYSLGNVTSLSSLLLAKNKLYGSLPPFVDLSINQFRGFLPPFVGNLTNLERLGLMDNHLSGSIPPSLGNSTLTWLTFSLNHFTGYLPHDICRGGALEIFIVDEYRFQGTIPTSLRNCTSLIRVRLDGNNLTGNISEALGIYPNLTFIDLSRNNFYGEISSNWGKCPKLGTLNVSMNNITGGIPREIGNSSQLQALDLSLNQIVGDIPKELGKSNSLTKLILRGNQLTGRLPTEIGSLIKLEYLDFSANRFNNSVPEILGNLLKLHYLGLSNNQFVQELPKELEKLVQLSLLDASHNLFGGEIPFQICSLKSLEMLNLSHNNLSGSIPNCFDGMHGLSVIDISDNQL*********FRNAPVEALEGNKGLCGGVKGMQPCKVYSTHKQNSGAKWFAIVFPVLGA**
**S*T*NTT*ATTNVSSKISPCAWYGISCNDAGRVINISLRNTGLSGTLRDLSFSSFPQLEYLDLSLNGLFGTIPSQIGNLSKLSYISLDSNQLFGKIPLELSSIEELFLYSNHLNESFPPFLGNLSNIVRLYINNNSLSSSIPTNIGNLKFLFELDLSNNQLGGSIPLSFGNLSNLARLCLYKNLLIGSIPSSLGNLKLIDLKLSSNQLTGYIPYSLGNVTSLSSLLLAKNKLYGSLPPFVDLSINQFRGFLPPFVGNLTNLERLGLMDNHLSGSIPPSLGNSTLTWLTFSLNHFTGYLPHDICRGGALEIFIVDEYRFQGTIPTSLRNCTSLIRVRLDGNNLTGNISEALGIYPNLTFIDLSRNNFYGEISSNWGKCPKLGTLNVSMNNITGGIPREIGNSSQLQALDLSLNQIVGDIPKELGKSNSLTKLILRGNQLTGRLPTEIGSLIKLEYLDFSANRFNNSVPEILGNLLKLHYLGLSNNQFVQELPKELEKLVQLSLLDASHNLFGGEIPFQICSLKSLEMLNLSHNNLSGSIPNCFDGMHGLSVIDISDNQLQGPVPNSTAFRNAPVEALEGNKGLCGGV*********************AIVFPVLGALF
*************NVSSKISPCAWYGISCNDAGRVINISLRNTGLSGTLRDLSFSSFPQLEYLDLSLNGLFGTIPSQIGNLSKLSYISLDSNQLFGKIPLELSSIEELFLYSNHLNESFPPFLGNLSNIVRLYINNNSLSSSIPTNIGNLKFLFELDLSNNQLGGSIPLSFGNLSNLARLCLYKNLLIGSIPSSLGNLKLIDLKLSSNQLTGYIPYSLGNVTSLSSLLLAKNKLYGSLPPFVDLSINQFRGFLPPFVGNLTNLERLGLMDNHLSGSIPPSLGNSTLTWLTFSLNHFTGYLPHDICRGGALEIFIVDEYRFQGTIPTSLRNCTSLIRVRLDGNNLTGNISEALGIYPNLTFIDLSRNNFYGEISSNWGKCPKLGTLNVSMNNITGGIPREIGNSSQLQALDLSLNQIVGDIPKELGKSNSLTKLILRGNQLTGRLPTEIGSLIKLEYLDFSANRFNNSVPEILGNLLKLHYLGLSNNQFVQELPKELEKLVQLSLLDASHNLFGGEIPFQICSLKSLEMLNLSHNNLSGSIPNCFDGMHGLSVIDISDNQLQGPVPNSTAFRNAPVEALEGNKGLCGGVKGMQPCKVYSTHKQNSGAKWFAIVFPVLGALF
*************N**SKISPCAWYGISCNDAGRVINISLRNTGLSGTLRDLSFSSFPQLEYLDLSLNGLFGTIPSQIGNLSKLSYISLDSNQLFGKIPLELSSIEELFLYSNHLNESFPPFLGNLSNIVRLYINNNSLSSSIPTNIGNLKFLFELDLSNNQLGGSIPLSFGNLSNLARLCLYKNLLIGSIPSSLGNLKLIDLKLSSNQLTGYIPYSLGNVTSLSSLLLAKNKLYGSLPPFVDLSINQFRGFLPPFVGNLTNLERLGLMDNHLSGSIPPSLGNSTLTWLTFSLNHFTGYLPHDICRGGALEIFIVDEYRFQGTIPTSLRNCTSLIRVRLDGNNLTGNISEALGIYPNLTFIDLSRNNFYGEISSNWGKCPKLGTLNVSMNNITGGIPREIGNSSQLQALDLSLNQIVGDIPKELGKSNSLTKLILRGNQLTGRLPTEIGSLIKLEYLDFSANRFNNSVPEILGNLLKLHYLGLSNNQFVQELPKELEKLVQLSLLDASHNLFGGEIPFQICSLKSLEMLNLSHNNLSGSIPNCFDGMHGLSVIDISDNQLQGPVPNSTAFRNAPVEALEGNKGLCGGVKGMQPCKVYSTHKQNSGAKWFAIVFPVLGALF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSPTLNTTNATTNVSSKISPCAWYGISCNDAGRVINISLRNTGLSGTLRDLSFSSFPQLEYLDLSLNGLFGTIPSQIGNLSKLSYISLDSNQLFGKIPLELSSIEELFLYSNHLNESFPPFLGNLSNIVRLYINNNSLSSSIPTNIGNLKFLFELDLSNNQLGGSIPLSFGNLSNLARLCLYKNLLIGSIPSSLGNLKLIDLKLSSNQLTGYIPYSLGNVTSLSSLLLAKNKLYGSLPPFVDLSINQFRGFLPPFVGNLTNLERLGLMDNHLSGSIPPSLGNSTLTWLTFSLNHFTGYLPHDICRGGALEIFIVDEYRFQGTIPTSLRNCTSLIRVRLDGNNLTGNISEALGIYPNLTFIDLSRNNFYGEISSNWGKCPKLGTLNVSMNNITGGIPREIGNSSQLQALDLSLNQIVGDIPKELGKSNSLTKLILRGNQLTGRLPTEIGSLIKLEYLDFSANRFNNSVPEILGNLLKLHYLGLSNNQFVQELPKELEKLVQLSLLDASHNLFGGEIPFQICSLKSLEMLNLSHNNLSGSIPNCFDGMHGLSVIDISDNQLQGPVPNSTAFRNAPVEALEGNKGLCGGVKGMQPCKVYSTHKQNSGAKWFAIVFPVLGALF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query620 2.2.26 [Sep-21-2011]
Q8VZG8 1045 Probable LRR receptor-lik yes no 0.991 0.588 0.456 1e-149
Q9LP24 1120 Probable leucine-rich rep no no 0.895 0.495 0.479 1e-130
Q9SHI2 1101 Leucine-rich repeat recep no no 0.967 0.544 0.341 1e-85
O49318 1124 Probable leucine-rich rep no no 0.914 0.504 0.342 4e-82
Q9LVP0 1102 Probable leucine-rich rep no no 0.906 0.509 0.349 4e-82
Q9LHP4 1141 Receptor-like protein kin no no 0.919 0.499 0.347 3e-81
C0LGV1 1135 LRR receptor-like serine/ no no 0.938 0.512 0.355 3e-81
Q9FL28 1173 LRR receptor-like serine/ no no 0.877 0.463 0.357 2e-80
C0LGR3 1091 Probable LRR receptor-lik no no 0.911 0.517 0.345 5e-76
Q9FZ59 1088 Leucine-rich repeat recep no no 0.927 0.528 0.336 9e-76
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function desciption
 Score =  529 bits (1363), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 303/664 (45%), Positives = 413/664 (62%), Gaps = 49/664 (7%)

Query: 5   TLNTTNATTNVSSKISP------CAWYGISCNDAGRVINISLRNTGLSGTLRDLSFSSFP 58
           T     +++ +SS ++P       +WYG++C+  G +I ++L NTG+ GT  D  FSS P
Sbjct: 60  TFTNQTSSSKLSSWVNPNTSSFCTSWYGVACS-LGSIIRLNLTNTGIEGTFEDFPFSSLP 118

Query: 59  ------------------------QLEYLDLSLNGLFGTIPSQIGNLSKLSYISLDSNQL 94
                                   +LEY DLS+N L G IP ++G+LS L  + L  N+L
Sbjct: 119 NLTFVDLSMNRFSGTISPLWGRFSKLEYFDLSINQLVGEIPPELGDLSNLDTLHLVENKL 178

Query: 95  FGKIPLE---LSSIEELFLYSNHLNESFPPFLGNLSNIVRLYINNNSLSSSIPTNIGNLK 151
            G IP E   L+ + E+ +Y N L    P   GNL+ +V LY+  NSLS SIP+ IGNL 
Sbjct: 179 NGSIPSEIGRLTKVTEIAIYDNLLTGPIPSSFGNLTKLVNLYLFINSLSGSIPSEIGNLP 238

Query: 152 FLFELDLSNNQLGGSIPLSFGNLSNLARLCLYKNLLIGSIPSSLGNLKLID-LKLSSNQL 210
            L EL L  N L G IP SFGNL N+  L +++N L G IP  +GN+  +D L L +N+L
Sbjct: 239 NLRELCLDRNNLTGKIPSSFGNLKNVTLLNMFENQLSGEIPPEIGNMTALDTLSLHTNKL 298

Query: 211 TGYIPYSLGNVTSLSSLLLAKNKLYGSLPP-------FVDLSI--NQFRGFLPPFVGNLT 261
           TG IP +LGN+ +L+ L L  N+L GS+PP        +DL I  N+  G +P   G LT
Sbjct: 299 TGPIPSTLGNIKTLAVLHLYLNQLNGSIPPELGEMESMIDLEISENKLTGPVPDSFGKLT 358

Query: 262 NLERLGLMDNHLSGSIPPSLGNST-LTWLTFSLNHFTGYLPHDICRGGALEIFIVDEYRF 320
            LE L L DN LSG IPP + NST LT L    N+FTG+LP  ICRGG LE   +D+  F
Sbjct: 359 ALEWLFLRDNQLSGPIPPGIANSTELTVLQLDTNNFTGFLPDTICRGGKLENLTLDDNHF 418

Query: 321 QGTIPTSLRNCTSLIRVRLDGNNLTGNISEALGIYPNLTFIDLSRNNFYGEISSNWGKCP 380
           +G +P SLR+C SLIRVR  GN+ +G+ISEA G+YP L FIDLS NNF+G++S+NW +  
Sbjct: 419 EGPVPKSLRDCKSLIRVRFKGNSFSGDISEAFGVYPTLNFIDLSNNNFHGQLSANWEQSQ 478

Query: 381 KLGTLNVSMNNITGGIPREIGNSSQLQALDLSLNQIVGDIPKELGKSNSLTKLILRGNQL 440
           KL    +S N+ITG IP EI N +QL  LDLS N+I G++P+ +   N ++KL L GN+L
Sbjct: 479 KLVAFILSNNSITGAIPPEIWNMTQLSQLDLSSNRITGELPESISNINRISKLQLNGNRL 538

Query: 441 TGRLPTEIGSLIKLEYLDFSANRFNNSVPEILGNLLKLHYLGLSNNQFVQELPKELEKLV 500
           +G++P+ I  L  LEYLD S+NRF++ +P  L NL +L+Y+ LS N   Q +P+ L KL 
Sbjct: 539 SGKIPSGIRLLTNLEYLDLSSNRFSSEIPPTLNNLPRLYYMNLSRNDLDQTIPEGLTKLS 598

Query: 501 QLSLLDASHNLFGGEIPFQICSLKSLEMLNLSHNNLSGSIPNCFDGMHGLSVIDISDNQL 560
           QL +LD S+N   GEI  Q  SL++LE L+LSHNNLSG IP  F  M  L+ +D+S N L
Sbjct: 599 QLQMLDLSYNQLDGEISSQFRSLQNLERLDLSHNNLSGQIPPSFKDMLALTHVDVSHNNL 658

Query: 561 QGPVPNSTAFRNAPVEALEGNKGLCGGV---KGMQPCKVYSTHKQNSGAKWFA-IVFPVL 616
           QGP+P++ AFRNAP +A EGNK LCG V   +G++PC + S+ K +        I+ P++
Sbjct: 659 QGPIPDNAAFRNAPPDAFEGNKDLCGSVNTTQGLKPCSITSSKKSHKDRNLIIYILVPII 718

Query: 617 GALF 620
           GA+ 
Sbjct: 719 GAII 722

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGR3|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=1 SV=1 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query620
225456161 1037 PREDICTED: probable LRR receptor-like se 0.988 0.591 0.505 1e-160
225456159 1038 PREDICTED: probable LRR receptor-like se 0.988 0.590 0.505 1e-160
359491512 1078 PREDICTED: probable LRR receptor-like se 0.988 0.568 0.515 1e-159
255545702 1008 receptor protein kinase, putative [Ricin 0.980 0.603 0.506 1e-157
359491509 1032 PREDICTED: probable LRR receptor-like se 0.987 0.593 0.516 1e-155
147767326 1032 hypothetical protein VITISV_008862 [Viti 0.987 0.593 0.516 1e-154
297846642 1007 hypothetical protein ARALYDRAFT_891227 [ 0.979 0.602 0.473 1e-147
186511602 1045 Leucine-rich repeat-containing protein [ 0.991 0.588 0.456 1e-147
7267528 1027 receptor protein kinase-like protein [Ar 0.991 0.598 0.456 1e-147
186511604 1009 Leucine-rich repeat-containing protein [ 0.990 0.608 0.457 1e-147
>gi|225456161|ref|XP_002278590.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  572 bits (1474), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 331/655 (50%), Positives = 408/655 (62%), Gaps = 42/655 (6%)

Query: 7   NTTNATTNVSSKISPCAWYGISCNDAGRVINISLRNTGLSGTLRDLSFSSFPQLEYLDLS 66
           N TN++T++ +++SPC WYGISCN AG VI I+L  +GL GTL+  SFSSFP L Y+D+S
Sbjct: 62  NFTNSSTHLGTEVSPCKWYGISCNHAGSVIRINLTESGLGGTLQAFSFSSFPNLAYVDIS 121

Query: 67  LNGLFGTIPSQIGNLSKLSYISLDSNQLFGKIPLE------------------------- 101
           +N L G IP QIG LSKL Y+ L  NQ  G IP E                         
Sbjct: 122 MNNLSGPIPPQIGLLSKLKYLDLSINQFSGGIPPEIGLLTNLEVLHLVQNQLNGSIPHEI 181

Query: 102 --LSSIEELFLYSNHLNESFPPFLGNLSNIVRLYINNNSLSSSIPTNIGNLKFLFELDLS 159
             L+S+ EL LY+N L  S P  LGNLSN+  LY+  N LS SIP  +GNL  L +L   
Sbjct: 182 GQLTSLYELALYTNQLEGSIPASLGNLSNLASLYLYENQLSGSIPPEMGNLTNLVQLYSD 241

Query: 160 NNQLGGSIPLSFGNLSNLARLCLYKNLLIGSIPSSLGNLK-LIDLKLSSNQLTGYIPYSL 218
            N L G IP +FGNL +L  L L+ N L G IP  +GNLK L  L L  N L+G IP SL
Sbjct: 242 TNNLTGPIPSTFGNLKHLTVLYLFNNSLSGPIPPEIGNLKSLQGLSLYGNNLSGPIPVSL 301

Query: 219 GNVTSLSSLLLAKNKLYGSLPPFV---------DLSINQFRGFLPPFVGNLTNLERLGLM 269
            +++ L+ L L  N+L G +P  +         +LS NQ  G +P  +GNLTNLE L L 
Sbjct: 302 CDLSGLTLLHLYANQLSGPIPQEIGNLKSLVDLELSENQLNGSIPTSLGNLTNLEILFLR 361

Query: 270 DNHLSGSIPPSLGN-STLTWLTFSLNHFTGYLPHDICRGGALEIFIVDEYRFQGTIPTSL 328
           DN LSG  P  +G    L  L    N   G LP  IC+GG+LE F V +    G IP SL
Sbjct: 362 DNRLSGYFPQEIGKLHKLVVLEIDTNQLFGSLPEGICQGGSLERFTVSDNHLSGPIPKSL 421

Query: 329 RNCTSLIRVRLDGNNLTGNISEALGIYPNLTFIDLSRNNFYGEISSNWGKCPKLGTLNVS 388
           +NC +L R    GN LTGN+SE +G  PNL FIDLS N F+GE+S NWG+CP+L  L ++
Sbjct: 422 KNCRNLTRALFQGNRLTGNVSEVVGDCPNLEFIDLSYNRFHGELSHNWGRCPQLQRLEIA 481

Query: 389 MNNITGGIPREIGNSSQLQALDLSLNQIVGDIPKELGKSNSLTKLILRGNQLTGRLPTEI 448
            NNITG IP + G S+ L  LDLS N +VG+IPK++G   SL  LIL  NQL+G +P E+
Sbjct: 482 GNNITGSIPEDFGISTNLILLDLSSNHLVGEIPKKMGSLTSLLGLILNDNQLSGSIPPEL 541

Query: 449 GSLIKLEYLDFSANRFNNSVPEILGNLLKLHYLGLSNNQFVQELPKELEKLVQLSLLDAS 508
           GSL  LEYLD SANR N S+PE LG+ L LHYL LSNN+    +P ++ KL  LS LD S
Sbjct: 542 GSLSHLEYLDLSANRLNGSIPEHLGDCLDLHYLNLSNNKLSHGIPVQMGKLSHLSQLDLS 601

Query: 509 HNLFGGEIPFQICSLKSLEMLNLSHNNLSGSIPNCFDGMHGLSVIDISDNQLQGPVPNST 568
           HNL  G IP QI  L+SLEML+LSHNNL G IP  F+ M  LS +DIS NQLQGP+P+S 
Sbjct: 602 HNLLTGGIPAQIQGLESLEMLDLSHNNLCGFIPKAFEDMPALSYVDISYNQLQGPIPHSN 661

Query: 569 AFRNAPVEALEGNKGLCGGVKGMQPCK----VYSTHKQNSGAKWFAIVFPVLGAL 619
           AFRNA +E L+GNK LCG VKG+QPCK    V     + S    F I+FP+LGAL
Sbjct: 662 AFRNATIEVLKGNKDLCGNVKGLQPCKYGFGVDQQPVKKSHKVVFIIIFPLLGAL 716

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225456159|ref|XP_002278561.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491512|ref|XP_002278614.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255545702|ref|XP_002513911.1| receptor protein kinase, putative [Ricinus communis] gi|223546997|gb|EEF48494.1| receptor protein kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359491509|ref|XP_002278522.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147767326|emb|CAN68996.1| hypothetical protein VITISV_008862 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297846642|ref|XP_002891202.1| hypothetical protein ARALYDRAFT_891227 [Arabidopsis lyrata subsp. lyrata] gi|297337044|gb|EFH67461.1| hypothetical protein ARALYDRAFT_891227 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|186511602|ref|NP_849538.2| Leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|281185491|sp|Q8VZG8.3|Y4885_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein kinase At4g08850; Flags: Precursor gi|18086327|gb|AAL57627.1| AT4g08850/T32A17_160 [Arabidopsis thaliana] gi|224589610|gb|ACN59338.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gi|332657282|gb|AEE82682.1| Leucine-rich repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|7267528|emb|CAB78010.1| receptor protein kinase-like protein [Arabidopsis thaliana] gi|7321074|emb|CAB82121.1| receptor protein kinase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|186511604|ref|NP_192625.4| Leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|222423559|dbj|BAH19749.1| AT4G08850 [Arabidopsis thaliana] gi|332657283|gb|AEE82683.1| Leucine-rich repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query620
TAIR|locus:2138268 1045 AT4G08850 [Arabidopsis thalian 0.937 0.555 0.448 1.8e-126
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.893 0.494 0.454 1.4e-119
TAIR|locus:2046525 1124 AT2G33170 [Arabidopsis thalian 0.903 0.498 0.336 7.5e-76
TAIR|locus:2160791 1102 AT5G63930 [Arabidopsis thalian 0.880 0.495 0.343 1e-74
TAIR|locus:2020417 1101 AT1G17230 [Arabidopsis thalian 0.904 0.509 0.344 3.7e-74
TAIR|locus:2825384 847 RLP12 "AT1G71400" [Arabidopsis 0.832 0.609 0.318 1.2e-73
TAIR|locus:2085949 1141 AT3G24240 [Arabidopsis thalian 0.843 0.458 0.345 3.3e-73
TAIR|locus:2154344 1135 AT5G48940 [Arabidopsis thalian 0.858 0.468 0.351 6.7e-73
TAIR|locus:4515102753598 AT1G73066 [Arabidopsis thalian 0.861 0.892 0.336 1.4e-71
TAIR|locus:2032697 1123 PEPR1 "PEP1 receptor 1" [Arabi 0.883 0.487 0.324 7.6e-71
TAIR|locus:2138268 AT4G08850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1242 (442.3 bits), Expect = 1.8e-126, P = 1.8e-126
 Identities = 269/600 (44%), Positives = 361/600 (60%)

Query:    38 ISLRNTGLSGTLRDLSFSSFPQLEYLDLSLNGLFGTIPSQIGNLSKLSYISLDSNQLFGK 97
             + L     SGT+  L +  F +LEY DLS+N L G IP ++G+LS L  + L  N+L G 
Sbjct:   123 VDLSMNRFSGTISPL-WGRFSKLEYFDLSINQLVGEIPPELGDLSNLDTLHLVENKLNGS 181

Query:    98 IPLE---LSSIEELFLYSNHLNESFPPFLGNLSNIVRLYXXXXXXXXXXXXXXGNLKFLF 154
             IP E   L+ + E+ +Y N L    P   GNL+ +V LY              GNL  L 
Sbjct:   182 IPSEIGRLTKVTEIAIYDNLLTGPIPSSFGNLTKLVNLYLFINSLSGSIPSEIGNLPNLR 241

Query:   155 ELDLSNNQLGGSIPLSFGNLSNLARLCLYKNLLIGSIPSSLGNLKLID-LKLSSNQLTGY 213
             EL L  N L G IP SFGNL N+  L +++N L G IP  +GN+  +D L L +N+LTG 
Sbjct:   242 ELCLDRNNLTGKIPSSFGNLKNVTLLNMFENQLSGEIPPEIGNMTALDTLSLHTNKLTGP 301

Query:   214 IPYSLGNVTXXXXXXXAKNKLYGSLPP-------FVDLSI--NQFRGFLPPFVGNLTNLE 264
             IP +LGN+          N+L GS+PP        +DL I  N+  G +P   G LT LE
Sbjct:   302 IPSTLGNIKTLAVLHLYLNQLNGSIPPELGEMESMIDLEISENKLTGPVPDSFGKLTALE 361

Query:   265 RLGLMDNHLSGSIPPSLGNST-LTWLTFSLNHFTGYLPHDICRGGALEIFIVDEYRFQGT 323
              L L DN LSG IPP + NST LT L    N+FTG+LP  ICRGG LE   +D+  F+G 
Sbjct:   362 WLFLRDNQLSGPIPPGIANSTELTVLQLDTNNFTGFLPDTICRGGKLENLTLDDNHFEGP 421

Query:   324 IPTSLRNCTSLIRVRLDGNNLTGNISEALGIYPNLTFIDLSRNNFYGEISSNWGKCPKLG 383
             +P SLR+C SLIRVR  GN+ +G+ISEA G+YP L FIDLS NNF+G++S+NW +  KL 
Sbjct:   422 VPKSLRDCKSLIRVRFKGNSFSGDISEAFGVYPTLNFIDLSNNNFHGQLSANWEQSQKLV 481

Query:   384 TLNVSMNNITGGIPREIGNSSQLQALDLSLNQIVGDIPKELGKSNSLTKLILRGNQLTGR 443
                +S N+ITG IP EI N +QL  LDLS N+I G++P+ +   N ++KL L GN+L+G+
Sbjct:   482 AFILSNNSITGAIPPEIWNMTQLSQLDLSSNRITGELPESISNINRISKLQLNGNRLSGK 541

Query:   444 LPTEIGSLIKLEYLDFSANRFNNSVPEIXXXXXXXXXXXXXXXQFVQELPKELEKLVQLS 503
             +P+ I  L  LEYLD S+NRF++ +P                    Q +P+ L KL QL 
Sbjct:   542 IPSGIRLLTNLEYLDLSSNRFSSEIPPTLNNLPRLYYMNLSRNDLDQTIPEGLTKLSQLQ 601

Query:   504 LLDASHNLFGGEIPFQICSLKSLEMLNLSHNNLSGSIPNCFDGMHGLSVIDISDNQLQGP 563
             +LD S+N   GEI  Q  SL++LE L+LSHNNLSG IP  F  M  L+ +D+S N LQGP
Sbjct:   602 MLDLSYNQLDGEISSQFRSLQNLERLDLSHNNLSGQIPPSFKDMLALTHVDVSHNNLQGP 661

Query:   564 VPNSTAFRNAPVEALEGNKGLCGGV---KGMQPCKVYSTHKQNSGAKWFA-IVFPVLGAL 619
             +P++ AFRNAP +A EGNK LCG V   +G++PC + S+ K +        I+ P++GA+
Sbjct:   662 IPDNAAFRNAPPDAFEGNKDLCGSVNTTQGLKPCSITSSKKSHKDRNLIIYILVPIIGAI 721
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0016020 "membrane" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0006857 "oligopeptide transport" evidence=RCA
GO:0006995 "cellular response to nitrogen starvation" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0031347 "regulation of defense response" evidence=RCA
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046525 AT2G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160791 AT5G63930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020417 AT1G17230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154344 AT5G48940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4515102753 AT1G73066 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032697 PEPR1 "PEP1 receptor 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query620
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-90
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  299 bits (767), Expect = 3e-90
 Identities = 225/660 (34%), Positives = 301/660 (45%), Gaps = 122/660 (18%)

Query: 13  TNVSSKISPCAWYGISCNDAGRVINISLRNTGLSG------------------------- 47
           +N +S    C W GI+CN++ RV++I L    +SG                         
Sbjct: 49  SNWNSSADVCLWQGITCNNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGP 108

Query: 48  ----------TLRDLSFS-----------SFPQLEYLDLSLNGLFGTIPSQIGNLSKLSY 86
                     +LR L+ S           S P LE LDLS N L G IP+ IG+ S L  
Sbjct: 109 IPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKV 168

Query: 87  ISLDSNQLFGKIPL---ELSSIEELFLYSNHLNESFPPFLGNLSNIVRLYINNNSLSSSI 143
           + L  N L GKIP     L+S+E L L SN L    P  LG + ++  +Y+  N+LS  I
Sbjct: 169 LDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEI 228

Query: 144 PTNIGNLKFLFELDLSNNQLGGSIPLSFGNLSNLARLCLYKNLLIGSIPSSLGNL-KLID 202
           P  IG L  L  LDL  N L G IP S GNL NL  L LY+N L G IP S+ +L KLI 
Sbjct: 229 PYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLIS 288

Query: 203 LKLSSNQLTGYIPYSLGNVTSLSSLLLAKNKLYGSLPPFVDLSINQFRGFLPPFVGNLTN 262
           L LS N L+G IP  +  + +L  L L  N                F G +P  + +L  
Sbjct: 289 LDLSDNSLSGEIPELVIQLQNLEILHLFSNN---------------FTGKIPVALTSLPR 333

Query: 263 LERLGLMDNHLSGSIPPSLG-NSTLTWLTFSLNHFTGYLPHDICRGGALEIFIVDEYRFQ 321
           L+ L L  N  SG IP +LG ++ LT L  S N+ TG +P  +C  G L   I+     +
Sbjct: 334 LQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLE 393

Query: 322 GTIPTSLRNCTSLIRVRLDGNNLTGNISEALGIYPNLTFIDLSRNNFYGEISSNWGKCPK 381
           G IP SL  C SL RVRL  N+ +G +       P + F+D+S NN  G I+S     P 
Sbjct: 394 GEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPS 453

Query: 382 LGTLNVSMNNITGGIPREIGNSSQLQALDLSLNQIVGDIPKELGKSNSLTKLILRGNQLT 441
           L  L+++ N   GG+P   G S +L+ LDLS NQ  G +P++LG  + L +L L  N+L+
Sbjct: 454 LQMLSLARNKFFGGLPDSFG-SKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLS 512

Query: 442 GRLPTEIGSLIKLEYLDFSANRFNNSVPEILGNLLKLHYLGLSNNQFVQELPKELEKLVQ 501
           G +P E+ S                                              +KLV 
Sbjct: 513 GEIPDELSSC---------------------------------------------KKLVS 527

Query: 502 LSLLDASHNLFGGEIPFQICSLKSLEMLNLSHNNLSGSIPNCFDGMHGLSVIDISDNQLQ 561
           L L   SHN   G+IP     +  L  L+LS N LSG IP     +  L  ++IS N L 
Sbjct: 528 LDL---SHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLH 584

Query: 562 GPVPNSTAFRNAPVEALEGNKGLCGGVK--GMQPCKVYSTHKQNSGAKWFAIVFPVLGAL 619
           G +P++ AF      A+ GN  LCGG    G+ PCK            W+  +   LGA 
Sbjct: 585 GSLPSTGAFLAINASAVAGNIDLCGGDTTSGLPPCKRVRKTPS-----WWFYITCTLGAF 639

Length = 968
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 620
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
PLN032101153 Resistant to P. syringae 6; Provisional 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
KOG4237498 consensus Extracellular matrix protein slit, conta 99.9
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.79
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.75
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.73
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.69
KOG0617264 consensus Ras suppressor protein (contains leucine 99.67
PLN03150623 hypothetical protein; Provisional 99.25
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.21
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.19
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.18
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.15
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.15
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.13
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.13
PLN03150623 hypothetical protein; Provisional 99.12
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.12
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.11
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.09
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.07
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.02
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.92
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.92
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.9
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.87
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.82
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.78
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.76
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.57
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.41
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.37
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.36
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.33
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.2
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.14
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.04
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.98
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.96
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.8
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.77
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.73
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.69
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.68
PRK15386 426 type III secretion protein GogB; Provisional 97.63
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.6
PRK15386 426 type III secretion protein GogB; Provisional 97.56
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.47
KOG4341483 consensus F-box protein containing LRR [General fu 97.42
KOG4341483 consensus F-box protein containing LRR [General fu 97.25
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.11
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.09
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.07
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.53
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.22
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.04
KOG4308478 consensus LRR-containing protein [Function unknown 94.36
KOG4308478 consensus LRR-containing protein [Function unknown 93.99
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.89
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.62
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.68
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.62
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.38
smart0037026 LRR Leucine-rich repeats, outliers. 89.46
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.46
smart0037026 LRR Leucine-rich repeats, outliers. 87.74
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.74
KOG0473326 consensus Leucine-rich repeat protein [Function un 87.64
KOG0473 326 consensus Leucine-rich repeat protein [Function un 85.71
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 83.47
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.9e-66  Score=593.16  Aligned_cols=564  Identities=37%  Similarity=0.568  Sum_probs=526.4

Q ss_pred             CCCCCCCccccceeeCCCCCEEEEEcCCCCCccccCCCCCCCCCCCCEEECCCCCCCCcCCcccc-CCCCCCEEECCCCC
Q 043685           15 VSSKISPCAWYGISCNDAGRVINISLRNTGLSGTLRDLSFSSFPQLEYLDLSLNGLFGTIPSQIG-NLSKLSYISLDSNQ   93 (620)
Q Consensus        15 ~~~~~~~c~~~~~~~~~~~~l~~L~l~~~~~~~~~~~~~~~~~~~L~~L~Ls~~~i~~~~~~~l~-~l~~L~~L~L~~~~   93 (620)
                      -..+.+||.|.|+.|...++|++|+++++.+.+.+ +..|..+++|++|++++|.+.+.+|..+. .+++|++|++++|+
T Consensus        51 w~~~~~~c~w~gv~c~~~~~v~~L~L~~~~i~~~~-~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~  129 (968)
T PLN00113         51 WNSSADVCLWQGITCNNSSRVVSIDLSGKNISGKI-SSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNN  129 (968)
T ss_pred             CCCCCCCCcCcceecCCCCcEEEEEecCCCccccC-ChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCc
Confidence            33467899999999987789999999999999887 77899999999999999999888887654 99999999999999


Q ss_pred             CcccCCC-CCCCCcEEEccCCcCCCcCcccccCCCCCCEEEccCCcCCcccCccCCCCCCCCEEeCCCCCCcCCCCcccC
Q 043685           94 LFGKIPL-ELSSIEELFLYSNHLNESFPPFLGNLSNIVRLYINNNSLSSSIPTNIGNLKFLFELDLSNNQLGGSIPLSFG  172 (620)
Q Consensus        94 i~~~~~~-~l~~L~~L~ls~~~~~~~~~~~l~~l~~L~~L~Ls~n~~~~~~~~~~~~l~~L~~L~l~~~~l~~~~~~~l~  172 (620)
                      +.+.+|. .+++|++|++++|.+++..|..++++++|++|++++|.+.+..|..+.++++|++|++++|.+.+..|..+.
T Consensus       130 l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~  209 (968)
T PLN00113        130 FTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELG  209 (968)
T ss_pred             cccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHc
Confidence            9988775 679999999999999999999999999999999999999888999999999999999999999988999999


Q ss_pred             CCCCCcEEEcccccccccCCCCCCcee-ecEEEccCCccccccCCCCCCCCCCCEEEccCCcCCCCCCCccccccccccc
Q 043685          173 NLSNLARLCLYKNLLIGSIPSSLGNLK-LIDLKLSSNQLTGYIPYSLGNVTSLSSLLLAKNKLYGSLPPFVDLSINQFRG  251 (620)
Q Consensus       173 ~l~~L~~L~l~~n~~~~~~~~~l~~l~-L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~l~l~~~~l~~  251 (620)
                      ++++|++|++++|.+.+..|..+..+. |++|++++|.+.+..|..+..+++|+.|++++|.+               .+
T Consensus       210 ~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l---------------~~  274 (968)
T PLN00113        210 QMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKL---------------SG  274 (968)
T ss_pred             CcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCee---------------ec
Confidence            999999999999999999999999988 99999999999999999999999999999999987               45


Q ss_pred             cCCcccccCCCCCeeeccCCcCCCCCCCCCCC-CCcCeEEecCCcccccCCCCccCCCCccEEEecCccccccccccccc
Q 043685          252 FLPPFVGNLTNLERLGLMDNHLSGSIPPSLGN-STLTWLTFSLNHFTGYLPHDICRGGALEIFIVDEYRFQGTIPTSLRN  330 (620)
Q Consensus       252 ~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~-~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~  330 (620)
                      ..|..+..+++|++|++++|.+.+..|..+.. ++|+.|++++|.+.+..+..+..+++|+.|++++|.+.+..|..+..
T Consensus       275 ~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~  354 (968)
T PLN00113        275 PIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGK  354 (968)
T ss_pred             cCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhC
Confidence            67778889999999999999999888887776 89999999999999999999999999999999999999999999999


Q ss_pred             cCCCceeecCCCccccccCcccCCCCCCCEEECCCCcccCccCccccCCCCCcEEECCCCccccCCCccccCCCCCCEEe
Q 043685          331 CTSLIRVRLDGNNLTGNISEALGIYPNLTFIDLSRNNFYGEISSNWGKCPKLGTLNVSMNNITGGIPREIGNSSQLQALD  410 (620)
Q Consensus       331 l~~L~~L~l~~~~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~  410 (620)
                      +++|+.|++++|.+.+..+..+..+++|+.|++++|.+.+..|..+..+++|+.|++++|.+.+..|..+..++.|+.|+
T Consensus       355 ~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~  434 (968)
T PLN00113        355 HNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLD  434 (968)
T ss_pred             CCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEE
Confidence            99999999999999988888898999999999999999999999999999999999999999988898999999999999


Q ss_pred             cCCCeecccCChhhhccCCCcEEEccCCcccccCCccccCCCCCCEEEccCCcCCcchhhhhhCCCCCCEecCcCCcCcc
Q 043685          411 LSLNQIVGDIPKELGKSNSLTKLILRGNQLTGRLPTEIGSLIKLEYLDFSANRFNNSVPEILGNLLKLHYLGLSNNQFVQ  490 (620)
Q Consensus       411 l~~n~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~ls~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~  490 (620)
                      +++|.+++..+..+..+++|+.|++++|++.+.+|..+ ..++|+.|++++|++.+..|..+..+++|+.|++++|.+.+
T Consensus       435 Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~  513 (968)
T PLN00113        435 ISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSG  513 (968)
T ss_pred             CcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhhhhccCEEECcCCccee
Confidence            99999999888888899999999999999998887765 46899999999999999999999999999999999999999


Q ss_pred             cchhHhhhccCCCEEeCCCCcCccccchhccCCCCCCEEECCCCcCccccCccccCCCCCCEEEccCCcCccCCCCCccc
Q 043685          491 ELPKELEKLVQLSLLDASHNLFGGEIPFQICSLKSLEMLNLSHNNLSGSIPNCFDGMHGLSVIDISDNQLQGPVPNSTAF  570 (620)
Q Consensus       491 ~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~N~l~~~~~~~~~~  570 (620)
                      .+|..+..+++|+.|++++|.+++..|..+..+++|+.|++++|++++.+|..+..+++|+.+++++|++.+.+|....+
T Consensus       514 ~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~  593 (968)
T PLN00113        514 EIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAF  593 (968)
T ss_pred             eCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999998888


Q ss_pred             CCCCccccCCCCCCCCCCC--CCCCCC
Q 043685          571 RNAPVEALEGNKGLCGGVK--GMQPCK  595 (620)
Q Consensus       571 ~~l~~~~l~~Np~~C~~~~--~~~~c~  595 (620)
                      ..+....+.|||..|+...  +.++|.
T Consensus       594 ~~~~~~~~~~n~~lc~~~~~~~~~~c~  620 (968)
T PLN00113        594 LAINASAVAGNIDLCGGDTTSGLPPCK  620 (968)
T ss_pred             cccChhhhcCCccccCCccccCCCCCc
Confidence            8888899999999998643  345674

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query620
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-43
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-39
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-13
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-11
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 5e-05
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 8e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 9e-05
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score =  160 bits (405), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 187/705 (26%), Positives = 294/705 (41%), Gaps = 124/705 (17%)
Query: 16  SSKISPCAWYGISCND--------AGRVINIS------------------LRNTGLSGTL 49
           SS  +PC + G++C D        + + +N+                   L N+ ++G++
Sbjct: 34  SSNKNPCTFDGVTCRDDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSV 93
Query: 50  RDLSFSSFPQLEYLDLSLNGLFG--TIPSQIGNLSKLSYISLDSNQLF--GKIP--LELS 103
               F     L  LDLS N L G  T  + +G+ S L ++++ SN L   GK+   L+L+
Sbjct: 94  S--GFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLN 151
Query: 104 SIEELFLYSN--------------------HLNESFPPFLGNL--SNIVRLYXXXXXXXX 141
           S+E L L +N                    HL  S     G++  S  V L         
Sbjct: 152 SLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNN 211
Query: 142 XXXXX--XGNLKFLFELDLSNNQLGGSIPLSFGNLSNLARLCLYKNLLIGSIPSSLGNLK 199
                   G+   L  LD+S N+L G    +    + L  L +  N  +G IP  L    
Sbjct: 212 FSTGIPFLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPP-LPLKS 270
Query: 200 LIDLKLSSNQLTGYIPYSL-GNVTXXXXXXXAKNKLYGSLPPFV---------DLSINQF 249
           L  L L+ N+ TG IP  L G          + N  YG++PPF           LS N F
Sbjct: 271 LQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNF 330
Query: 250 RGFLPPFVGNLTNLERLGLMD---NHLSGSIPPSLGNSTLTWLTFSL--NHFTGYLPHDI 304
            G LP  +  L  +  L ++D   N  SG +P SL N + + LT  L  N+F+G +  ++
Sbjct: 331 SGELP--MDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNL 388
Query: 305 CRG--GALEIFIVDEYRFQGTIPTSLRNCTSLIRVRLDGNNLTGNISEALGIYPNLTFID 362
           C+     L+   +    F G IP +L NC+ L+ + L  N L+G I  +LG    L  + 
Sbjct: 389 CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLK 448
Query: 363 LSRNNFYGEISSNWGKCPKLGTLNVSMNNITGGIPREIGNSSQLQALDLSLNQIVGDIPK 422
           L  N   GEI         L TL +  N++TG IP  + N + L  + LS N++ G+IPK
Sbjct: 449 LWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPK 508
Query: 423 ELGKSNSLTKLILRGNQLTGRLPTEIGSLIKLEYLDFSANRFNNSVPEIXXXXXXXXXXX 482
            +G+  +L  L L  N  +G +P E+G    L +LD + N FN ++P             
Sbjct: 509 WIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAAN 568
Query: 483 XXX----------------------XQFVQELPKELEKLVQLSLLDASHNLFGGE----- 515
                                     +F     ++L +L   +  + +  ++GG      
Sbjct: 569 FIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTF 628
Query: 516 -------------------IPFQICSLKSLEMLNLSHNNLSGSIPNCFDGMHGLSVIDIS 556
                              IP +I S+  L +LNL HN++SGSIP+    + GL+++D+S
Sbjct: 629 DNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLS 688
Query: 557 DNQLQGPVPNSTAFRNAPVEALEGNKGLCGGVKGMQPCKVYSTHK 601
            N+L G +P + +      E    N  L G +  M   + +   K
Sbjct: 689 SNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAK 733
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query620
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-155
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-134
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-90
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-28
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-87
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-85
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-80
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-71
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-56
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-52
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-24
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-80
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-70
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-40
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-40
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-28
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-71
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-29
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-25
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-70
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-61
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-58
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-27
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-68
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-65
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-57
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-26
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-20
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-63
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-51
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-50
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-24
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-47
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-34
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-24
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-46
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-45
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-43
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-41
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-45
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-39
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-32
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-23
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-43
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-31
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-20
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-18
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-41
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-40
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-39
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-20
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-37
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-36
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-35
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-34
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-34
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-35
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-33
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-30
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-27
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-34
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-33
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-33
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-30
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-27
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-32
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-30
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-32
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-31
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-30
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-30
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-16
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-31
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-23
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-23
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-22
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-19
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-13
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-30
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-30
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-24
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-29
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-25
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-25
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-24
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-24
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-29
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-26
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-24
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-28
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-24
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-26
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-21
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-11
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-25
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-24
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-19
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-17
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-17
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 1e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-19
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-17
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-11
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-18
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-17
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-15
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-12
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 7e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 8e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 9e-08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 9e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 3e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  463 bits (1193), Expect = e-155
 Identities = 172/571 (30%), Positives = 261/571 (45%), Gaps = 31/571 (5%)

Query: 38  ISLRNTGLSGTLRDLSFSSFPQLEYLDLSLNGLFGTIPSQIGNLSKLSYISLDSNQLFGK 97
           +++    +SG +     S    LE+LD+S N     IP  +G+ S L ++ +  N+L G 
Sbjct: 183 LAISGNKISGDV---DVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGD 238

Query: 98  IPLE---LSSIEELFLYSNHLNESFPPFLGNLSNIVRLYINNNSLSSSIPTNI-GNLKFL 153
                   + ++ L + SN      PP    L ++  L +  N  +  IP  + G    L
Sbjct: 239 FSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDTL 296

Query: 154 FELDLSNNQLGGSIPLSFGNLSNLARLCLYKNLLIGSIP-SSLGNLK-LIDLKLSSNQLT 211
             LDLS N   G++P  FG+ S L  L L  N   G +P  +L  ++ L  L LS N+ +
Sbjct: 297 TGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFS 356

Query: 212 GYIPYSLGNVT-SLSSLLLAKNKLYGSLPP-----------FVDLSINQFRGFLPPFVGN 259
           G +P SL N++ SL +L L+ N   G + P            + L  N F G +PP + N
Sbjct: 357 GELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN 416

Query: 260 LTNLERLGLMDNHLSGSIPPSLGN-STLTWLTFSLNHFTGYLPHDICRGGALEIFIVDEY 318
            + L  L L  N+LSG+IP SLG+ S L  L   LN   G +P ++     LE  I+D  
Sbjct: 417 CSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 476

Query: 319 RFQGTIPTSLRNCTSLIRVRLDGNNLTGNISEALGIYPNLTFIDLSRNNFYGEISSNWGK 378
              G IP+ L NCT+L  + L  N LTG I + +G   NL  + LS N+F G I +  G 
Sbjct: 477 DLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGD 536

Query: 379 CPKLGTLNVSMNNITGGIPREIGNSSQLQALDLSLNQIVGDIPKELGKSNSLTKLILRGN 438
           C  L  L+++ N   G IP  +   S      ++ N I G     +       +    GN
Sbjct: 537 CRSLIWLDLNTNLFNGTIPAAMFKQS----GKIAANFIAGKRYVYIKNDGMKKECHGAGN 592

Query: 439 --QLTGRLPTEIGSLIKLEYLDFSANRFNNSVPEILGNLLKLHYLGLSNNQFVQELPKEL 496
             +  G    ++  L      + ++  +         N   + +L +S N     +PKE+
Sbjct: 593 LLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEI 652

Query: 497 EKLVQLSLLDASHNLFGGEIPFQICSLKSLEMLNLSHNNLSGSIPNCFDGMHGLSVIDIS 556
             +  L +L+  HN   G IP ++  L+ L +L+LS N L G IP     +  L+ ID+S
Sbjct: 653 GSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLS 712

Query: 557 DNQLQGPVPNSTAFRNAPVEALEGNKGLCGG 587
           +N L GP+P    F   P      N GLCG 
Sbjct: 713 NNNLSGPIPEMGQFETFPPAKFLNNPGLCGY 743
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query620
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.91
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.79
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.66
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.65
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.65
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.65
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.64
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.63
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.61
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.6
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.52
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.47
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.47
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.44
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.43
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.43
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.42
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.4
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.38
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.37
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.32
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.3
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.23
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.22
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.21
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.17
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.92
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.87
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.64
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.57
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.36
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.25
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.22
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.07
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.67
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.66
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.41
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.72
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2.3e-71  Score=619.57  Aligned_cols=575  Identities=33%  Similarity=0.537  Sum_probs=485.2

Q ss_pred             CCCCCccccceeeCCCCCEEEEEcCCCCCccc---cC----------------------CCCCCCCCCCCEEECCCCCCC
Q 043685           17 SKISPCAWYGISCNDAGRVINISLRNTGLSGT---LR----------------------DLSFSSFPQLEYLDLSLNGLF   71 (620)
Q Consensus        17 ~~~~~c~~~~~~~~~~~~l~~L~l~~~~~~~~---~~----------------------~~~~~~~~~L~~L~Ls~~~i~   71 (620)
                      .+.+||+|.|+.|+ .++|++|+++++.+.+.   +.                      +..+.++++|++|+|++|.+.
T Consensus        35 ~~~~~C~w~gv~C~-~~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~  113 (768)
T 3rgz_A           35 SNKNPCTFDGVTCR-DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLS  113 (768)
T ss_dssp             TTSCGGGSTTEEEE-TTEEEEEECTTSCCCEEHHHHHHHTTTCTTCCEEECTTSCEEECCCCCCCCTTCCEEECCSSEEE
T ss_pred             CCCCCcCCcceEEC-CCcEEEEECCCCCcCCccCccChhHhccCcccccCCcCCCcCCCchhhccCCCCCEEECCCCcCC
Confidence            56789999999998 68999999999988875   31                      157889999999999999998


Q ss_pred             CcCCc--cccCCCCCCEEECCCCCCcccCCC----CCCCCcEEEccCCcCCCcCccc---cc------------------
Q 043685           72 GTIPS--QIGNLSKLSYISLDSNQLFGKIPL----ELSSIEELFLYSNHLNESFPPF---LG------------------  124 (620)
Q Consensus        72 ~~~~~--~l~~l~~L~~L~L~~~~i~~~~~~----~l~~L~~L~ls~~~~~~~~~~~---l~------------------  124 (620)
                      +.+|.  .++++++|++|++++|.+.+..|.    .+++|++|++++|.+++..+..   +.                  
T Consensus       114 ~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~  193 (768)
T 3rgz_A          114 GPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGD  193 (768)
T ss_dssp             EEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESC
T ss_pred             CcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCccccc
Confidence            88888  899999999999999998876664    4688888888888887665544   44                  


Q ss_pred             ----CCCCCCEEEccCCcCCcccCccCCCCCCCCEEeCCCCCCcCCCCcccCCCCCCcEEEcccccccccCCCCCCcee-
Q 043685          125 ----NLSNIVRLYINNNSLSSSIPTNIGNLKFLFELDLSNNQLGGSIPLSFGNLSNLARLCLYKNLLIGSIPSSLGNLK-  199 (620)
Q Consensus       125 ----~l~~L~~L~Ls~n~~~~~~~~~~~~l~~L~~L~l~~~~l~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~l~~l~-  199 (620)
                          ++++|++|++++|.+.+..|. ++++++|++|++++|.+.+..|..+..+++|++|++++|.+.+..|..  .++ 
T Consensus       194 ~~~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~  270 (768)
T 3rgz_A          194 VDVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKS  270 (768)
T ss_dssp             CBCTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC--CCTT
T ss_pred             CCcccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc--ccCC
Confidence                455555555555555544444 666666777777776666666666677777777777777666555543  444 


Q ss_pred             ecEEEccCCccccccCCCCCCC-CCCCEEEccCCcCCCCCCCc---------cccccccccccCCcc-cccCCCCCeeec
Q 043685          200 LIDLKLSSNQLTGYIPYSLGNV-TSLSSLLLAKNKLYGSLPPF---------VDLSINQFRGFLPPF-VGNLTNLERLGL  268 (620)
Q Consensus       200 L~~L~l~~~~~~~~~~~~l~~l-~~L~~L~l~~n~~~~~~~~~---------l~l~~~~l~~~~~~~-l~~~~~L~~L~l  268 (620)
                      |++|++++|.+++.+|..+... ++|++|++++|.+++..|..         ++++.|.+.+.++.. +..+++|++|++
T Consensus       271 L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~L  350 (768)
T 3rgz_A          271 LQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDL  350 (768)
T ss_dssp             CCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEEC
T ss_pred             CCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeC
Confidence            7777777777776777666654 77888888888776655543         577778887766655 778888888888


Q ss_pred             cCCcCCCCCCCCCCC-C-CcCeEEecCCcccccCCCCccC--CCCccEEEecCccccccccccccccCCCceeecCCCcc
Q 043685          269 MDNHLSGSIPPSLGN-S-TLTWLTFSLNHFTGYLPHDICR--GGALEIFIVDEYRFQGTIPTSLRNCTSLIRVRLDGNNL  344 (620)
Q Consensus       269 ~~~~~~~~~~~~~~~-~-~L~~L~l~~~~~~~~~~~~~~~--~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~l  344 (620)
                      ++|.+.+..|..+.. . +++.|++++|.+.+..+..+..  +++|++|++++|.+.+..|..+.++++|+.|++++|.+
T Consensus       351 s~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l  430 (768)
T 3rgz_A          351 SFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYL  430 (768)
T ss_dssp             CSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEE
T ss_pred             cCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcc
Confidence            888887777777665 4 8899999999888888877776  78899999999999999999999999999999999999


Q ss_pred             ccccCcccCCCCCCCEEECCCCcccCccCccccCCCCCcEEECCCCccccCCCccccCCCCCCEEecCCCeecccCChhh
Q 043685          345 TGNISEALGIYPNLTFIDLSRNNFYGEISSNWGKCPKLGTLNVSMNNITGGIPREIGNSSQLQALDLSLNQIVGDIPKEL  424 (620)
Q Consensus       345 ~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~  424 (620)
                      .+..+..+..+++|+.|++++|.+.+.+|..+..+++|++|++++|.+.+..|..+..+++|++|++++|++++..|..+
T Consensus       431 ~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~  510 (768)
T 3rgz_A          431 SGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWI  510 (768)
T ss_dssp             ESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGG
T ss_pred             cCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHH
Confidence            98888899999999999999999999999999999999999999999998889999999999999999999999999999


Q ss_pred             hccCCCcEEEccCCcccccCCccccCCCCCCEEEccCCcCCcchhhhh--------------------------------
Q 043685          425 GKSNSLTKLILRGNQLTGRLPTEIGSLIKLEYLDFSANRFNNSVPEIL--------------------------------  472 (620)
Q Consensus       425 ~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~ls~n~l~~~~~~~l--------------------------------  472 (620)
                      ..+++|++|++++|++.+.+|..+..+++|++|++++|++++.+|..+                                
T Consensus       511 ~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  590 (768)
T 3rgz_A          511 GRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGA  590 (768)
T ss_dssp             GGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSS
T ss_pred             hcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcccccccccccccccccccccc
Confidence            999999999999999999999999999999999999999876655433                                


Q ss_pred             --------------------------------------hCCCCCCEecCcCCcCcccchhHhhhccCCCEEeCCCCcCcc
Q 043685          473 --------------------------------------GNLLKLHYLGLSNNQFVQELPKELEKLVQLSLLDASHNLFGG  514 (620)
Q Consensus       473 --------------------------------------~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~  514 (620)
                                                            ..+++|++|++++|.+++.+|..++.+++|+.|++++|++++
T Consensus       591 ~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g  670 (768)
T 3rgz_A          591 GNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISG  670 (768)
T ss_dssp             EEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCS
T ss_pred             ccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCC
Confidence                                                  335779999999999999999999999999999999999999


Q ss_pred             ccchhccCCCCCCEEECCCCcCccccCccccCCCCCCEEEccCCcCccCCCCCcccCCCCccccCCCCCCCCCCCCCCCC
Q 043685          515 EIPFQICSLKSLEMLNLSHNNLSGSIPNCFDGMHGLSVIDISDNQLQGPVPNSTAFRNAPVEALEGNKGLCGGVKGMQPC  594 (620)
Q Consensus       515 ~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~N~l~~~~~~~~~~~~l~~~~l~~Np~~C~~~~~~~~c  594 (620)
                      .+|..++.+++|+.||+++|++++.+|..+..+++|++||+++|+++|.+|...++.++....+.|||.+||.+..  +|
T Consensus       671 ~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~--~C  748 (768)
T 3rgz_A          671 SIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP--RC  748 (768)
T ss_dssp             CCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC--CC
T ss_pred             CCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc--CC
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999998754  78


Q ss_pred             CCC
Q 043685          595 KVY  597 (620)
Q Consensus       595 ~~~  597 (620)
                      ...
T Consensus       749 ~~~  751 (768)
T 3rgz_A          749 DPS  751 (768)
T ss_dssp             CSC
T ss_pred             CCC
Confidence            644
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 620
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-20
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-17
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-18
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-06
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 5e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 5e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.003
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 3e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 5e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.004
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 7e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 90.4 bits (223), Expect = 4e-20
 Identities = 61/381 (16%), Positives = 122/381 (32%), Gaps = 20/381 (5%)

Query: 106 EELFLYSNHLNESFPPFLGNLSNIVRLYINNNSLSSSIPTNIGNLKFLFELDLSNNQLGG 165
           E++       N +      +L  +  L  +   + S     +  L  L +++ SNNQL  
Sbjct: 23  EKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKS--IDGVEYLNNLTQINFSNNQLTD 80

Query: 166 SIPLSFGNLSNLARLCLYKNLLIGSIPSSLGNLKLIDLKLSSNQLTGYIPYSLGNVTSLS 225
             P    NL+ L  + +  N +    P +           ++         +L N+  L 
Sbjct: 81  ITP--LKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLE 138

Query: 226 SLLLAKNKLYGSLPPFVDLSINQFRGFLPPFVGNLTNLERLGLMDNHLSGSIPPSLGNST 285
                 + +           ++                     + ++    I      + 
Sbjct: 139 LSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTN 198

Query: 286 LTWLTFSLNHFTGYLPHDICRGGALEIFIVDEYRFQGTIPTSLRNCTSLIRVRLDGNNLT 345
           L  L  + N  +   P  I     L+   ++  + +     +L + T+L  + L  N ++
Sbjct: 199 LESLIATNNQISDITPLGILT--NLDELSLNGNQLKD--IGTLASLTNLTDLDLANNQIS 254

Query: 346 GNISEALGIYPNLTFIDLSRNNFYGEISSNWGKCPKLGTLNVSMNNITGGIPREIGNSSQ 405
                 L     LT + L  N                   N+ +N         I N   
Sbjct: 255 NLAP--LSGLTKLTELKLGANQISNISPLAGLTALT----NLELNENQLEDISPISNLKN 308

Query: 406 LQALDLSLNQIVGDIPKELGKSNSLTKLILRGNQLTGRLPTEIGSLIKLEYLDFSANRFN 465
           L  L L  N I    P  +     L +L    N+++    + + +L  + +L    N+ +
Sbjct: 309 LTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGHNQIS 364

Query: 466 NSVPEILGNLLKLHYLGLSNN 486
           +  P  L NL ++  LGL++ 
Sbjct: 365 DLTP--LANLTRITQLGLNDQ 383
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query620
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.76
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.71
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.71
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.54
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.54
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.51
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.47
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.46
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.45
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.44
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.32
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.29
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.23
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.56
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.36
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.1
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.9
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.58
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.44
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.96  E-value=1.9e-29  Score=248.60  Aligned_cols=258  Identities=26%  Similarity=0.449  Sum_probs=227.3

Q ss_pred             CCceeecCCCcccc--ccCcccCCCCCCCEEECCC-CcccCccCccccCCCCCcEEECCCCccccCCCccccCCCCCCEE
Q 043685          333 SLIRVRLDGNNLTG--NISEALGIYPNLTFIDLSR-NNFYGEISSNWGKCPKLGTLNVSMNNITGGIPREIGNSSQLQAL  409 (620)
Q Consensus       333 ~L~~L~l~~~~l~~--~~~~~~~~l~~L~~L~l~~-n~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L  409 (620)
                      +++.|+++++.+.+  ..+..++.+++|++|++++ |.+.+.+|..+.++++|++|++++|++.+..+..+..++.|+.+
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l  130 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTL  130 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEE
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhccc
Confidence            56777777777765  3567788889999999986 78888888889999999999999999988778888889999999


Q ss_pred             ecCCCeecccCChhhhccCCCcEEEccCCcccccCCccccCCCCC-CEEEccCCcCCcchhhhhhCCCCCCEecCcCCcC
Q 043685          410 DLSLNQIVGDIPKELGKSNSLTKLILRGNQLTGRLPTEIGSLIKL-EYLDFSANRFNNSVPEILGNLLKLHYLGLSNNQF  488 (620)
Q Consensus       410 ~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L-~~L~ls~n~l~~~~~~~l~~l~~L~~L~l~~n~l  488 (620)
                      ++++|.+.+..|..+..++.++.+++++|++.+.+|..+..+..+ +.+++++|++++..+..+..+. ...+++.++..
T Consensus       131 ~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~-~~~l~l~~~~~  209 (313)
T d1ogqa_         131 DFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN-LAFVDLSRNML  209 (313)
T ss_dssp             ECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCC-CSEEECCSSEE
T ss_pred             ccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccc-ccccccccccc
Confidence            999999988889999999999999999999998888888887776 8899999999988888887664 45799999999


Q ss_pred             cccchhHhhhccCCCEEeCCCCcCccccchhccCCCCCCEEECCCCcCccccCccccCCCCCCEEEccCCcCccCCCCCc
Q 043685          489 VQELPKELEKLVQLSLLDASHNLFGGEIPFQICSLKSLEMLNLSHNNLSGSIPNCFDGMHGLSVIDISDNQLQGPVPNST  568 (620)
Q Consensus       489 ~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~N~l~~~~~~~~  568 (620)
                      .+.+|..+..+++++.+++++|.+.+.++ .+..+++|+.|++++|++++.+|..|..+++|++|||++|+|++.+|...
T Consensus       210 ~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~  288 (313)
T d1ogqa_         210 EGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGG  288 (313)
T ss_dssp             EECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCST
T ss_pred             ccccccccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcc
Confidence            88899889999999999999999986654 68889999999999999999999999999999999999999999999887


Q ss_pred             ccCCCCccccCCCCCCCCCCCCCCCC
Q 043685          569 AFRNAPVEALEGNKGLCGGVKGMQPC  594 (620)
Q Consensus       569 ~~~~l~~~~l~~Np~~C~~~~~~~~c  594 (620)
                      .+++++.+++.||+.+||.|.  +.|
T Consensus       289 ~L~~L~~l~l~~N~~l~g~pl--p~c  312 (313)
T d1ogqa_         289 NLQRFDVSAYANNKCLCGSPL--PAC  312 (313)
T ss_dssp             TGGGSCGGGTCSSSEEESTTS--SCC
T ss_pred             cCCCCCHHHhCCCccccCCCC--CCC
Confidence            889999999999999999865  466
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure