Citrus Sinensis ID: 043718

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23

MPDKVTTMVLKVDLQCSKCYKKVKKVLSKFPQIQDQIYDEKQNKVTIKVVCCCPEKMRDKICCKGDGVIKSIEIKSPDDQKKKKEEPADKKEPEKKKETPQTEKKKEKAEESKPKNKEPAPEKGKEKDQPEKKKEPKDTPKPKVDPQPKVDPPAPGYPPPYYPFGVCCPECYGGHGGGPCHRYGPPPKIWYDGYYGRPVYDSWGGSSKYYGYRSDCLSEENPSACAII

cccccEEEEEEEEcccHHHHHHHHHHHccccccEEEEEEccccEEEEEEEEccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

ccccEEEEEEEEcccHHHHHHHHHHHHHccccccEEEEcccccEEEEEEccccHHHHHHHHHHccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccEccEEEcccccccccccccccEEEcccccccEEc

MPDKVTTMVLKVDLQCSKCYKKVKKVLSKfpqiqdqiydekqnkVTIKVVcccpekmrdkicckgdgviksieikspddqkkkkeepadkkepekkketpqtekkkekaeeskpknkepapekgkekdqpekkkepkdtpkpkvdpqpkvdppapgypppyypfgvccpecygghgggpchrygpppkiwydgyygrpvydswggsskyygyrsdclseenpsacaii

mpdkvttmvlkvdlqcskCYKKVKKVlskfpqiqdqiydekqnkvtIKVVcccpekmrdkicckgdgviksieikspddqkkkkeepadkkepekkketpqtekkkekaeeskpknkepapekgkekdqpekkkepkdtpkpkvdpqpkvDPPAPGYPPPYYPFGVCCPECYGGHGGGPCHRYGPPPKIWYDGYYGRPVYDSWGGSSKYYGYRsdclseenpsacaii

MPDKVTTMVLKVDLQcskcykkvkkvlskFPQIQDQIYDEKQNKVTIKVVCCCPEKMRDKICCKGDGVIKSIEIkspddqkkkkeepadkkepekkketpqtekkkekaeeskpknkepapekgkekdqpekkkepkdtpkpkvdpqpkvdppapgypppyypFGVccpecygghgggpchrygpppKIWYDGYYGRPVYDSWGGSSKYYGYRSDCLSEENPSACAII

*****TTMVLKVDLQCSKCYKKVKKVLSKFPQIQDQIYDEKQNKVTIKVVCCCPEKMRDKICCKGDGVIKSI***************************************************************************************PYYPFGVCCPECYGGHGGGPCHRYGPPPKIWYDGYYGRPVYDSWGGSSKYYGYRSDCL***********

***KVTTMVLKVDLQCSKCYKKVKKVLSKFPQIQDQIYDEKQNKVTIKVVCCCPEKMRDKICCKGDGV*************************************************************************************************VCCPECYGGHGGGPCHRYGPPPKIWYDGYYGRPVYDSWGGSSKYYGYRSDCLSEENPSACAII

********VLKVDLQCSKCYKKVKKVLSKFPQIQDQIYDEKQNKVTIKVVCCCPEKMRDKICCKGDGVIKSIEIKS*************************************************************************VDPPAPGYPPPYYPFGVCCPECYGGHGGGPCHRYGPPPKIWYDGYYGRPVYDSWGGSSKYYGYRSDCLS**********

**DKVTTMVLKVDLQCSKCYKKVKKVLSKFPQIQDQIYDEKQNKVTIKVVCCCPEKMRDKICCKGDGVIKSIEIKSP******************************************************************************GYPPPYYPFGVCCPECYGGHGGGPCHRYGPPPKIWYDGYYGRPVYDSWGGSSKYYGYRSDCLSEENPSACAII

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		228
194466241		232	putative metal ion-binding protein [Arac	0.890	0.875	0.448	3e-29
118486749		207	unknown [Populus trichocarpa]	0.842	0.927	0.432	1e-27
359496103		233	PREDICTED: uncharacterized protein LOC10	0.973	0.952	0.464	2e-26
359495628		215	PREDICTED: uncharacterized protein LOC10	0.899	0.953	0.393	5e-25
359496105		233	PREDICTED: uncharacterized protein LOC10	0.973	0.952	0.451	2e-24
351721915		240	uncharacterized protein LOC547653 [Glyci	0.324	0.308	0.770	6e-24
449443496		286	PREDICTED: uncharacterized protein LOC10	0.311	0.248	0.830	8e-24
255563766		274	conserved hypothetical protein [Ricinus	0.947	0.788	0.419	1e-23
119888002		182	proline-rich protein [Gossypium hirsutum	0.587	0.736	0.48	7e-23
388494848		261	unknown [Medicago truncatula]	0.311	0.272	0.816	7e-23

>gi\|194466241\|gb\|ACF74351.1\| putative metal ion-binding protein [Arachis hypogaea]	Back alignment and taxonomy information

 Score =  134 bits (337), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 101/225 (44%), Positives = 126/225 (56%), Gaps = 22/225 (9%)

Query: 1   MPDKVTTMVLKVDLQCSKCYKKVKKVLSKFPQIQDQIYDEKQNKVTIKVVCCCPEKMRDK 60
           M +KVT M LKVDL+C KCYKKVKKVL+KFPQI+D+ +DEKQN VTI VVCC PEK+RDK
Sbjct: 1   MAEKVTVMKLKVDLECHKCYKKVKKVLAKFPQIRDEKFDEKQNIVTITVVCCSPEKIRDK 60

Query: 61  ICCKGDGVIKSIEIKSP--DDQKKKKEEPADKKEPEKKKETPQTEKKKEKAEESKPKNKE 118
           +C KG G IKSIEI  P   ++KK  ++      P+  K+      K +     +P  K+
Sbjct: 61  LCYKGGGSIKSIEIVDPPKPEKKKDADDKPKAPAPDPPKKKDAAADKPKPKLADEPDKKK 120

Query: 119 PAPEKGKEKDQPEKKKEPK---DTPKPKVDPQ---------------PKVDPPAPGYPPP 160
            A +K K KD   K+K  K   D+ KPK DP+                K+  P   YPP 
Sbjct: 121 DAGDKEKPKDAAPKEKADKPKGDSEKPKGDPEKPKDKPAEAKPAPPPVKIADPVAAYPPA 180

Query: 161 YYPFGVCCPECYGGHGG--GPCHRYGPPPKIWYDGYYGRPVYDSW 203
             P  V    C  G+ G  GPC      P + YDGYY RPVYD +
Sbjct: 181 PQPMMVPVGICVTGYEGGPGPCVNGYAGPVMCYDGYYARPVYDVY 225

Source: Arachis hypogaea

Species: Arachis hypogaea

Genus: Arachis

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|118486749\|gb\|ABK95210.1\| unknown [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|359496103\|ref\|XP_002269930.2\| PREDICTED: uncharacterized protein LOC100250652 [Vitis vinifera] gi\|297735871\|emb\|CBI18630.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359495628\|ref\|XP_003635040.1\| PREDICTED: uncharacterized protein LOC100852467 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359496105\|ref\|XP_003635154.1\| PREDICTED: uncharacterized protein LOC100853846 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|351721915\|ref\|NP_001235946.1\| uncharacterized protein LOC547653 [Glycine max] gi\|22597168\|gb\|AAN03471.1\| unknown protein [Glycine max]	Back alignment and taxonomy information

>gi\|449443496\|ref\|XP_004139513.1\| PREDICTED: uncharacterized protein LOC101212464 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|255563766\|ref\|XP_002522884.1\| conserved hypothetical protein [Ricinus communis] gi\|223537869\|gb\|EEF39484.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|119888002\|gb\|ABM05953.1\| proline-rich protein [Gossypium hirsutum]	Back alignment and taxonomy information

>gi\|388494848\|gb\|AFK35490.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		228
TAIR\|locus:1006589875		254	AT4G16380 [Arabidopsis thalian	0.315	0.283	0.541	5.4e-23
TAIR\|locus:2026042		171	AT1G51090 [Arabidopsis thalian	0.324	0.432	0.486	1.2e-19
TAIR\|locus:2010192		189	AT1G49420 [Arabidopsis thalian	0.311	0.375	0.472	4.3e-18

TAIR\|locus:1006589875 AT4G16380 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 192 (72.6 bits), Expect = 5.4e-23, Sum P(2) = 5.4e-23
 Identities = 39/72 (54%), Positives = 47/72 (65%)

Query:     3 DKVTTMVLKVDLQXXXXXXXXXXXXXXFPQIQDQIYDEKQNKVTIKVVCCCPEKMRDKIC 62
             +KVT M LKVDL               FPQI+DQ++DEK N V IKVVCC PE++ DK+C
Sbjct:     7 EKVTMMKLKVDLDCAKCYKKVKKVLCKFPQIRDQLFDEKSNIVIIKVVCCSPERIMDKLC 66

Query:    63 CKGDGVIKSIEI 74
              KG G IK+IEI
Sbjct:    67 SKGGGSIKTIEI 78

GO:0005634 "nucleus" evidence=ISM

GO:0030001 "metal ion transport" evidence=IEA

GO:0046872 "metal ion binding" evidence=IEA

GO:0009506 "plasmodesma" evidence=IDA

TAIR\|locus:2026042 AT1G51090 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2010192 AT1G49420 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		228
PRK04195		482	PRK04195, PRK04195, replication factor C large sub	2e-05
PRK04195		482	PRK04195, PRK04195, replication factor C large sub	2e-05
COG0810		244	COG0810, TonB, Periplasmic protein TonB, links inn	2e-05
pfam14181		155	pfam14181, YqfQ, YqfQ-like protein	2e-05
pfam10243		506	pfam10243, MIP-T3, Microtubule-binding protein MIP	3e-05
PRK04195		482	PRK04195, PRK04195, replication factor C large sub	7e-05
PRK04195		482	PRK04195, PRK04195, replication factor C large sub	8e-05
pfam10243		506	pfam10243, MIP-T3, Microtubule-binding protein MIP	8e-05
PRK04195		482	PRK04195, PRK04195, replication factor C large sub	1e-04
PTZ00144		418	PTZ00144, PTZ00144, dihydrolipoamide succinyltrans	2e-04
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	2e-04
pfam07415		489	pfam07415, Herpes_LMP2, Gammaherpesvirus latent me	2e-04
TIGR02794		346	TIGR02794, tolA_full, TolA protein	2e-04
PRK04195		482	PRK04195, PRK04195, replication factor C large sub	3e-04
COG0810		244	COG0810, TonB, Periplasmic protein TonB, links inn	3e-04
PTZ00372		413	PTZ00372, PTZ00372, endonuclease 4-like protein; P	3e-04
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	5e-04
pfam12569		516	pfam12569, NARP1, NMDA receptor-regulated protein	5e-04
pfam14181		155	pfam14181, YqfQ, YqfQ-like protein	6e-04
PRK05306		746	PRK05306, infB, translation initiation factor IF-2	7e-04
PRK04195		482	PRK04195, PRK04195, replication factor C large sub	0.001
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	0.001
COG4499		434	COG4499, COG4499, Predicted membrane protein [Func	0.001
TIGR03490		541	TIGR03490, Mycoplas_LppA, mycoides cluster lipopro	0.001
PRK04195		482	PRK04195, PRK04195, replication factor C large sub	0.002
TIGR03490		541	TIGR03490, Mycoplas_LppA, mycoides cluster lipopro	0.002
PRK04950		213	PRK04950, PRK04950, ProP expression regulator; Pro	0.002
pfam10310		436	pfam10310, DUF2413, Protein of unknown function (D	0.002
pfam10310		436	pfam10310, DUF2413, Protein of unknown function (D	0.002
COG0810		244	COG0810, TonB, Periplasmic protein TonB, links inn	0.003
pfam10243		506	pfam10243, MIP-T3, Microtubule-binding protein MIP	0.003
PRK05306		746	PRK05306, infB, translation initiation factor IF-2	0.003
PRK00247		429	PRK00247, PRK00247, putative inner membrane protei	0.003
COG0810		244	COG0810, TonB, Periplasmic protein TonB, links inn	0.004

>gnl\|CDD\|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional	Back alignment and domain information

 Score = 44.9 bits (107), Expect = 2e-05
 Identities = 20/63 (31%), Positives = 38/63 (60%)

Query: 81  KKKKEEPADKKEPEKKKETPQTEKKKEKAEESKPKNKEPAPEKGKEKDQPEKKKEPKDTP 140
           KK  E+   K+E EKK++  +    K+K EE + + ++   EK +E+++ E++KE ++  
Sbjct: 413 KKIVEKAEKKREEEKKEKKKKAFAGKKKEEEEEEEKEKKEEEKEEEEEEAEEEKEEEEEK 472

Query: 141 KPK 143
           K K
Sbjct: 473 KKK 475

Length = 482

>gnl\|CDD\|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|222581 pfam14181, YqfQ, YqfQ-like protein	Back alignment and domain information

>gnl\|CDD\|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3	Back alignment and domain information

>gnl\|CDD\|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3	Back alignment and domain information

>gnl\|CDD\|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|219404 pfam07415, Herpes_LMP2, Gammaherpesvirus latent membrane protein (LMP2) protein	Back alignment and domain information

>gnl\|CDD\|234017 TIGR02794, tolA_full, TolA protein	Back alignment and domain information

>gnl\|CDD\|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1	Back alignment and domain information

>gnl\|CDD\|222581 pfam14181, YqfQ, YqfQ-like protein	Back alignment and domain information

>gnl\|CDD\|235401 PRK05306, infB, translation initiation factor IF-2; Validated	Back alignment and domain information

>gnl\|CDD\|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|226894 COG4499, COG4499, Predicted membrane protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|234229 TIGR03490, Mycoplas_LppA, mycoides cluster lipoprotein, LppA/P72 family	Back alignment and domain information

>gnl\|CDD\|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|234229 TIGR03490, Mycoplas_LppA, mycoides cluster lipoprotein, LppA/P72 family	Back alignment and domain information

>gnl\|CDD\|235322 PRK04950, PRK04950, ProP expression regulator; Provisional	Back alignment and domain information

>gnl\|CDD\|220684 pfam10310, DUF2413, Protein of unknown function (DUF2413)	Back alignment and domain information

>gnl\|CDD\|220684 pfam10310, DUF2413, Protein of unknown function (DUF2413)	Back alignment and domain information

>gnl\|CDD\|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3	Back alignment and domain information

>gnl\|CDD\|235401 PRK05306, infB, translation initiation factor IF-2; Validated	Back alignment and domain information

>gnl\|CDD\|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated	Back alignment and domain information

>gnl\|CDD\|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		228
KOG1603		73	consensus Copper chaperone [Inorganic ion transpor	99.55
PF00403		62	HMA: Heavy-metal-associated domain; InterPro: IPR0	99.39
COG2608		71	CopZ Copper chaperone [Inorganic ion transport and	99.26
KOG4656		247	consensus Copper chaperone for superoxide dismutas	98.93
PLN02957		238	copper, zinc superoxide dismutase	98.16
PRK10671		834	copA copper exporting ATPase; Provisional	98.13
TIGR00003		68	copper ion binding protein. This model describes a	97.63
COG2217		713	ZntA Cation transport ATPase [Inorganic ion transp	97.04
PRK10671		834	copA copper exporting ATPase; Provisional	96.24
KOG0207		951	consensus Cation transport ATPase [Inorganic ion t	95.94
COG1888		97	Uncharacterized protein conserved in archaea [Func	95.69
PRK11033		741	zntA zinc/cadmium/mercury/lead-transporting ATPase	95.3
KOG0207		951	consensus Cation transport ATPase [Inorganic ion t	94.66
PF02680		95	DUF211: Uncharacterized ArCR, COG1888; InterPro: I	93.31
TIGR02052		92	MerP mercuric transport protein periplasmic compon	87.59
cd00371		63	HMA Heavy-metal-associated domain (HMA) is a conse	85.7

>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism]	Back alignment and domain information

Probab=99.55  E-value=2.4e-14  Score=105.22  Aligned_cols=68  Identities=35%  Similarity=0.514  Sum_probs=61.8

Q ss_pred             CceEEEEEEeccChhhHHHHHHHHhcCCCceeEEEEcCCCEEEEEeeccCHHHHHHHHHHhcCCccccEEEe
Q 043718            4 KVTTMVLKVDLQCSKCYKKVKKVLSKFPQIQDQIYDEKQNKVTIKVVCCCPEKMRDKICCKGDGVIKSIEIK   75 (228)
Q Consensus         4 k~~tvvLKV~M~C~gCakKIkKaL~kl~GV~sV~vD~k~~kVtV~G~~vDPekLv~aL~kK~gK~IK~aEIV   75 (228)
                      .+++.+|+|+|||++|+.+|++.|+.++||.++.+|.++++|||.|. +|+..|+++|++++++   .++++
T Consensus         3 ~~~~~v~kv~~~C~gc~~kV~~~l~~~~GV~~v~id~~~~kvtV~g~-~~p~~vl~~l~k~~~k---~~~~~   70 (73)
T KOG1603|consen    3 PIKTVVLKVNMHCEGCARKVKRVLQKLKGVESVDIDIKKQKVTVKGN-VDPVKLLKKLKKTGGK---RAELW   70 (73)
T ss_pred             CccEEEEEECcccccHHHHHHHHhhccCCeEEEEecCCCCEEEEEEe-cCHHHHHHHHHhcCCC---ceEEe
Confidence            35788999999999999999999999999999999999999999999 9999999999986644   56555

>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures	Back alignment and domain information

>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PLN02957 copper, zinc superoxide dismutase	Back alignment and domain information

>PRK10671 copA copper exporting ATPase; Provisional	Back alignment and domain information

>TIGR00003 copper ion binding protein	Back alignment and domain information

>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK10671 copA copper exporting ATPase; Provisional	Back alignment and domain information

>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1888 Uncharacterized protein conserved in archaea [Function unknown]	Back alignment and domain information

>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional	Back alignment and domain information

>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF02680 DUF211: Uncharacterized ArCR, COG1888; InterPro: IPR003831 This entry describes proteins of unknown function	Back alignment and domain information

>TIGR02052 MerP mercuric transport protein periplasmic component	Back alignment and domain information

>cd00371 HMA Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		228
3gdb_A		937	Endo-D, putative uncharacterized protein SPR0440;	1e-07
3gdb_A		937	Endo-D, putative uncharacterized protein SPR0440;	4e-07
3gdb_A		937	Endo-D, putative uncharacterized protein SPR0440;	6e-07
3gdb_A		937	Endo-D, putative uncharacterized protein SPR0440;	6e-04
1qup_A		222	Superoxide dismutase 1 copper chaperone; two domai	1e-05
2crl_A		98	Copper chaperone for superoxide dismutase; SOD1, f	4e-05
1jk9_B		249	CCS, copper chaperone for superoxide dismutase; pr	2e-04

>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937	Back alignment and structure

 Score = 50.7 bits (120), Expect = 1e-07
 Identities = 10/88 (11%), Positives = 21/88 (23%)

Query: 73  EIKSPDDQKKKKEEPADKKEPEKKKETPQTEKKKEKAEESKPKNKEPAPEKGKEKDQPEK 132
           E   P++     E  + + E    +   Q E +  +  + +         +       E 
Sbjct: 23  ETAVPENSGANTELVSGESEHSTNEADKQNEGEHARENKLEKAEGVATASETASPASNEA 82

Query: 133 KKEPKDTPKPKVDPQPKVDPPAPGYPPP 160
                        P+ K        P  
Sbjct: 83  ATTETAEAASAAKPEEKASEVVAETPSA 110

PyMOL of 3gdb

>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937	Back alignment and structure

>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937	Back alignment and structure

>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937	Back alignment and structure

>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222	Back alignment and structure

>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98	Back alignment and structure

>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		228
3iwl_A		68	Copper transport protein ATOX1; beta-alpha-beta-BE	99.5
1cc8_A		73	Protein (metallochaperone ATX1); copper transport,	99.44
4a4j_A		69	Pacszia, cation-transporting ATPase PACS; hydrolas	99.35
3dxs_X		74	Copper-transporting ATPase RAN1; CXXC motif, ferre	99.32
3fry_A		73	Probable copper-exporting P-type ATPase A; transpo	99.27
1opz_A		76	Potential copper-transporting ATPase; mutation, fo	99.22
2crl_A		98	Copper chaperone for superoxide dismutase; SOD1, f	99.22
2roe_A		66	Heavy metal binding protein; NMR {Thermus thermoph	99.17
2xmm_A		64	SSR2857 protein, ATX1; metal transport, copper hom	99.17
2qif_A		69	Copper chaperone COPZ; tetranuclear Cu(I) cluster;	99.15
2l3m_A		71	Copper-ION-binding protein; structural genomics, c	99.11
1mwy_A		73	ZNTA; open-faced beta-sandwich fold, beta-alpha-be	99.09
2xmw_A		71	PACS-N, cation-transporting ATPase PACS; hydrolase	99.09
1aw0_A		72	Menkes copper-transporting ATPase; copper-binding	99.08
1osd_A		72	MERP, hypothetical protein MERP; mercury resistanc	99.07
1kvi_A		79	Copper-transporting ATPase 1; menkes, Cu-protein,	99.05
2k2p_A		85	Uncharacterized protein ATU1203; putative metal-bi	99.04
1fvq_A		72	Copper-transporting ATPase; APO-CCC2A, hydrolase;	99.03
1yg0_A		66	COP associated protein; open-faced beta-sandwich,	99.03
1cpz_A		68	Protein (COPZ); copper chaperone, metal transport,	99.01
3cjk_B		75	Copper-transporting ATPase 1; HAH1, ATP7B, menkes	99.01
1y3j_A		77	Copper-transporting ATPase 1; ferrodoxin-like fold	99.0
1yjr_A		75	Copper-transporting ATPase 1; metallochaperone, pr	99.0
1q8l_A		84	Copper-transporting ATPase 1; metal binding protei	98.99
2g9o_A		90	Copper-transporting ATPase 1; menkes disease, solu	98.96
2kt2_A		69	Mercuric reductase; nmera, MERA, HMA domain, mercu	98.96
2kyz_A		67	Heavy metal binding protein; structural genomics,	98.95
2ldi_A		71	Zinc-transporting ATPase; metal homeostasis, metal	98.94
1jww_A		80	Potential copper-transporting ATPase; beta-alpha-b	98.9
2aj0_A		71	Probable cadmium-transporting ATPase; ferrodoxin-l	98.87
2kkh_A		95	Putative heavy metal transporter; zinc transport,	98.87
2ofg_X		111	Zinc-transporting ATPase; ferredoxin-like fold, be	98.87
1qup_A		222	Superoxide dismutase 1 copper chaperone; two domai	98.86
1p6t_A		151	Potential copper-transporting ATPase; COPA, P-type	98.83
2ew9_A		149	Copper-transporting ATPase 2; copper trafficking,	98.82
2ew9_A		149	Copper-transporting ATPase 2; copper trafficking,	98.82
1jk9_B		249	CCS, copper chaperone for superoxide dismutase; pr	98.72
2rop_A		202	Copper-transporting ATPase 2; wilson protein, mobi	98.68
2rop_A		202	Copper-transporting ATPase 2; wilson protein, mobi	98.51
1p6t_A		151	Potential copper-transporting ATPase; COPA, P-type	98.5
3j09_A		723	COPA, copper-exporting P-type ATPase A; copper tra	98.01
2raq_A		97	Conserved protein MTH889; alpha-beta protein, stru	95.91
2x3d_A		96	SSO6206; unknown function; 2.70A {Sulfolobus solfa	95.55
3bpd_A		100	Uncharacterized protein; heptamer, Mg+2 ION, PSI-2	94.27
2jsx_A		95	Protein NAPD; TAT, proofreading, cytoplasm, chaper	82.04
2cpq_A		91	FragIle X mental retardation syndrome related prot	80.72

>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A	Back alignment and structure

Probab=99.50  E-value=7.2e-14  Score=96.71  Aligned_cols=67  Identities=19%  Similarity=0.311  Sum_probs=59.9

Q ss_pred             ceEEEEEEeccChhhHHHHHHHHhcCCCceeEEEEcCCCEEEEEeeccCHHHHHHHHHHhcCCccccEEEeCC
Q 043718            5 VTTMVLKVDLQCSKCYKKVKKVLSKFPQIQDQIYDEKQNKVTIKVVCCCPEKMRDKICCKGDGVIKSIEIKSP   77 (228)
Q Consensus         5 ~~tvvLKV~M~C~gCakKIkKaL~kl~GV~sV~vD~k~~kVtV~G~~vDPekLv~aL~kK~gK~IK~aEIVsp   77 (228)
                      |++++|+|+|+|.+|+++|+++|.+++|| ++++|+.+++++|++. ++.+.|+++|++.+.    .++++++
T Consensus         1 m~~~~~~vgm~C~~C~~~i~~~l~~~~gV-~v~v~~~~~~~~v~~~-~~~~~i~~~i~~~Gy----~~~~~~~   67 (68)
T 3iwl_A            1 MPKHEFSVDMTCGGCAEAVSRVLNKLGGV-KYDIDLPNKKVCIESE-HSMDTLLATLKKTGK----TVSYLGL   67 (68)
T ss_dssp             -CEEEEEECCCSHHHHHHHHHHHHHHCSE-EEEEETTTTEEEEEES-SCHHHHHHHHHTTCS----CEEEEEC
T ss_pred             CceEEEEECcCcHHHHHHHHHHHHcCCCe-EEEEEcCCCEEEEEec-CCHHHHHHHHHHcCC----ceEecCC
Confidence            45788999999999999999999999999 9999999999999997 899999999994443    6888765

PyMOL of 3iwl

>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A	Back alignment and structure

>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A	Back alignment and structure

>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0	Back alignment and structure

>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus}	Back alignment and structure

>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A	Back alignment and structure

>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A	Back alignment and structure

>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A	Back alignment and structure

>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A	Back alignment and structure

>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis}	Back alignment and structure

>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A	Back alignment and structure

>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A	Back alignment and structure

>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A	Back alignment and structure

>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A	Back alignment and structure

>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A	Back alignment and structure

>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str}	Back alignment and structure

>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B	Back alignment and structure

>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori}	Back alignment and structure

>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1	Back alignment and structure

>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A	Back alignment and structure

>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A	Back alignment and structure

>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A	Back alignment and structure

>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A	Back alignment and structure

>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A	Back alignment and structure

>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A	Back alignment and structure

>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima}	Back alignment and structure

>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP}	Back alignment and structure

>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A	Back alignment and structure

>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A	Back alignment and structure

>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana}	Back alignment and structure

>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1	Back alignment and structure

>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A	Back alignment and structure

>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens}	Back alignment and structure

>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens}	Back alignment and structure

>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1	Back alignment and structure

>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens}	Back alignment and structure

>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens}	Back alignment and structure

>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A	Back alignment and structure

>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus}	Back alignment and structure

>2raq_A Conserved protein MTH889; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 3.11A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: d.58.61.1	Back alignment and structure

>2x3d_A SSO6206; unknown function; 2.70A {Sulfolobus solfataricus}	Back alignment and structure

>3bpd_A Uncharacterized protein; heptamer, Mg+2 ION, PSI-2, NYSGXRC, structural genom protein structure initiative; 2.80A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.61.1	Back alignment and structure

>2jsx_A Protein NAPD; TAT, proofreading, cytoplasm, chaperone; NMR {Escherichia coli K12} PDB: 2pq4_A	Back alignment and structure

>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		228
d1qupa2		72	d.58.17.1 (A:2-73) Copper chaperone for superoxide	6e-05
d1cc8a_		72	d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX	9e-04

>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: Copper chaperone for superoxide dismutase, N-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 37.8 bits (88), Expect = 6e-05
 Identities = 8/46 (17%), Positives = 18/46 (39%)

Query: 3  DKVTTMVLKVDLQCSKCYKKVKKVLSKFPQIQDQIYDEKQNKVTIK 48
          +        + + C  C   +K  L   P I    +D +Q  ++++
Sbjct: 3  NDTYEATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVE 48

PyMOL of d1qupa2

>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		228
d1cc8a_		72	ATX1 metallochaperone protein (ATOX1) {Baker's yea	99.66
d1fe0a_		66	ATX1 metallochaperone protein (ATOX1) {Human (Homo	99.6
d1qupa2		72	Copper chaperone for superoxide dismutase, N-termi	99.6
d1sb6a_		64	Copper chaperone {Synechocystis sp. pcc 6803, Scat	99.45
d2qifa1		69	Copper chaperone {Bacillus subtilis, CopZ [TaxId:	99.44
d2ggpb1		72	Copper transporter domain ccc2a {Baker's yeast (Sa	99.4
d1p6ta1		72	Potential copper-translocating P-type ATPase CopA	99.39
d1kvja_		79	Menkes copper-transporting ATPase {Human (Homo sap	99.38
d1osda_		72	Mercuric ion binding protein MerP {Ralstonia metal	99.37
d1cpza_		68	Copper chaperone {Enterococcus hirae [TaxId: 1354]	99.37
d2aw0a_		72	Menkes copper-transporting ATPase {Human (Homo sap	99.36
d1q8la_		84	Menkes copper-transporting ATPase {Human (Homo sap	99.31
d1mwza_		73	Metal ion-transporting ATPase ZntA, N-terminal dom	99.29
d1p6ta2		79	Potential copper-translocating P-type ATPase CopA	99.24
d2raqa1		93	Uncharacterized protein MTH889 {Methanobacterium t	95.68
d3bpda1		91	Uncharacterized protein AF1549 {Archaeoglobus fulg	94.9
d1urra_		97	Acylphosphatase 2 (Cg18505) {Fruit fly (Drosophila	86.79
d1uwda_		102	Hypothetical protein TM0487 {Thermotoga maritima [	80.11

>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: ATX1 metallochaperone protein (ATOX1)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.66  E-value=2.9e-16  Score=112.81  Aligned_cols=68  Identities=21%  Similarity=0.271  Sum_probs=60.7

Q ss_pred             CceEEEEEEeccChhhHHHHHHHHhcCC-CceeEEEEcCCCEEEEEeeccCHHHHHHHHHHhcCCccccEE
Q 043718            4 KVTTMVLKVDLQCSKCYKKVKKVLSKFP-QIQDQIYDEKQNKVTIKVVCCCPEKMRDKICCKGDGVIKSIE   73 (228)
Q Consensus         4 k~~tvvLKV~M~C~gCakKIkKaL~kl~-GV~sV~vD~k~~kVtV~G~~vDPekLv~aL~kK~gK~IK~aE   73 (228)
                      .+++++|+|+|||.+|+++|+++|.+|+ ||.+|++|+.+++|+|+|. +++++|+++|+ ++|+.+++.+
T Consensus         2 ~~kt~~f~V~MtC~~C~~~Ie~~L~~l~~gV~~v~v~~~~~~v~V~~~-~~~~~i~~~i~-~~G~~~~~~~   70 (72)
T d1cc8a_           2 EIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTT-LPYDFILEKIK-KTGKEVRSGK   70 (72)
T ss_dssp             CCEEEEEEECCCSHHHHHHHHHHHHTTTTSEEEEEEETTTTEEEEEES-SCHHHHHHHHH-TTSSCEEEEE
T ss_pred             CcEEEEEEECcCcHHHHHHHHHHHHcCcCceEEEEEECCCCEEEEeec-CCHHHHHHHHH-HHCCccCCce
Confidence            5789999999999999999999999995 9999999999999999998 99999999998 5565444443

PyMOL of d1cc8a_

>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]}	Back information, alignment and structure

>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]}	Back information, alignment and structure

>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]}	Back information, alignment and structure

>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]}	Back information, alignment and structure

>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]}	Back information, alignment and structure

>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2raqa1 d.58.61.1 (A:3-95) Uncharacterized protein MTH889 {Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d3bpda1 d.58.61.1 (A:1-91) Uncharacterized protein AF1549 {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1urra_ d.58.10.1 (A:) Acylphosphatase 2 (Cg18505) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1uwda_ d.52.8.2 (A:) Hypothetical protein TM0487 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure