Citrus Sinensis ID: 043750
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 149 | ||||||
| 255544956 | 1403 | leucine-rich repeat containing protein, | 0.959 | 0.101 | 0.381 | 3e-16 | |
| 359486075 | 1291 | PREDICTED: TMV resistance protein N-like | 0.966 | 0.111 | 0.363 | 4e-15 | |
| 147770134 | 1414 | hypothetical protein VITISV_040107 [Viti | 0.966 | 0.101 | 0.363 | 4e-15 | |
| 359496034 | 1132 | PREDICTED: TMV resistance protein N-like | 0.899 | 0.118 | 0.356 | 6e-15 | |
| 224131066 | 1176 | tir-nbs-lrr resistance protein [Populus | 0.892 | 0.113 | 0.382 | 7e-15 | |
| 224113213 | 687 | predicted protein [Populus trichocarpa] | 0.899 | 0.195 | 0.367 | 8e-15 | |
| 296090597 | 1201 | unnamed protein product [Vitis vinifera] | 0.899 | 0.111 | 0.356 | 8e-15 | |
| 359493483 | 1274 | PREDICTED: TMV resistance protein N-like | 0.973 | 0.113 | 0.371 | 1e-14 | |
| 451798990 | 1335 | TMV resistance protein N-like protein 7 | 0.973 | 0.108 | 0.371 | 1e-14 | |
| 451798988 | 1219 | TMV resistance protein N-like protein 6 | 0.932 | 0.114 | 0.367 | 2e-14 |
| >gi|255544956|ref|XP_002513539.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223547447|gb|EEF48942.1| leucine-rich repeat containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 90.1 bits (222), Expect = 3e-16, Method: Compositional matrix adjust.
Identities = 58/152 (38%), Positives = 85/152 (55%), Gaps = 9/152 (5%)
Query: 2 LYLSKNNFERIPKSIIQLSKLSCLYLSYCGKLQSLPKLPCSLHKLHAHHCTALESLSG-- 59
L L NNF RIP +I QLS L L +SYC +L++LP+LP + L AH+CT+L+++S
Sbjct: 1039 LLLKGNNFMRIPATIRQLSWLEVLDISYCKRLKALPELPQRIRVLVAHNCTSLKTVSSPL 1098
Query: 60 -LFPKSYESCPPR---FELNGNYNLDRNVVGGILEDALQNIQHVATARWEHMHAREKISY 115
F +S E P F +L++N I+E AL QH+ATA E + + E+I
Sbjct: 1099 IQFQESQEQSPDDKYGFTFANCVSLEKNARSNIVESALLKTQHLATAVLELLTSYEEILV 1158
Query: 116 PEFEGFAILPGNEIPKWFCFQSMGSLIKLKTP 147
F PG+EIP+ F +Q+ G+ + P
Sbjct: 1159 SPVVCF---PGSEIPECFRYQNTGASVTTLLP 1187
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359486075|ref|XP_002273047.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147770134|emb|CAN76615.1| hypothetical protein VITISV_040107 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359496034|ref|XP_002277500.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224131066|ref|XP_002328445.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222838160|gb|EEE76525.1| tir-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224113213|ref|XP_002332638.1| predicted protein [Populus trichocarpa] gi|222832865|gb|EEE71342.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|296090597|emb|CBI40966.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359493483|ref|XP_003634610.1| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|451798990|gb|AGF69193.1| TMV resistance protein N-like protein 7 [Vitis labrusca] | Back alignment and taxonomy information |
|---|
| >gi|451798988|gb|AGF69192.1| TMV resistance protein N-like protein 6 [Vitis labrusca] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 149 | ||||||
| TAIR|locus:2118106 | 1219 | AT4G12010 [Arabidopsis thalian | 0.966 | 0.118 | 0.315 | 6.6e-10 | |
| TAIR|locus:2122965 | 1210 | AT4G19510 [Arabidopsis thalian | 0.966 | 0.119 | 0.315 | 3.6e-09 | |
| TAIR|locus:2122209 | 1179 | AT4G36150 [Arabidopsis thalian | 0.946 | 0.119 | 0.286 | 2.6e-06 | |
| TAIR|locus:2153328 | 1231 | AT5G45230 [Arabidopsis thalian | 0.744 | 0.090 | 0.285 | 3.9e-06 | |
| TAIR|locus:2827629 | 1355 | AT2G17050 [Arabidopsis thalian | 0.906 | 0.099 | 0.277 | 5.1e-06 | |
| TAIR|locus:2122925 | 417 | AT4G19470 [Arabidopsis thalian | 0.973 | 0.347 | 0.268 | 6.2e-06 | |
| TAIR|locus:2153207 | 1165 | AT5G45060 [Arabidopsis thalian | 0.953 | 0.121 | 0.264 | 7e-06 | |
| TAIR|locus:2081810 | 1226 | AT3G51570 [Arabidopsis thalian | 0.187 | 0.022 | 0.448 | 1.1e-05 | |
| TAIR|locus:2158475 | 1217 | RPS4 "RESISTANT TO P. SYRINGAE | 0.966 | 0.118 | 0.271 | 1.5e-05 | |
| TAIR|locus:2122199 | 1607 | AT4G36140 [Arabidopsis thalian | 0.624 | 0.057 | 0.294 | 2.7e-05 |
| TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 156 (60.0 bits), Expect = 6.6e-10, P = 6.6e-10
Identities = 47/149 (31%), Positives = 69/149 (46%)
Query: 2 LYLSKNNFERIPKSIIQXXXXXXXXXXXXGKLQSLPKLPCSLHKLHAHHCTALESLSG-L 60
L LS NN E +P+S Q L+SLP LP +L L AH C +LE+L+ L
Sbjct: 883 LCLSGNNIENLPESFNQLNNLKWFDLKFCKMLKSLPVLPQNLQYLDAHECESLETLANPL 942
Query: 61 FPKSY-ESCPPRFELNGNYNLDRNVVGGILEDALQNIQHVATARWEHMHAREKISYPEFE 119
P + E F + Y L+++ ++ A Q +A A + + R + P
Sbjct: 943 TPLTVGERIHSMFIFSNCYKLNQDAQASLVGHARIKSQLMANASAKRYY-RGFVPEP-LV 1000
Query: 120 GFAILPGNEIPKWFCFQSMGSLIKLKTPP 148
G P EIP WFC Q +G +++ PP
Sbjct: 1001 GICY-PATEIPSWFCHQRLGRSLEIPLPP 1028
|
|
| TAIR|locus:2122965 AT4G19510 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2122209 AT4G36150 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153328 AT5G45230 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2827629 AT2G17050 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2122925 AT4G19470 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153207 AT5G45060 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2081810 AT3G51570 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2158475 RPS4 "RESISTANT TO P. SYRINGAE 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2122199 AT4G36140 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.53 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.16 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 98.09 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.88 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.35 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.27 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 96.97 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 96.91 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 96.81 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 96.81 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 96.74 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 96.64 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 96.46 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 96.31 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 96.21 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 96.15 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 95.94 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 95.91 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 95.84 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 95.83 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 95.79 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 95.79 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 95.7 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 95.34 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 95.16 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 94.93 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 94.75 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 94.26 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 94.12 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 93.26 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 93.14 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 92.58 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 89.95 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 89.95 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 89.4 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 89.39 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 89.16 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 88.26 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 88.24 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 87.86 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 87.36 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 87.22 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 86.74 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 86.34 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 85.91 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 83.38 | |
| smart00364 | 26 | LRR_BAC Leucine-rich repeats, bacterial type. | 83.33 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 82.28 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 82.25 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 82.23 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 82.0 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 81.01 |
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
Probab=99.53 E-value=1.5e-14 Score=133.51 Aligned_cols=121 Identities=26% Similarity=0.321 Sum_probs=93.3
Q ss_pred CEEccCCCccccchhhcCCCCCCEEccccccccccCCCCC---CCccEEccccccccccccCCCCCC-----------CC
Q 043750 1 YLYLSKNNFERIPKSIIQLSKLSCLYLSYCGKLQSLPKLP---CSLHKLHAHHCTALESLSGLFPKS-----------YE 66 (149)
Q Consensus 1 ~L~L~~~~~~~lP~si~~L~~L~~L~L~~c~~L~~lP~l~---~~L~~L~~~~C~sL~~~~~~~~~~-----------~~ 66 (149)
+|+|++|.+..+|.+|..+++|+.|+|++|.+|+.+|..+ .+|+.+++.+|.+|+.++-..... ..
T Consensus 850 ~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~~L~~~~l~~~~~~~~~~~~n~~~~~ 929 (1153)
T PLN03210 850 DLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWNGSPSEVAMATDNIHSKL 929 (1153)
T ss_pred EeECCCCCCccChHHHhcCCCCCEEECCCCCCcCccCcccccccCCCeeecCCCcccccccCCCCchhhhhhcccccccC
Confidence 4789999999999999999999999999999999999865 567888999999998765321100 00
Q ss_pred CCCCeeEecCCCCCchhhhhchHHHHHHHHHHhhhHHHhhhhhcccCCCCCcceEEEccCCCCCCccccccCCceEE-Ee
Q 043750 67 SCPPRFELNGNYNLDRNVVGGILEDALQNIQHVATARWEHMHAREKISYPEFEGFAILPGNEIPKWFCFQSMGSLIK-LK 145 (149)
Q Consensus 67 ~~~~~l~~~nC~~L~~~~~~~i~~~~~~~~q~~~~~~~~~~~~~~~~~~~~f~~~~~lPGs~IP~WF~~qs~gssis-i~ 145 (149)
.....+.|.||++|++.+.. +.- ..+ ..+++||.+||+||.||+.|++++ |.
T Consensus 930 p~~~~l~f~nC~~L~~~a~l----------~~~----------------~~~-~~~~l~g~evp~~f~hr~~g~sl~~i~ 982 (1153)
T PLN03210 930 PSTVCINFINCFNLDQEALL----------QQQ----------------SIF-KQLILSGEEVPSYFTHRTTGASLTNIP 982 (1153)
T ss_pred CchhccccccccCCCchhhh----------ccc----------------ccc-eEEECCCccCchhccCCcccceeeeec
Confidence 11234689999999865421 100 111 468999999999999999999998 99
Q ss_pred CCC
Q 043750 146 TPP 148 (149)
Q Consensus 146 lP~ 148 (149)
+|+
T Consensus 983 l~~ 985 (1153)
T PLN03210 983 LLH 985 (1153)
T ss_pred cCC
Confidence 976
|
syringae 6; Provisional |
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >smart00364 LRR_BAC Leucine-rich repeats, bacterial type | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 149 | |||
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 9e-08 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 1e-07 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 3e-07 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 4e-07 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 7e-07 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-06 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 7e-06 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 1e-06 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 5e-06 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 9e-06 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 2e-06 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 4e-06 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 8e-06 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 3e-05 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 4e-05 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 5e-05 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 5e-04 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 6e-04 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 6e-06 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 1e-05 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 2e-05 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 7e-05 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 7e-06 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-05 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 6e-05 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 3e-04 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 4e-04 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 8e-04 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-04 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 5e-04 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 3e-05 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 4e-05 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 4e-05 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 6e-05 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 7e-05 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-04 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-04 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 4e-04 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-04 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 3e-04 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 4e-04 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 4e-04 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 5e-04 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 8e-04 |
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
Score = 48.8 bits (117), Expect = 9e-08
Identities = 15/48 (31%), Positives = 20/48 (41%), Gaps = 1/48 (2%)
Query: 1 YLYLS-KNNFERIPKSIIQLSKLSCLYLSYCGKLQSLPKLPCSLHKLH 47
L L +N +P I +L++L L L C L LP L L
Sbjct: 257 RLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLPANC 304
|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.34 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.2 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.09 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.92 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.89 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.89 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.88 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.85 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.8 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.78 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.78 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.77 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.76 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.76 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.73 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.71 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.7 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.7 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.67 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.67 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.67 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.66 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 97.65 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.65 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.63 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.62 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.61 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.61 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.6 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 97.58 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.56 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 97.56 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 97.55 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.55 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.54 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.54 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.54 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.53 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.53 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.5 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.5 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.5 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.5 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.48 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.47 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.46 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.46 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.46 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.45 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.45 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 97.44 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.44 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.43 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 97.43 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 97.43 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.43 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.43 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 97.42 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.41 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.41 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.4 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.39 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.39 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.39 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 97.38 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.38 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.38 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 97.37 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.37 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.37 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.35 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.34 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.34 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 97.34 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 97.33 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 97.33 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.33 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.33 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.32 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.32 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.31 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.29 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.29 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.28 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.28 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 97.28 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.28 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.28 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.27 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.27 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.24 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.24 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.24 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 97.24 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 97.23 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.22 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 97.22 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.22 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.22 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.2 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.19 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.17 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.16 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 97.15 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.14 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.13 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.13 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.13 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 97.12 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 97.12 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.12 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 97.11 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.11 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.11 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.1 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 97.1 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.07 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.02 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 96.99 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 96.95 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 96.91 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 96.91 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 96.89 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 96.83 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 96.8 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 96.8 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 96.78 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 96.73 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 96.7 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 96.69 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 96.25 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 95.63 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 95.56 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 94.89 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 94.85 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 94.37 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 93.96 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 93.49 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 93.26 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 93.05 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 92.81 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 92.71 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 92.38 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 91.83 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 91.36 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 89.95 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 89.93 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 89.21 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 87.31 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 85.84 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 80.03 |
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
Probab=98.34 E-value=9.8e-07 Score=69.77 Aligned_cols=78 Identities=24% Similarity=0.344 Sum_probs=35.6
Q ss_pred EEccCCCccccchhhcCCCCCCEEccccccccccCCCCC---CCccEEccccccccccccCCCCCCCCCCCCeeEecCCC
Q 043750 2 LYLSKNNFERIPKSIIQLSKLSCLYLSYCGKLQSLPKLP---CSLHKLHAHHCTALESLSGLFPKSYESCPPRFELNGNY 78 (149)
Q Consensus 2 L~L~~~~~~~lP~si~~L~~L~~L~L~~c~~L~~lP~l~---~~L~~L~~~~C~sL~~~~~~~~~~~~~~~~~l~~~nC~ 78 (149)
|+|++|.+..+|..+..+++|+.|+|++|.....+|... .+|+.|++.+|..+..+|..+. .+..++.|++.+|.
T Consensus 211 L~L~~N~l~~l~~~l~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~~p~~~~--~l~~L~~L~L~~n~ 288 (328)
T 4fcg_A 211 LKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIH--RLTQLEKLDLRGCV 288 (328)
T ss_dssp EEEESSCCCCCCGGGGGCTTCCEEECTTCTTCCBCCCCTTCCCCCCEEECTTCTTCCBCCTTGG--GCTTCCEEECTTCT
T ss_pred EEccCCCCCcCchhhccCCCCCEEECcCCcchhhhHHHhcCCCCCCEEECCCCCchhhcchhhh--cCCCCCEEeCCCCC
Confidence 444444444444444444555555555444444444332 3444555555544444443211 22334455555555
Q ss_pred CCc
Q 043750 79 NLD 81 (149)
Q Consensus 79 ~L~ 81 (149)
.+.
T Consensus 289 ~~~ 291 (328)
T 4fcg_A 289 NLS 291 (328)
T ss_dssp TCC
T ss_pred chh
Confidence 443
|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 149 | ||||
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 1e-04 |
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Leucine rich effector protein YopM domain: Leucine rich effector protein YopM species: Yersinia pestis [TaxId: 632]
Score = 38.3 bits (87), Expect = 1e-04
Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 4/51 (7%)
Query: 1 YLYLSKNNFERIPKSIIQLSKLSCLYLSYCGKLQSLPKLPCSLHKLHAHHC 51
L +S N +P +L L S+ L +P+LP +L +LH +
Sbjct: 288 ELNVSNNKLIELPALP---PRLERLIASFN-HLAEVPELPQNLKQLHVEYN 334
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.39 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.19 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.01 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.99 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.91 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 97.76 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.75 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.7 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.7 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.58 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.57 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.39 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.31 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.27 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.2 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.19 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.15 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.12 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.11 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.06 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.04 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.0 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 96.99 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 96.99 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 96.96 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 96.89 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 96.77 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 96.74 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 96.57 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 96.46 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 96.43 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 95.58 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 95.02 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 88.64 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 84.8 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 83.64 |
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain domain: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=98.39 E-value=2.5e-07 Score=62.31 Aligned_cols=70 Identities=26% Similarity=0.241 Sum_probs=44.8
Q ss_pred CEEccCCCccccchhhcCCCCCCEEccccccccccCCCCC---CCccEEccccccccccccCCCCCCCCCCCCeeEecC
Q 043750 1 YLYLSKNNFERIPKSIIQLSKLSCLYLSYCGKLQSLPKLP---CSLHKLHAHHCTALESLSGLFPKSYESCPPRFELNG 76 (149)
Q Consensus 1 ~L~L~~~~~~~lP~si~~L~~L~~L~L~~c~~L~~lP~l~---~~L~~L~~~~C~sL~~~~~~~~~~~~~~~~~l~~~n 76 (149)
.|+|++|++..+|. +.++.+|++|++++++ ++.+|... .+|+.|++.+. .++.++... .+..++.+++.+
T Consensus 2 ~L~Ls~n~l~~l~~-l~~l~~L~~L~ls~N~-l~~lp~~~~~l~~L~~L~l~~N-~i~~l~~~~---~l~~L~~L~l~~ 74 (124)
T d1dcea3 2 VLHLAHKDLTVLCH-LEQLLLVTHLDLSHNR-LRALPPALAALRCLEVLQASDN-ALENVDGVA---NLPRLQELLLCN 74 (124)
T ss_dssp EEECTTSCCSSCCC-GGGGTTCCEEECCSSC-CCCCCGGGGGCTTCCEEECCSS-CCCCCGGGT---TCSSCCEEECCS
T ss_pred EEEcCCCCCCCCcc-cccCCCCCEEECCCCc-cCcchhhhhhhhcccccccccc-cccccCccc---cccccCeEECCC
Confidence 37788888887774 7888888888888776 77777532 56777777764 355554321 223344555544
|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|